Summary

1. Notes

2. Result Statistics

Figure 1. False discovery rate (FDR) curve. X axis is the number of peptide-spectrum matches (PSM) being kept. Y axis is the corresponding FDR.

Figure 2. PSM score distribution. (a) Distribution of PEAKS peptide score; (b) Scatterplot of PEAKS peptide score versus precursor mass error.

**(a)**

**(b)**

Figure 3. De novo result validation. Distribution of residue local confidence: (a) Residues in de novo sequences validated by confident database peptide assignment; (b) Residues in "de novo only" sequences.

**(a)**

**(b)**

**Table 1.** Statistics of data.
# of MS scans	28645
# of MS/MS scans	89084

**Table 2.** Result filtration parameters.
Peptide -10lgP	≥20
Peptide Ascore	≥0
Protein -10lgP	≥20
Proteins unique peptides	≥2
De novo ALC Score	≥50%

**Table 3.** Statistics of filtered result.
Peptide-Spectrum Matches	40639
Peptide sequences	24003
Protein groups	2534
Proteins	5802
Proteins (#Unique Peptides)	4654 (>2); 1148 (=2); 0 (=1);
FDR (Peptide-Spectrum Matches)	0.0%
FDR (Peptide Sequences)	0.1%
FDR (Protein)	0.0%
De Novo Only Spectra	8816

**Table 4.** PTM profile.
Name	∆Mass	Position	#PSM	-10lgP	Area	AScore
Carbamidomethyl	57.02	C	7520	69.03	7.3E7	1000.00
Oxidation	15.99	M	798	60.99	4.18E7	1000.00
Phe->Tyr	15.99	Y	328	58.61	1.79E7	1000.00
Tyr->Phe	-15.99	F	129	53.45	7.46E8	1000.00

3. Experiment Control

Figure 4. Precursor mass error of peptide-spectrum matches (PSM) in filtered result. (a) Distribution of precursor mass error in ppm; (b) Scatterplot of precursor m/z versus precursor mass error in ppm.

**(a)**

**(b)**

Table 5. Number of identified peptides in each sample by the number of missed cleavages

Missed Cleavages	0	1	2	3	4+
Sample 3	18299	4720	844	140	0

4. Other Information

**Table 6.** Search parameters.
Search Engine Name: PEAKS Parent Mass Error Tolerance: 20.0 ppm Fragment Mass Error Tolerance: 0.5 Da Precursor Mass Search Type: monoisotopic Enzyme: Trypsin Max Missed Cleavages: 3 Non-specific Cleavage: both Fixed Modifications: Carbamidomethylation: 57.02 Variable Modifications: Oxidation (M): 15.99 Phe->Tyr substitution: 15.99 Tyr->Phe substitution: -15.99 Max Variable PTM Per Peptide: 3 Database: arabidopsis Taxon: All Contaminant Database: contaminants Searched Entry: 89449 FDR Estimation: Enabled Merge Options: no merge Precursor Options: corrected Charge Options: no correction Filter Options: no filter Process: true

**Table 7.** Instrument parameters.
Fractions: 20190523-10-H3.raw Ion Source: ESI(nano-spray) Fragmentation Mode: CID, CAD(y and b ions) MS Scan Mode: FT-ICR/Orbitrap MS/MS Scan Mode: Linear Ion Trap

Protein List

Protein Accession Contains:

Protein Description Contains:

Peptide Sample Area >=

Protein Ptm Contains:

Protein Group	Protein ID	Accession	-10lgP	Coverage (%)	Coverage (%) Sample 3	Area Sample 3	#Peptides	#Unique	#Spec Sample 3	PTM	Avg. Mass	Description
5	1	A0A178UTF1	284.01	77	77	8.11E9	75	39	277	Y	112925	Glycine cleavage system P protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g37830 PE=3 SV=1
5	2	Q94B78	284.01	77	77	8.11E9	75	39	277	Y	112925	Glycine dehydrogenase (decarboxylating) 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GLDP1 PE=1 SV=2
3	3	A0A178VCN3	275.72	78	78	3.5E10	89	78	329	Y	59721	PYK10 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g08880 PE=3 SV=1
3	4	Q9SR37	275.72	78	78	3.5E10	89	78	329	Y	59721	Beta-glucosidase 23 OS=Arabidopsis thaliana OX=3702 GN=BGLU23 PE=1 SV=1
2	23	A0A1B1W4U8	267.13	88	88	5.38E10	91	91	455	Y	52955	Ribulose bisphosphate carboxylase large chain OS=Arabidopsis thaliana OX=3702 GN=rbcL PE=3 SV=1
2	24	O03042	267.13	88	88	5.38E10	91	91	455	Y	52955	Ribulose bisphosphate carboxylase large chain OS=Arabidopsis thaliana OX=3702 GN=rbcL PE=1 SV=1
9	37	O80988	266.40	73	73	1.6E9	66	30	210	Y	113776	Glycine dehydrogenase (decarboxylating) 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GLDP2 PE=1 SV=1
10	14	Q9SZJ5	262.78	87	87	1.15E10	65	50	205	Y	57401	Serine hydroxymethyltransferase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SHM1 PE=1 SV=1
10	15	A0A178UYX1	262.78	87	87	1.15E10	65	50	205	Y	57401	Serine hydroxymethyltransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g43250 PE=3 SV=1
4	7	A0A1B1W4V2	252.50	91	91	2.72E10	65	61	319	Y	53934	ATP synthase subunit beta, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=atpB PE=3 SV=1
4	8	P19366	252.50	91	91	2.72E10	65	61	319	Y	53934	ATP synthase subunit beta, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=atpB PE=1 SV=2
19	39	A0A178VEN0	247.63	80	80	1.91E9	63	40	142	Y	61281	HSP60-3B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g25900 PE=3 SV=1
19	40	P29197	247.63	80	80	1.91E9	63	40	142	Y	61281	Chaperonin CPN60, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CPN60 PE=1 SV=2
18	57	O04310	245.70	62	62	6.91E9	51	49	142	Y	72474	Jacalin-related lectin 34 OS=Arabidopsis thaliana OX=3702 GN=JAL34 PE=1 SV=1
11	110	A0A1B1W4S8	245.11	67	67	1.39E10	50	44	191	Y	55328	ATP synthase subunit alpha, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=atpA PE=3 SV=1
11	111	P56757	245.11	67	67	1.39E10	50	44	191	Y	55328	ATP synthase subunit alpha, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=atpA PE=1 SV=1
6	511	O04314	244.55	97	97	1.32E10	48	43	260	Y	32158	PYK10-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=PBP1 PE=1 SV=1
20	10	O23654	244.34	88	88	4.02E9	57	57	137	Y	68813	V-type proton ATPase catalytic subunit A OS=Arabidopsis thaliana OX=3702 GN=VHA-A PE=1 SV=1
20	11	Q0WLF6	244.34	88	88	4.02E9	57	57	137	Y	68813	AT1G78900 protein OS=Arabidopsis thaliana OX=3702 GN=At1g78900 PE=2 SV=1
20	12	A0A384LM33	244.34	88	88	4.02E9	57	57	137	Y	68813	VHA-A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g73590 PE=3 SV=1
41	73	A0A178WBS0	243.53	78	78	1.79E9	66	66	116	Y	93891	LOS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g50740 PE=4 SV=1
41	74	Q9ASR1	243.53	78	78	1.79E9	66	66	116	Y	93891	Elongation factor 2 OS=Arabidopsis thaliana OX=3702 GN=LOS1 PE=1 SV=1
13	71	A0A178WFZ3	243.30	80	80	9.27E9	47	47	152	Y	44445	Aminomethyltransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g12220 PE=3 SV=1
13	72	O65396	243.30	80	80	9.27E9	47	47	152	Y	44445	Aminomethyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GDCST PE=2 SV=1
13	76	A0A2H1ZEA9	243.30	77	77	9.27E9	47	47	152	Y	46352	Aminomethyltransferase OS=Arabidopsis thaliana OX=3702 GN=At1g11860 PE=3 SV=1
47	84	A0A178VEI0	240.10	76	76	2.96E9	51	39	113	Y	79968	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g55130 PE=4 SV=1
47	85	Q8RWV0	240.10	76	76	2.96E9	51	39	113	Y	79968	Transketolase-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TKL-1 PE=1 SV=1
55	53	O80860	239.56	65	65	9.53E8	42	19	94	Y	74157	ATP-dependent zinc metalloprotease FTSH 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FTSH2 PE=1 SV=1
55	54	A0A178W2Q8	239.56	65	65	9.53E8	42	19	94	Y	74157	VAR2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g27100 PE=3 SV=1
55	55	A0A1P8AXC1	239.56	65	65	9.53E8	42	19	94	Y	74678	FtsH extracellular protease family OS=Arabidopsis thaliana OX=3702 GN=VAR2 PE=3 SV=1
36	417	Q9ZP06	239.38	83	83	5.46E9	43	26	129	Y	35804	Malate dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g53240 PE=1 SV=1
36	418	A0A178WFE8	239.38	83	83	5.46E9	43	26	129	Y	35776	Malate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g47550 PE=3 SV=1
23	46	Q9M5K3	239.09	81	81	2.2E9	46	31	134	Y	53988	Dihydrolipoyl dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LPD1 PE=1 SV=2
23	47	A0A178W162	239.09	81	81	2.2E9	46	31	134	Y	53988	Dihydrolipoyl dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g42080 PE=3 SV=1
49	139	Q9ZNZ7	238.81	57	57	1.09E9	62	53	106	Y	176751	Ferredoxin-dependent glutamate synthase 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GLU1 PE=1 SV=3
49	140	A0A178UNU3	238.81	57	57	1.09E9	62	53	106	Y	176751	GLUS OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g03510 PE=4 SV=1
16	642	A0A178UTK6	238.24	71	71	4.83E9	40	16	141	Y	35142	PSBO1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g66530 PE=4 SV=1
16	643	P23321	238.24	71	71	4.83E9	40	16	141	Y	35142	Oxygen-evolving enhancer protein 1-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSBO1 PE=1 SV=2
42	59	A0A178VSN5	237.78	53	53	3.86E8	58	18	115	Y	104224	Plasma membrane ATPase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g14320 PE=3 SV=1
42	60	P20649	237.78	53	53	3.86E8	58	18	115	Y	104224	ATPase 1, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=AHA1 PE=1 SV=3
38	51	O50008	237.78	65	65	1.37E9	50	26	114	Y	84357	5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=MS1 PE=1 SV=1
59	104	F4IVR2	237.70	78	78	8.29E8	53	30	102	Y	61478	Heat shock protein 60-2 OS=Arabidopsis thaliana OX=3702 GN=HSP60-2 PE=1 SV=1
59	106	A0A178VPJ6	237.70	78	78	8.29E8	53	30	102	Y	61861	HSP60-2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g29650 PE=3 SV=1
59	107	Q8L7B5	237.70	77	77	8.29E8	53	30	102	Y	61979	Chaperonin CPN60-like 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g33210 PE=1 SV=1
7	32	P83483	237.68	82	82	4.06E8	54	4	225	Y	59671	ATP synthase subunit beta-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g08670 PE=1 SV=1
7	33	P83484	237.68	82	82	4.06E8	54	4	225	Y	59713	ATP synthase subunit beta-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g08690 PE=1 SV=1
7	34	A0A178UQU4	237.68	82	82	4.06E8	54	4	225	Y	59713	ATP synthase subunit beta OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g08610 PE=3 SV=1
31	79	P10896	236.24	76	76	1.85E8	42	2	128	Y	51981	Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RCA PE=1 SV=2
56	114	Q8LPR9	236.16	56	56	1.52E9	55	55	98	Y	112120	Protein TIC110, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIC110 PE=1 SV=1
25	142	A0A178VV24	234.70	62	62	2.2E9	46	36	123	Y	108201	Aconitate hydratase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g04790 PE=3 SV=1
25	143	Q9SIB9	234.70	62	62	2.2E9	46	36	123	Y	108201	Aconitate hydratase 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ACO3 PE=1 SV=2
40	62	P19456	234.68	51	51	6.09E8	59	19	119	Y	104401	ATPase 2, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=AHA2 PE=1 SV=2
40	63	A0A178UV39	234.68	51	51	6.09E8	59	19	119	Y	104401	Plasma membrane ATPase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g34620 PE=3 SV=1
27	66	Q9LR30	232.87	82	82	2.58E9	48	23	128	Y	53301	Glutamate--glyoxylate aminotransferase 1 OS=Arabidopsis thaliana OX=3702 GN=GGAT1 PE=1 SV=1
27	67	A0A178WG36	232.87	82	82	2.58E9	48	23	128	Y	53301	GGT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g24520 PE=4 SV=1
12	82	A0A2P2CLF9	232.76	72	72	8.89E9	65	58	191	Y	55103	ATP synthase subunit alpha OS=Arabidopsis thaliana OX=3702 GN=atp1 PE=3 SV=1
60	112	Q9FI56	232.70	60	60	5.34E8	53	19	91	Y	103453	Chaperone protein ClpC1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPC1 PE=1 SV=1
60	113	A0A178UE63	232.70	60	60	5.34E8	53	19	91	Y	103453	HSP93-V OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g49710 PE=3 SV=1
76	144	Q9M2T8	228.25	57	57	1.05E9	46	36	87	Y	114218	2-oxoglutarate dehydrogenase, E1 subunit-like protein OS=Arabidopsis thaliana OX=3702 GN=T22E16.70 PE=4 SV=1
76	145	F4IWV2	228.25	56	56	1.05E9	46	36	87	Y	115163	2-oxoglutarate dehydrogenase, E1 component OS=Arabidopsis thaliana OX=3702 GN=At3g55410 PE=1 SV=1
76	146	A0A384KLZ3	228.25	56	56	1.05E9	46	36	87	Y	115163	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g50000 PE=1 SV=1
46	662	Q9S841	228.19	70	70	1.8E9	35	11	112	Y	35019	Oxygen-evolving enhancer protein 1-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSBO2 PE=1 SV=1
46	663	A0A178VBH5	228.19	70	70	1.8E9	35	11	112	Y	35045	PSBO2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g45080 PE=4 SV=1
62	83	Q9LSB4	228.06	70	70	1.1E9	52	52	94	Y	85016	TSA1-like protein OS=Arabidopsis thaliana OX=3702 GN=NAI2 PE=1 SV=1
66	148	A0A178UVE5	227.80	61	61	1.26E9	44	39	87	Y	108481	Aconitate hydratase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g31120 PE=3 SV=1
66	149	Q94A28	227.80	61	61	1.26E9	44	39	87	Y	108481	Aconitate hydratase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ACO2 PE=1 SV=3
35	16	A0A1P8B564	225.59	82	82	2.59E9	39	25	120	Y	56950	Catalase OS=Arabidopsis thaliana OX=3702 GN=CAT2 PE=3 SV=1
35	17	P25819	225.59	82	82	2.59E9	39	25	120	Y	56931	Catalase-2 OS=Arabidopsis thaliana OX=3702 GN=CAT2 PE=1 SV=3
74	49	A0A178UL64	225.27	66	66	3.47E8	41	18	80	Y	71358	HSP70-1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g01630 PE=3 SV=1
74	50	P22953	225.27	66	66	3.47E8	41	18	80	Y	71358	Probable mediator of RNA polymerase II transcription subunit 37e OS=Arabidopsis thaliana OX=3702 GN=MED37E PE=1 SV=3
17	823	Q8W4H8	225.07	69	69	9.99E9	42	39	143	Y	43143	Inactive GDSL esterase/lipase-like protein 23 OS=Arabidopsis thaliana OX=3702 GN=GLL23 PE=1 SV=1
103	265	F4JF64	224.13	58	58	7.7E7	45	12	73	Y	102242	Clp ATPase OS=Arabidopsis thaliana OX=3702 GN=HSP93-III PE=3 SV=1
103	268	A0A178VA06	224.13	57	57	7.7E7	45	12	73	Y	105839	HSP93-III OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g43020 PE=3 SV=1
103	269	Q9SXJ7	224.13	57	57	7.7E7	45	12	73	Y	105739	Chaperone protein ClpC2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPC2 PE=1 SV=1
121	132	O81283	223.42	48	48	5.55E8	44	44	65	Y	160818	Translocase of chloroplast 159, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC159 PE=1 SV=1
88	308	A0A178VB65	223.31	44	44	1.02E8	52	11	75	Y	193270	Clathrin heavy chain OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g08110 PE=3 SV=1
88	309	Q0WLB5	223.31	44	44	1.02E8	52	11	75	Y	193270	Clathrin heavy chain 2 OS=Arabidopsis thaliana OX=3702 GN=CHC2 PE=1 SV=1
34	158	A0A178VBY9	222.88	87	87	1.45E9	34	14	123	Y	40307	GOX2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g15020 PE=3 SV=1
34	159	Q9LRS0	222.88	87	87	1.45E9	34	14	123	Y	40307	(S)-2-hydroxy-acid oxidase GLO2 OS=Arabidopsis thaliana OX=3702 GN=GLO2 PE=1 SV=1
71	42	Q42290	222.77	72	72	3.6E9	36	36	84	Y	59160	Probable mitochondrial-processing peptidase subunit beta, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g02090 PE=1 SV=2
71	43	A0A178V9A9	222.77	72	72	3.6E9	36	36	84	Y	59160	MPPBETA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g01260 PE=3 SV=1
50	20	Q9ZU25	222.69	88	88	2.42E9	34	26	108	Y	54402	Probable mitochondrial-processing peptidase subunit alpha-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g51980 PE=1 SV=1
50	21	A0A178W8B9	222.69	88	88	2.42E9	34	26	108	Y	54402	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g46230 PE=3 SV=1
100	315	A0A178V904	222.50	42	42	7.18E7	52	11	72	Y	193244	Clathrin heavy chain OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g11020 PE=3 SV=1
100	316	Q0WNJ6	222.50	42	42	7.18E7	52	11	72	Y	193244	Clathrin heavy chain 1 OS=Arabidopsis thaliana OX=3702 GN=CHC1 PE=1 SV=1
29	135	A0A178V4S0	221.51	63	63	1.92E9	45	37	127	Y	73075	MtHsc70-1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g43220 PE=3 SV=1
29	136	Q8GUM2	221.51	63	63	1.92E9	45	37	127	Y	73075	Heat shock 70 kDa protein 9, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HSP70-9 PE=1 SV=1
75	122	Q9FH02	221.44	61	61	4.98E8	40	13	84	Y	75232	ATP-dependent zinc metalloprotease FTSH 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FTSH5 PE=1 SV=1
75	123	A0A178U8J6	221.44	61	61	4.98E8	40	13	84	Y	75232	VAR1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g40110 PE=3 SV=1
52	208	P46643	221.40	79	79	3.96E9	32	32	94	Y	47758	Aspartate aminotransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ASP1 PE=1 SV=1
52	209	A0A178VP87	221.40	79	79	3.96E9	32	32	94	Y	47736	Aspartate aminotransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g27120 PE=4 SV=1
128	86	A0A178VKH7	221.11	81	81	2.16E9	39	36	66	Y	58555	ALDH2B4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g41990 PE=3 SV=1
128	87	Q9SU63	221.11	81	81	2.16E9	39	36	66	Y	58589	Aldehyde dehydrogenase family 2 member B4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALDH2B4 PE=1 SV=1
108	29	A0A178VT47	221.09	85	85	1.69E9	31	29	72	Y	47719	LOS2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g33250 PE=3 SV=1
108	30	P25696	221.09	85	85	1.69E9	31	29	72	Y	47719	Bifunctional enolase 2/transcriptional activator OS=Arabidopsis thaliana OX=3702 GN=ENO2 PE=1 SV=1
106	125	Q9LJE4	220.59	68	68	1.05E8	40	8	74	Y	63342	Chaperonin 60 subunit beta 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CPN60B2 PE=1 SV=1
39	305	A0A178UPX1	220.17	51	51	1.81E9	44	36	115	Y	100031	MTHSC70-2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g09130 PE=3 SV=1
22	584	A0A1B1W4X0	219.66	51	51	9.43E9	44	44	131	Y	56037	Photosystem II CP47 reaction center protein OS=Arabidopsis thaliana OX=3702 GN=psbB PE=3 SV=1
22	585	P56777	219.66	51	51	9.43E9	44	44	131	Y	56037	Photosystem II CP47 reaction center protein OS=Arabidopsis thaliana OX=3702 GN=psbB PE=1 SV=1
58	91	Q9M5K2	219.44	74	74	4.89E8	37	22	101	Y	53986	Dihydrolipoyl dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LPD2 PE=1 SV=1
117	126	P21240	219.28	65	65	1.19E8	39	7	70	Y	63809	Chaperonin 60 subunit beta 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CPN60B1 PE=1 SV=3
117	127	A0A178W724	219.28	65	65	1.19E8	39	7	70	Y	63809	LEN1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g50100 PE=3 SV=1
28	160	Q9LRR9	219.14	86	86	1.83E9	39	15	129	Y	40342	(S)-2-hydroxy-acid oxidase GLO1 OS=Arabidopsis thaliana OX=3702 GN=GLO1 PE=1 SV=1
28	161	A0A178VGT8	219.14	84	84	1.83E9	39	15	129	Y	41426	GOX1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g15030 PE=3 SV=1
113	203	Q9XIE2	219.13	38	38	3.77E8	46	25	66	Y	165081	ABC transporter G family member 36 OS=Arabidopsis thaliana OX=3702 GN=ABCG36 PE=1 SV=1
113	204	A0A178W9Z8	219.13	38	38	3.77E8	46	25	66	Y	165082	PEN3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g52980 PE=3 SV=1
65	90	Q42547	218.69	70	70	1.68E9	32	22	93	Y	56695	Catalase-3 OS=Arabidopsis thaliana OX=3702 GN=CAT3 PE=1 SV=3
65	121	A0A1P8AWT7	218.69	63	63	1.68E9	32	22	93	Y	63560	Catalase 3 OS=Arabidopsis thaliana OX=3702 GN=CAT3 PE=1 SV=1
72	101	A0A178V5M8	218.62	73	73	9.93E8	33	18	86	Y	50112	Phosphoglycerate kinase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g12840 PE=3 SV=1
72	102	Q9LD57	218.62	73	73	9.93E8	33	18	86	Y	50112	Phosphoglycerate kinase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGK1 PE=1 SV=1
68	231	F4JQ55	218.55	54	54	1.34E9	44	40	89	Y	94149	Chaperone protein htpG family protein OS=Arabidopsis thaliana OX=3702 GN=SHD PE=1 SV=1
68	232	Q9STX5	218.55	54	54	1.34E9	44	40	89	Y	94204	Endoplasmin homolog OS=Arabidopsis thaliana OX=3702 GN=HSP90-7 PE=1 SV=1
102	191	A0A178WM68	218.43	57	57	9.62E7	35	11	68	Y	73197	FTSH8 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g06050 PE=3 SV=1
102	192	Q8W585	218.43	57	57	9.62E7	35	11	68	Y	73198	ATP-dependent zinc metalloprotease FTSH 8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FTSH8 PE=1 SV=1
64	2096	Q96318	218.42	77	77	1.99E9	31	31	93	Y	58235	12S seed storage protein CRC OS=Arabidopsis thaliana OX=3702 GN=CRC PE=1 SV=1
64	2097	A0A178V3Z1	218.42	74	74	1.99E9	31	31	93	Y	59986	CRU3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g32840 PE=3 SV=1
32	250	P25858	218.25	85	85	2.27E8	41	4	126	Y	36914	Glyceraldehyde-3-phosphate dehydrogenase GAPC1, cytosolic OS=Arabidopsis thaliana OX=3702 GN=GAPC1 PE=1 SV=2
70	80	A0A178WGH9	218.02	79	79	2.87E8	37	6	91	Y	54108	VAB1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g70470 PE=3 SV=1
70	81	P11574	218.02	79	79	2.87E8	37	6	91	Y	54108	V-type proton ATPase subunit B1 OS=Arabidopsis thaliana OX=3702 GN=VHA-B1 PE=2 SV=2
67	129	A0A178VZW6	216.83	66	66	1.49E9	36	35	92	Y	62072	SLP OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g23960 PE=3 SV=1
67	130	P21238	216.83	66	66	1.49E9	36	35	92	Y	62072	Chaperonin 60 subunit alpha 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CPN60A1 PE=1 SV=2
80	64	A0A178WM81	216.79	91	91	5.85E8	36	8	81	Y	42248	HPR OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g62030 PE=3 SV=1
80	65	Q9C9W5	216.79	91	91	5.85E8	36	8	81	Y	42248	Glycerate dehydrogenase HPR, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=HPR PE=1 SV=1
44	184	Q39043	216.10	61	61	1.41E8	51	3	117	Y	73561	Mediator of RNA polymerase II transcription subunit 37f OS=Arabidopsis thaliana OX=3702 GN=MED37F PE=1 SV=2
44	185	A0A178UG43	216.10	61	61	1.41E8	51	3	117	Y	73561	BIP2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g39840 PE=3 SV=1
44	186	A0A1P8BF32	216.10	61	61	1.41E8	51	3	117	Y	74375	Heat shock protein 70 (Hsp 70) family protein OS=Arabidopsis thaliana OX=3702 GN=BIP2 PE=1 SV=1
24	2346	Q9C8S5	215.60	89	89	1.75E9	38	11	120	Y	26548	Chlorophyll a-b binding protein, chloroplastic (Fragment) OS=Arabidopsis thaliana OX=3702 GN=T1P2.1 PE=3 SV=1
24	2347	Q8VZ87	215.60	83	83	1.75E9	38	11	120	Y	28227	Chlorophyll a-b binding protein 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LHCB1.2 PE=1 SV=2
24	2348	P04778	215.60	83	83	1.75E9	38	11	120	Y	28241	Chlorophyll a-b binding protein 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LHCB1.3 PE=1 SV=1
24	2349	A0A178WKX1	215.60	83	83	1.75E9	38	11	120	Y	28241	Chlorophyll a-b binding protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g30320 PE=3 SV=1
24	2350	A0A178W2T0	215.60	83	83	1.75E9	38	11	120	Y	28227	Chlorophyll a-b binding protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g30300 PE=3 SV=1
24	2351	P0CJ48	215.60	83	83	1.75E9	38	11	120	Y	28227	Chlorophyll a-b binding protein 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LHCB1.1 PE=1 SV=1
43	182	Q9LKR3	215.52	62	62	2.25E8	52	4	117	Y	73629	Mediator of RNA polymerase II transcription subunit 37a OS=Arabidopsis thaliana OX=3702 GN=MED37A PE=1 SV=1
81	99	Q9SZN1	214.79	74	74	5.23E7	35	4	84	Y	54305	V-type proton ATPase subunit B2 OS=Arabidopsis thaliana OX=3702 GN=VHA-B2 PE=1 SV=1
81	100	A0A178V0N0	214.79	74	74	5.23E7	35	4	84	Y	54305	VAB2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g43850 PE=3 SV=1
81	105	F4JTQ0	214.79	73	73	5.23E7	35	4	84	Y	55178	ATPase, V1 complex, subunit B protein OS=Arabidopsis thaliana OX=3702 GN=VAB2 PE=1 SV=1
15	330	A0A178WJC9	214.53	63	63	1.09E10	37	36	151	Y	49502	Elongation factor 1-alpha OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g07650 PE=3 SV=1
15	331	Q8W4H7	214.53	63	63	1.09E10	37	36	151	Y	49502	Elongation factor 1-alpha 2 OS=Arabidopsis thaliana OX=3702 GN=A2 PE=1 SV=2
15	332	Q0WL56	214.53	63	63	1.09E10	37	36	151	Y	49502	Elongation factor 1-alpha 3 OS=Arabidopsis thaliana OX=3702 GN=A3 PE=1 SV=2
15	333	P0DH99	214.53	63	63	1.09E10	37	36	151	Y	49502	Elongation factor 1-alpha 1 OS=Arabidopsis thaliana OX=3702 GN=A1 PE=1 SV=1
15	334	Q8GTY0	214.53	63	63	1.09E10	37	36	151	Y	49502	Elongation factor 1-alpha 4 OS=Arabidopsis thaliana OX=3702 GN=A4 PE=1 SV=2
33	248	A0A178W4Q5	214.16	86	86	1.76E8	42	5	127	Y	36913	Glyceraldehyde-3-phosphate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g13910 PE=3 SV=1
33	249	Q9FX54	214.16	86	86	1.76E8	42	5	127	Y	36913	Glyceraldehyde-3-phosphate dehydrogenase GAPC2, cytosolic OS=Arabidopsis thaliana OX=3702 GN=GAPC2 PE=1 SV=1
140	259	Q56WD9	213.74	72	72	1.78E9	27	23	66	Y	48579	3-ketoacyl-CoA thiolase 2, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=PED1 PE=1 SV=2
140	260	A0A178VRP9	213.74	72	72	1.78E9	27	23	66	Y	48579	PKT3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g29580 PE=3 SV=1
118	166	O23255	213.41	74	74	4.86E8	34	15	68	Y	53379	Adenosylhomocysteinase 1 OS=Arabidopsis thaliana OX=3702 GN=SAHH1 PE=1 SV=1
118	167	A0A178UZR5	213.41	74	74	4.86E8	34	15	68	Y	53379	Adenosylhomocysteinase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g15900 PE=3 SV=1
118	168	Q5D6C3	213.41	74	74	4.86E8	34	15	68	Y	53378	Adenosylhomocysteinase OS=Arabidopsis thaliana OX=3702 GN=HOG1 PE=3 SV=1
92	200	P55737	213.36	49	49	2.25E7	42	2	76	Y	80064	Heat shock protein 90-2 OS=Arabidopsis thaliana OX=3702 GN=HSP90-2 PE=1 SV=1
110	133	Q39102	213.30	59	59	1.41E8	36	9	70	Y	76759	ATP-dependent zinc metalloprotease FTSH 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FTSH1 PE=1 SV=2
110	134	A0A178W3Y5	213.30	59	59	1.41E8	36	9	70	Y	76759	FTSH1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g44460 PE=3 SV=1
95	194	P51818	212.86	47	47	7.12E6	42	2	75	Y	80052	Heat shock protein 90-3 OS=Arabidopsis thaliana OX=3702 GN=HSP90-3 PE=1 SV=2
95	195	A0A178U8T0	212.86	47	47	7.12E6	42	2	75	Y	80052	Hsp81.3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g55180 PE=3 SV=1
98	319	A0A178VX39	212.43	80	80	2.88E9	25	25	78	Y	44208	SGAT OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g08510 PE=3 SV=1
98	320	Q56YA5	212.43	80	80	2.88E9	25	25	78	Y	44208	Serine--glyoxylate aminotransferase OS=Arabidopsis thaliana OX=3702 GN=AGT1 PE=1 SV=2
119	108	Q9ZPI6	212.13	66	66	6.33E8	38	36	67	Y	77858	Peroxisomal fatty acid beta-oxidation multifunctional protein AIM1 OS=Arabidopsis thaliana OX=3702 GN=AIM1 PE=1 SV=1
119	109	A0A178UXN1	212.13	66	66	6.33E8	38	36	67	Y	77858	AIM1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g33330 PE=3 SV=1
51	2464	Q9XF89	211.55	71	71	8.97E9	28	28	103	Y	30157	Chlorophyll a-b binding protein CP26, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LHCB5 PE=1 SV=1
51	2465	A0A178UW55	211.55	71	71	8.97E9	28	28	103	Y	30157	Chlorophyll a-b binding protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g11600 PE=3 SV=1
104	236	F4JFN3	210.90	51	51	9.34E8	38	30	73	Y	90567	Heat shock protein 90-6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HSP90-6 PE=1 SV=1
104	237	A0A178VBE8	210.90	51	51	9.34E8	38	30	73	Y	90910	Hsp89.1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g07770 PE=3 SV=1
104	238	A0A178V9D6	210.90	51	51	9.34E8	38	30	73	Y	91989	Hsp89.1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g07770 PE=3 SV=1
14	563	Q0WVD8	210.44	60	60	6.76E9	42	26	141	Y	41476	Adenylate translocator OS=Arabidopsis thaliana OX=3702 GN=At3g08580 PE=2 SV=1
14	564	P31167	210.44	60	60	6.76E9	42	26	141	Y	41476	ADP,ATP carrier protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AAC1 PE=1 SV=2
14	565	A0A384KYV2	210.44	60	60	6.76E9	42	26	141	Y	41476	AAC1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g08150 PE=3 SV=1
190	1101	Q96250	209.63	62	62	1.52E9	23	22	53	Y	35448	ATP synthase subunit gamma, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ATPC PE=1 SV=1
190	1098	A0A178W0Z6	209.63	74	74	1.52E9	23	22	53	Y	29832	ATP synthase subunit gamma OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g29470 PE=3 SV=1
116	1396	Q9LKA3	209.53	82	82	3.1E8	28	11	74	Y	35875	Malate dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g15020 PE=1 SV=1
116	1397	A0A178VBJ9	209.53	82	82	3.1E8	28	11	74	Y	35875	Malate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g15670 PE=3 SV=1
101	115	B9DFQ9	208.17	62	62	1.15E9	33	33	70	Y	81182	AT5G37510 protein OS=Arabidopsis thaliana OX=3702 GN=EMB1467 PE=2 SV=1
101	117	Q9FGI6	208.17	61	61	1.15E9	33	33	70	Y	81526	NADH dehydrogenase [ubiquinone] iron-sulfur protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB1467 PE=1 SV=2
79	675	F4KDZ4	208.17	78	78	3.28E9	18	14	77	Y	34976	Malate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=PMDH2 PE=3 SV=1
79	687	Q9ZP05	208.17	74	74	3.28E9	18	14	77	Y	37369	Malate dehydrogenase 2, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=PMDH2 PE=1 SV=1
79	688	A0A178UMW0	208.17	74	74	3.28E9	18	14	77	Y	37369	Malate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g09190 PE=3 SV=1
84	462	Q8W493	207.70	70	70	1.73E9	34	29	76	Y	41168	Ferredoxin--NADP reductase, leaf isozyme 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LFNR2 PE=1 SV=1
84	463	A0A178WE91	207.70	70	70	1.73E9	34	29	76	Y	41168	Ferredoxin--NADP reductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g21000 PE=3 SV=1
131	354	A0A178UW98	207.29	72	72	2.69E9	29	18	68	Y	42988	Fructose-bisphosphate aldolase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g44320 PE=3 SV=1
131	355	Q944G9	207.29	72	72	2.69E9	29	18	68	Y	42988	Fructose-bisphosphate aldolase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FBA2 PE=1 SV=2
61	2378	A0A178WD57	206.73	69	69	3.26E9	25	15	95	Y	20216	Ribulose bisphosphate carboxylase small chain OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g60950 PE=3 SV=1
61	2379	P10795	206.73	69	69	3.26E9	25	15	95	Y	20216	Ribulose bisphosphate carboxylase small chain 1A, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RBCS-1A PE=1 SV=2
151	119	A0A178VI76	206.51	55	55	1.81E8	31	15	57	Y	71148	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g09090 PE=1 SV=1
151	120	O65719	206.51	55	55	1.81E8	31	15	57	Y	71148	Heat shock 70 kDa protein 3 OS=Arabidopsis thaliana OX=3702 GN=HSP70-3 PE=1 SV=1
57	2700	Q42029	206.24	66	66	5.43E9	22	17	96	Y	28095	Oxygen-evolving enhancer protein 2-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSBP1 PE=1 SV=2
57	2701	A0A178W7Q1	206.24	66	66	5.43E9	22	17	96	Y	28095	PSII-P OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g06320 PE=4 SV=1
96	179	A0A178VKB3	206.09	49	49	1.89E8	33	12	71	Y	84584	MS2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g03170 PE=3 SV=1
96	180	Q9SRV5	206.09	49	49	1.89E8	33	12	71	Y	84584	5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=MS2 PE=1 SV=1
85	251	Q9S7E9	205.99	57	57	3.08E7	31	6	81	Y	53444	Glutamate--glyoxylate aminotransferase 2 OS=Arabidopsis thaliana OX=3702 GN=GGAT2 PE=1 SV=1
85	252	A0A178WFM8	205.99	57	57	3.08E7	31	6	81	Y	53444	GGT2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g64740 PE=4 SV=1
85	253	A0A178WF62	205.99	55	55	3.08E7	31	6	81	Y	55378	GGT2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g64740 PE=4 SV=1
148	228	A0A178WKB4	205.66	68	68	1.52E9	26	22	59	Y	42795	Glyceraldehyde-3-phosphate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g39030 PE=3 SV=1
148	235	P25857	205.66	61	61	1.52E9	26	22	59	Y	47660	Glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GAPB PE=1 SV=2
122	264	A0A178VAA8	205.49	66	66	9.53E8	29	23	68	Y	51121	Acetyltransferase component of pyruvate dehydrogenase complex OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g14420 PE=3 SV=1
122	270	Q8RWN9	205.49	58	58	9.53E8	29	23	68	Y	58468	Dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g13930 PE=1 SV=2
196	362	P93033	205.36	70	70	1.19E9	22	22	46	Y	53000	Fumarate hydratase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FUM1 PE=1 SV=2
196	363	A0A178VMD4	205.36	70	70	1.19E9	22	22	46	Y	53000	FUM1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g45300 PE=3 SV=1
83	515	O82663	204.79	60	60	2.26E9	33	33	82	Y	69656	Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SDH1-1 PE=1 SV=1
83	516	A0A178UAN3	204.79	60	60	2.26E9	33	33	82	Y	69656	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g66760 PE=3 SV=1
142	118	Q9STF2	204.71	60	60	1.04E9	32	32	64	N	54358	Protein PLASTID TRANSCRIPTIONALLY ACTIVE 16, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PTAC16 PE=1 SV=1
126	572	Q9FLH2	204.44	52	52	3.34E8	35	25	66	Y	116399	2-oxoglutarate dehydrogenase, E1 component OS=Arabidopsis thaliana OX=3702 GN=MPA24.10 PE=2 SV=1
126	573	Q9ZRQ2	204.44	52	52	3.34E8	35	25	66	Y	116654	2-oxoglutarate dehydrogenase, E1 subunit OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
82	92	Q94C74	204.42	71	71	2.31E8	32	17	81	Y	57342	Serine hydroxymethyltransferase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SHM2 PE=1 SV=2
82	93	A0A178UER6	204.42	71	71	2.31E8	32	17	81	Y	57342	Serine hydroxymethyltransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g26740 PE=3 SV=1
149	229	A0A178W817	203.88	64	64	1.74E9	32	32	61	Y	51838	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g68850 PE=4 SV=1
149	230	Q9CA67	203.88	64	64	1.74E9	32	32	61	Y	51838	Geranylgeranyl diphosphate reductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CHLP PE=1 SV=1
77	678	P27140	203.84	64	64	2.92E9	33	18	88	Y	37450	Beta carbonic anhydrase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=BCA1 PE=1 SV=2
77	679	A0A178VK19	203.84	64	64	2.92E9	33	18	88	Y	37450	Carbonic anhydrase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g00600 PE=3 SV=1
97	293	Q9XI01	203.73	71	71	9.55E8	35	29	76	Y	55602	Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana OX=3702 GN=PDIL1-1 PE=1 SV=1
97	294	A0A178WAM1	203.73	71	71	9.55E8	35	29	76	Y	55602	Protein disulfide-isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g22850 PE=3 SV=1
97	295	A0A178W8M5	203.73	70	70	9.55E8	35	29	76	Y	57146	Protein disulfide-isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g22850 PE=3 SV=1
53	1462	Q9SMX3	203.40	76	76	4.52E9	25	20	101	Y	29211	Mitochondrial outer membrane protein porin 3 OS=Arabidopsis thaliana OX=3702 GN=VDAC3 PE=1 SV=3
114	116	Q9ZPI5	203.23	63	63	7.68E8	34	33	69	Y	78840	Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 OS=Arabidopsis thaliana OX=3702 GN=MFP2 PE=1 SV=1
152	153	Q0WV25	203.22	87	87	5.57E7	27	2	60	Y	49541	Tubulin alpha-4 chain OS=Arabidopsis thaliana OX=3702 GN=TUBA4 PE=2 SV=2
152	155	A0A178W5L2	203.22	87	87	5.57E7	27	2	60	Y	49541	Tubulin alpha chain OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g04150 PE=3 SV=1
152	156	B9DGT7	203.22	87	87	5.57E7	27	2	60	Y	49541	Tubulin alpha-2 chain OS=Arabidopsis thaliana OX=3702 GN=TUBA2 PE=2 SV=2
54	2027	A0A178UL15	202.96	69	69	2.72E9	26	10	98	Y	20343	Ribulose bisphosphate carboxylase small chain OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g35730 PE=3 SV=1
54	2028	P10798	202.96	69	69	2.72E9	26	10	98	Y	20284	Ribulose bisphosphate carboxylase small chain 3B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RBCS-3B PE=2 SV=2
54	2029	A0A178URY8	202.96	69	69	2.72E9	26	10	98	Y	20284	Ribulose bisphosphate carboxylase small chain OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g35720 PE=3 SV=1
54	2030	P10797	202.96	69	69	2.72E9	26	10	98	Y	20350	Ribulose bisphosphate carboxylase small chain 2B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RBCS-2B PE=2 SV=2
63	546	A0A178UT81	202.86	95	95	2.36E9	32	17	97	Y	28344	Carbonic anhydrase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g14240 PE=3 SV=1
63	561	P42737	202.86	74	74	2.36E9	32	17	97	Y	36615	Beta carbonic anhydrase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=BCA2 PE=1 SV=3
192	77	Q8L7K9	201.80	73	73	5.27E8	32	32	51	Y	66641	NAD-dependent malic enzyme 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NAD-ME2 PE=1 SV=1
192	97	A0A178UTQ3	201.80	67	67	5.27E8	32	32	51	Y	72966	Malic enzyme OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g00720 PE=3 SV=1
105	810	A0A178UIU8	201.55	83	83	3.06E9	22	22	70	Y	31912	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g19680 PE=3 SV=1
105	811	Q9C5M0	201.55	83	83	3.06E9	22	22	70	Y	31912	Mitochondrial dicarboxylate/tricarboxylate transporter DTC OS=Arabidopsis thaliana OX=3702 GN=DTC PE=1 SV=1
144	537	Q9STW6	201.52	45	45	2.63E8	32	15	56	Y	76508	Heat shock 70 kDa protein 6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HSP70-6 PE=1 SV=1
144	538	A0A178V345	201.52	45	45	2.63E8	32	15	56	Y	76508	CpHsc70-1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g28150 PE=3 SV=1
111	512	A0A384L697	201.48	64	64	1.54E9	25	23	69	Y	47411	Glutamine synthetase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g32810 PE=3 SV=1
111	513	Q43127	201.48	64	64	1.54E9	25	23	69	Y	47411	Glutamine synthetase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GLN2 PE=1 SV=1
111	514	B9DGD1	201.48	64	64	1.54E9	25	23	69	Y	47411	Glutamine synthetase OS=Arabidopsis thaliana OX=3702 GN=At5g35630 PE=2 SV=1
123	505	A0A178VLF6	200.76	67	67	5.19E8	26	11	69	Y	42490	Glyceraldehyde-3-phosphate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g28980 PE=3 SV=1
123	506	P25856	200.76	67	67	5.19E8	26	11	69	Y	42490	Glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GAPA1 PE=1 SV=3
153	273	A0A178U9S5	200.67	50	50	3.19E8	37	28	56	Y	108235	Ribonuclease OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g07030 PE=4 SV=1
153	274	Q8VZG7	200.67	50	50	3.19E8	37	28	56	Y	108235	Ribonuclease TUDOR 1 OS=Arabidopsis thaliana OX=3702 GN=TSN1 PE=1 SV=1
203	188	Q9STE8	200.66	54	54	5.97E8	30	30	45	Y	89189	Protein TOC75-3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC75-3 PE=1 SV=1
203	187	A0A178VEL0	200.66	54	54	5.97E8	30	30	45	Y	89245	TOC75-III OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g40640 PE=4 SV=1
89	441	Q9FKW6	200.62	73	73	2.13E9	35	30	74	Y	40327	Ferredoxin--NADP reductase, leaf isozyme 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LFNR1 PE=1 SV=1
89	442	A0A178UAK1	200.62	73	73	2.13E9	35	30	74	Y	40310	Ferredoxin--NADP reductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g66120 PE=3 SV=1
93	291	A0A178UY83	199.80	61	61	1.53E9	29	27	73	Y	51630	Elongation factor Tu OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g23840 PE=3 SV=1
93	292	P17745	199.80	61	61	1.53E9	29	27	73	Y	51630	Elongation factor Tu, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TUFA PE=1 SV=1
127	210	A0A178UP81	199.73	82	82	1.13E8	32	4	65	Y	50734	Tubulin beta chain OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g62230 PE=3 SV=1
127	211	Q56YW9	199.73	82	82	1.13E8	32	4	65	Y	50734	Tubulin beta-2 chain OS=Arabidopsis thaliana OX=3702 GN=TUBB2 PE=2 SV=2
127	212	Q9ASR0	199.73	82	82	1.13E8	32	4	65	Y	50734	Tubulin beta-3 chain OS=Arabidopsis thaliana OX=3702 GN=TUBB3 PE=2 SV=2
132	356	A0A178VBB5	198.96	71	71	1.45E9	26	26	61	Y	55216	POP2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g23870 PE=3 SV=1
132	357	Q94CE5	198.96	71	71	1.45E9	26	26	61	Y	55188	Gamma-aminobutyrate transaminase POP2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=POP2 PE=1 SV=1
185	189	Q9LHA8	198.77	52	52	8.85E7	29	12	54	Y	71102	Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana OX=3702 GN=MED37C PE=1 SV=1
185	190	A0A178VCC0	198.77	52	52	8.85E7	29	12	54	Y	71102	HSP70 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g12610 PE=3 SV=1
183	388	Q9LJL3	198.74	49	49	2.58E8	41	30	50	Y	121015	Presequence protease 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PREP1 PE=1 SV=2
183	389	A0A178VHU1	198.74	49	49	2.58E8	41	30	50	Y	121015	PREP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g20360 PE=4 SV=1
125	1603	O04311	198.67	72	72	1.73E9	21	21	69	N	32023	Jacalin-related lectin 33 OS=Arabidopsis thaliana OX=3702 GN=JAL33 PE=1 SV=1
220	449	A0A178UBE1	198.54	61	61	6.33E8	31	31	48	Y	72322	Mitochondrial Rho GTPase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g27450 PE=3 SV=1
220	450	Q8RXF8	198.54	61	61	6.33E8	31	31	48	Y	72322	Mitochondrial Rho GTPase 1 OS=Arabidopsis thaliana OX=3702 GN=MIRO1 PE=1 SV=1
137	3418	P15455	198.31	60	60	1.6E9	28	27	63	Y	52595	12S seed storage protein CRA1 OS=Arabidopsis thaliana OX=3702 GN=CRA1 PE=1 SV=2
69	1491	A0A1B1W4T4	197.96	41	41	8.08E9	28	28	83	Y	51868	Photosystem II CP43 reaction center protein OS=Arabidopsis thaliana OX=3702 GN=psbC PE=3 SV=1
69	1492	P56778	197.96	41	41	8.08E9	28	28	83	Y	51868	Photosystem II CP43 reaction center protein OS=Arabidopsis thaliana OX=3702 GN=psbC PE=1 SV=3
136	346	Q9LF98	197.86	86	86	7.68E8	28	19	64	Y	38540	Fructose-bisphosphate aldolase 8, cytosolic OS=Arabidopsis thaliana OX=3702 GN=FBA8 PE=1 SV=1
136	347	A0A178V8L4	197.86	86	86	7.68E8	28	19	64	Y	38540	Fructose-bisphosphate aldolase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g47340 PE=3 SV=1
172	321	O82662	197.72	73	73	1.77E9	30	30	54	Y	45346	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g20420 PE=1 SV=1
329	710	A0A384KAQ5	197.62	73	73	2.16E8	28	16	36	Y	60764	IPGAM2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g08160 PE=4 SV=1
329	711	Q9M9K1	197.62	73	73	2.16E8	28	16	36	Y	60764	Probable 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 2 OS=Arabidopsis thaliana OX=3702 GN=At3g08590 PE=1 SV=1
329	712	B9DFU6	197.62	73	73	2.16E8	28	16	36	Y	60764	AT3G08590 protein OS=Arabidopsis thaliana OX=3702 GN=At3g08590 PE=2 SV=1
197	423	C0Z2C0	197.24	69	69	7.58E8	28	20	50	Y	47039	AT1G56340 protein OS=Arabidopsis thaliana OX=3702 GN=At1g56340 PE=2 SV=1
197	424	O04151	197.24	66	66	7.58E8	28	20	50	Y	48527	Calreticulin-1 OS=Arabidopsis thaliana OX=3702 GN=CRT1 PE=1 SV=1
197	425	A0A178W6I8	197.24	66	66	7.58E8	28	20	50	Y	48527	CRT1a OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g51030 PE=3 SV=1
219	196	A0A384KVG9	196.70	39	39	9.06E7	29	12	48	Y	105123	Plasma membrane ATPase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g62210 PE=3 SV=1
219	197	Q9LV11	196.70	39	39	9.06E7	29	12	48	Y	105123	ATPase 11, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=AHA11 PE=1 SV=1
219	198	Q53XH7	196.70	39	39	9.06E7	29	12	48	Y	105123	Plasma membrane ATPase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
236	169	Q8H0U5	196.26	53	53	4.31E8	29	29	46	Y	68342	Protein TIC 62, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIC62 PE=1 SV=1
91	684	Q9SUI9	196.22	75	75	3.64E9	27	26	74	Y	33325	ATP synthase gamma chain, chloroplast (Fragment) OS=Arabidopsis thaliana OX=3702 GN=atpC1 PE=2 SV=1
91	548	A0A178USQ7	196.22	61	61	3.64E9	27	26	74	Y	40911	ATPC1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g05690 PE=3 SV=1
91	549	Q01908	196.22	61	61	3.64E9	27	26	74	Y	40911	ATP synthase gamma chain 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ATPC1 PE=1 SV=1
193	338	Q8VZC3	195.95	65	65	8.84E8	27	27	50	Y	61773	Delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALDH12A1 PE=2 SV=1
182	644	A0A178UEW8	195.40	68	68	1.1E9	26	19	53	Y	44699	Glutamate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g07120 PE=3 SV=1
182	645	Q38946	195.40	68	68	1.1E9	26	19	53	Y	44699	Glutamate dehydrogenase 2 OS=Arabidopsis thaliana OX=3702 GN=GDH2 PE=1 SV=1
78	1193	Q9SRH5	195.25	71	71	2.9E9	25	20	83	Y	29425	Mitochondrial outer membrane protein porin 1 OS=Arabidopsis thaliana OX=3702 GN=VDAC1 PE=1 SV=3
78	1194	A0A178VE16	195.25	71	71	2.9E9	25	20	83	Y	29425	VDAC1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g00320 PE=4 SV=1
167	493	O65202	195.12	62	62	5.65E8	29	25	47	Y	74302	Peroxisomal acyl-coenzyme A oxidase 1 OS=Arabidopsis thaliana OX=3702 GN=ACX1 PE=1 SV=1
73	2026	P10796	195.10	69	69	5.88E8	24	8	85	Y	20286	Ribulose bisphosphate carboxylase small chain 1B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RBCS-1B PE=1 SV=1
218	397	P92994	195.05	60	60	5.2E8	29	29	47	Y	57792	Trans-cinnamate 4-monooxygenase OS=Arabidopsis thaliana OX=3702 GN=CYP73A5 PE=2 SV=1
218	398	B1GV49	195.05	60	60	5.2E8	29	29	47	Y	57792	Cinnamate-4-hydroxylase OS=Arabidopsis thaliana OX=3702 GN=C4H PE=3 SV=1
180	864	Q9LQ31	194.97	53	53	4.63E8	25	25	49	Y	81843	Jacalin-related lectin 4 OS=Arabidopsis thaliana OX=3702 GN=JAL4 PE=2 SV=1
174	233	Q9LK36	194.74	63	63	7.54E7	25	6	54	Y	53159	Adenosylhomocysteinase 2 OS=Arabidopsis thaliana OX=3702 GN=SAHH2 PE=2 SV=1
174	234	A0A178VEP9	194.74	63	63	7.54E7	25	6	54	Y	53159	Adenosylhomocysteinase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g25710 PE=3 SV=1
133	840	A0A178UUR9	194.56	89	89	2.4E9	22	22	66	Y	29565	VDAC2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g67610 PE=4 SV=1
133	841	Q9FJX3	194.56	89	89	2.4E9	22	22	66	Y	29595	Mitochondrial outer membrane protein porin 2 OS=Arabidopsis thaliana OX=3702 GN=VDAC2 PE=1 SV=1
143	374	A0A178UGW7	194.44	82	82	8.58E7	30	6	58	Y	49823	Tubulin beta chain OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g42470 PE=3 SV=1
143	375	P24636	194.44	82	82	8.58E7	30	6	58	Y	49823	Tubulin beta-4 chain OS=Arabidopsis thaliana OX=3702 GN=TUBB4 PE=2 SV=2
112	597	Q93Z83	194.28	71	71	6.99E8	25	4	73	N	39446	AT5g26280/T19G15_130 OS=Arabidopsis thaliana OX=3702 GN=At5g26280 PE=2 SV=1
112	598	A0A1P8BA53	194.28	67	67	6.99E8	25	4	73	N	41632	TRAF-like family protein OS=Arabidopsis thaliana OX=3702 GN=At5g26280 PE=4 SV=1
166	244	Q93ZM8	194.10	37	37	3.47E7	29	11	55	Y	104494	Plasma membrane ATPase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
166	245	P20431	194.10	37	37	3.47E7	29	11	55	Y	104450	ATPase 3, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=AHA3 PE=1 SV=2
166	246	A0A178UHY0	194.10	37	37	3.47E7	29	11	55	Y	104450	Plasma membrane ATPase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g56620 PE=3 SV=1
161	239	Q9FLT0	194.08	48	48	3.12E8	36	27	48	Y	107742	Ribonuclease TUDOR 2 OS=Arabidopsis thaliana OX=3702 GN=TSN2 PE=1 SV=1
176	366	A0A178VPV7	193.73	51	51	3.81E8	31	25	51	Y	88663	HSP90.5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g02980 PE=3 SV=1
176	367	Q9SIF2	193.73	51	51	3.81E8	31	25	51	Y	88663	Heat shock protein 90-5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HSP90-5 PE=1 SV=1
189	383	Q96242	193.51	63	63	5.37E8	28	28	50	N	58197	Allene oxide synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CYP74A PE=1 SV=3
164	392	Q56WH1	193.50	74	74	1.93E8	26	8	57	Y	49654	Tubulin alpha-3 chain OS=Arabidopsis thaliana OX=3702 GN=TUBA3 PE=1 SV=2
164	393	B9DHQ0	193.50	74	74	1.93E8	26	8	57	Y	49654	Tubulin alpha-5 chain OS=Arabidopsis thaliana OX=3702 GN=TUBA5 PE=1 SV=2
164	394	A0A178UTQ9	193.50	74	74	1.93E8	26	8	57	Y	49654	Tubulin alpha chain OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g19690 PE=3 SV=1
200	804	A0A178WA14	193.47	30	30	2.03E9	23	23	50	Y	80820	VHP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g16450 PE=3 SV=1
200	805	P31414	193.47	30	30	2.03E9	23	23	50	Y	80820	Pyrophosphate-energized vacuolar membrane proton pump 1 OS=Arabidopsis thaliana OX=3702 GN=AVP1 PE=1 SV=1
169	733	Q9SJU4	192.87	70	70	1.15E9	24	13	57	Y	42931	Fructose-bisphosphate aldolase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FBA1 PE=1 SV=2
169	734	A0A178VN79	192.87	70	70	1.15E9	24	13	57	Y	42931	Fructose-bisphosphate aldolase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g16800 PE=3 SV=1
158	867	Q9LPW0	192.63	70	70	1.75E8	23	8	58	Y	42847	Glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GAPA2 PE=2 SV=1
158	868	A0A178WA64	192.63	70	70	1.75E8	23	8	58	Y	42847	Glyceraldehyde-3-phosphate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g13340 PE=3 SV=1
158	869	A0A1P8APR6	192.63	63	63	1.75E8	23	8	58	Y	47604	Glyceraldehyde-3-phosphate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=GAPA-2 PE=3 SV=1
146	591	P50318	192.36	60	60	5.46E7	24	6	60	Y	49939	Phosphoglycerate kinase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g56190 PE=1 SV=3
146	592	A0A178W4Q1	192.36	60	60	5.46E7	24	6	60	Y	49939	Phosphoglycerate kinase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g50870 PE=3 SV=1
157	213	A0A178UU99	192.20	77	77	1.45E7	28	2	56	Y	49658	Tubulin beta chain OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g24220 PE=3 SV=1
157	214	P29517	192.20	77	77	1.45E7	28	2	56	Y	49658	Tubulin beta-9 chain OS=Arabidopsis thaliana OX=3702 GN=TUBB9 PE=1 SV=1
129	431	A0A178VUU3	192.09	67	67	1.11E9	32	32	65	Y	52654	Citrate synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g41910 PE=3 SV=1
129	432	P20115	192.09	67	67	1.11E9	32	32	65	Y	52783	Citrate synthase 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CSY4 PE=1 SV=3
235	193	A0A178UYW8	192.00	44	44	4.65E8	32	32	44	Y	107873	Elongation factor Ts, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EFTS PE=3 SV=1
235	183	Q9SZD6	192.00	46	46	4.65E8	32	32	44	Y	103782	Elongation factor Ts, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=emb2726 PE=2 SV=1
87	676	Q9FMU6	191.80	60	60	3.57E9	28	28	77	Y	40090	Mitochondrial phosphate carrier protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPT3 PE=1 SV=1
87	677	A0A178UMU4	191.80	60	60	3.57E9	28	28	77	Y	40090	PHT3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g13490 PE=3 SV=1
262	379	A0A178UEJ4	191.34	58	58	2.2E8	28	25	37	Y	68172	RSW9 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g39890 PE=3 SV=1
262	380	P42697	191.34	58	58	2.2E8	28	25	37	Y	68172	Dynamin-related protein 1A OS=Arabidopsis thaliana OX=3702 GN=DRP1A PE=1 SV=3
141	420	A0A178W9M8	191.28	80	80	8.2E7	29	6	60	Y	50343	Tubulin beta chain OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g20990 PE=3 SV=1
141	421	P29513	191.28	80	80	8.2E7	29	6	60	Y	50343	Tubulin beta-5 chain OS=Arabidopsis thaliana OX=3702 GN=TUBB5 PE=2 SV=1
135	359	Q0WUV8	191.09	63	63	1.73E9	27	25	61	Y	49410	Elongation factor Tu OS=Arabidopsis thaliana OX=3702 GN=At4g02930 PE=2 SV=1
135	361	Q9ZT91	191.09	63	63	1.73E9	27	25	61	Y	49410	Elongation factor Tu, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=TUFA PE=1 SV=1
135	360	A0A178V004	191.09	63	63	1.73E9	27	25	61	Y	49424	Elongation factor Tu OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g03640 PE=3 SV=1
171	405	Q8GYH3	190.63	61	61	3.47E8	24	9	50	Y	44725	Putative 60S ribosomal protein OS=Arabidopsis thaliana OX=3702 GN=At5g02870/F9G14_180 PE=2 SV=1
171	406	P49691	190.63	61	61	3.47E8	24	9	50	Y	44722	60S ribosomal protein L4-2 OS=Arabidopsis thaliana OX=3702 GN=RPL4D PE=1 SV=2
171	407	A0A178UAH8	190.63	61	61	3.47E8	24	9	50	Y	44722	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g02040 PE=4 SV=1
171	492	F4KDU5	190.63	61	61	3.47E8	24	9	50	Y	44593	Ribosomal protein L4/L1 family OS=Arabidopsis thaliana OX=3702 GN=At5g02870 PE=1 SV=1
250	350	A0A178V1X0	190.53	72	72	1.08E9	27	27	42	Y	51718	Serine hydroxymethyltransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g15890 PE=3 SV=1
250	351	O23254	190.53	72	72	1.08E9	27	27	42	Y	51718	Serine hydroxymethyltransferase 4 OS=Arabidopsis thaliana OX=3702 GN=SHM4 PE=1 SV=1
205	242	A0A178V3A8	190.26	41	41	4.14E8	29	19	46	Y	92833	V-type proton ATPase subunit a OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g44440 PE=3 SV=1
205	243	Q8W4S4	190.26	41	41	4.14E8	29	19	46	Y	92833	V-type proton ATPase subunit a3 OS=Arabidopsis thaliana OX=3702 GN=VHA-a3 PE=1 SV=1
208	741	Q9LTX9	189.90	43	43	8.28E7	25	8	45	Y	76997	Heat shock 70 kDa protein 7, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HSP70-7 PE=2 SV=1
186	352	A0A178UPR2	189.45	74	74	7.32E7	29	5	50	Y	50586	Tubulin beta chain OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g11980 PE=3 SV=1
186	353	P29514	189.45	74	74	7.32E7	29	5	50	Y	50586	Tubulin beta-6 chain OS=Arabidopsis thaliana OX=3702 GN=TUBB6 PE=2 SV=1
45	1225	P56767	189.31	32	32	3.99E9	29	28	106	Y	82475	Photosystem I P700 chlorophyll a apoprotein A2 OS=Arabidopsis thaliana OX=3702 GN=psaB PE=3 SV=1
45	1226	A0A1B1W4U2	189.31	32	32	3.99E9	29	28	106	Y	82475	Photosystem I P700 chlorophyll a apoprotein A2 OS=Arabidopsis thaliana OX=3702 GN=psaB PE=3 SV=1
181	949	A0A178WGF2	189.30	57	57	4.81E8	26	13	53	Y	46400	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g51760 PE=4 SV=1
181	950	Q9FVT2	189.30	57	57	4.81E8	26	13	53	Y	46400	Probable elongation factor 1-gamma 2 OS=Arabidopsis thaliana OX=3702 GN=At1g57720 PE=1 SV=1
288	817	A0A178VF16	189.08	66	66	5.81E8	17	15	39	Y	42422	PNAD-MDH OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g41510 PE=4 SV=1
288	818	Q9SN86	189.08	66	66	5.81E8	17	15	39	Y	42406	Malate dehydrogenase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g47520 PE=1 SV=1
366	275	Q8H0S9	188.86	50	50	1.47E8	26	26	31	Y	99159	Puromycin-sensitive aminopeptidase OS=Arabidopsis thaliana OX=3702 GN=MPA1 PE=2 SV=1
366	280	F4I3R1	188.86	45	45	1.47E8	26	26	31	Y	109406	Peptidase M1 family protein OS=Arabidopsis thaliana OX=3702 GN=At1g63770 PE=4 SV=2
366	281	F4I3R0	188.86	45	45	1.47E8	26	26	31	Y	110814	Peptidase M1 family protein OS=Arabidopsis thaliana OX=3702 GN=At1g63770 PE=4 SV=1
86	737	A0A178VGN1	188.42	64	64	2.54E9	28	28	71	Y	39927	Cysteine synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g55720 PE=3 SV=1
86	738	Q9S757	188.42	64	64	2.54E9	28	28	71	Y	39927	Bifunctional L-3-cyanoalanine synthase/cysteine synthase C1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CYSC1 PE=1 SV=1
138	1114	A0A178UBZ3	188.13	53	53	2.24E9	22	22	63	Y	41230	CaS OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g22580 PE=4 SV=1
138	1115	Q9FN48	188.13	53	53	2.24E9	22	22	63	Y	41285	Calcium sensing receptor, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CAS PE=1 SV=1
214	460	A0A178VS27	187.95	72	72	2.69E7	28	2	47	Y	50747	Tubulin beta chain OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g25630 PE=3 SV=1
214	461	P29515	187.95	72	72	2.69E7	28	2	47	Y	50747	Tubulin beta-7 chain OS=Arabidopsis thaliana OX=3702 GN=TUBB7 PE=2 SV=1
257	415	F4ISU2	187.85	31	31	1.39E8	33	32	38	Y	148613	Early endosome antigen OS=Arabidopsis thaliana OX=3702 GN=At2g32240 PE=1 SV=1
199	401	A0A178UJ45	187.53	55	55	7.22E8	26	26	50	Y	53450	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g08420 PE=3 SV=1
199	402	Q9FNN5	187.53	55	55	7.22E8	26	26	50	Y	53450	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g08530 PE=1 SV=1
194	951	Q9SJQ9	187.22	79	79	3.49E8	22	13	50	Y	38387	Fructose-bisphosphate aldolase 6, cytosolic OS=Arabidopsis thaliana OX=3702 GN=FBA6 PE=1 SV=1
194	952	A0A178VRN7	187.22	79	79	3.49E8	22	13	50	Y	38387	Fructose-bisphosphate aldolase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g33200 PE=3 SV=1
280	282	F4HS98	187.12	26	26	1.32E8	28	24	37	Y	197498	Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g01320 PE=1 SV=1
280	283	A0A1P8AR50	187.12	26	26	1.32E8	28	24	37	Y	197740	Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g01320 PE=1 SV=1
280	287	A0A178W3B9	187.12	26	26	1.32E8	28	24	37	Y	197640	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g00370 PE=4 SV=1
280	284	F4HS99	187.12	26	26	1.32E8	28	24	37	Y	198773	Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g01320 PE=1 SV=1
206	224	B9DI55	187.00	58	58	3.36E8	33	33	48	Y	89393	AT3G09840 protein OS=Arabidopsis thaliana OX=3702 GN=At3g09840 PE=2 SV=1
206	225	A0A384KA82	187.00	58	58	3.36E8	33	33	48	Y	89393	CDC48A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g09510 PE=4 SV=1
206	226	P54609	187.00	58	58	3.36E8	33	33	48	Y	89393	Cell division control protein 48 homolog A OS=Arabidopsis thaliana OX=3702 GN=CDC48A PE=1 SV=1
245	606	A0A178W104	186.61	75	75	5.25E8	25	24	43	Y	43936	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g15660 PE=4 SV=1
245	607	Q9SK66	186.61	75	75	5.25E8	25	24	43	Y	43936	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g20360 PE=1 SV=2
177	490	A0A178VDX8	186.35	62	62	2.97E8	22	7	49	Y	44702	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g09270 PE=4 SV=1
177	491	Q9SF40	186.35	62	62	2.97E8	22	7	49	Y	44702	60S ribosomal protein L4-1 OS=Arabidopsis thaliana OX=3702 GN=RPL4A PE=1 SV=1
184	453	A0A178WA01	186.09	54	54	7.64E7	38	17	55	Y	99971	DRP2B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g52690 PE=3 SV=1
184	454	Q9LQ55	186.09	54	54	7.64E7	38	17	55	Y	100228	Dynamin-2B OS=Arabidopsis thaliana OX=3702 GN=DRP2B PE=1 SV=2
184	455	G1JSJ5	186.09	54	54	7.64E7	38	17	55	Y	100228	At1g59610 OS=Arabidopsis thaliana OX=3702 GN=At1g59610 PE=3 SV=1
303	708	Q9SPK5	186.02	60	60	2.11E8	23	23	34	Y	67802	Formate--tetrahydrofolate ligase OS=Arabidopsis thaliana OX=3702 GN=THFS PE=2 SV=1
263	339	A0A1I9LSH2	185.88	42	42	2.07E8	32	32	39	Y	129467	Carbohydrate-binding-like fold OS=Arabidopsis thaliana OX=3702 GN=At3g62360 PE=4 SV=1
294	298	Q93ZM7	185.63	57	57	4.03E8	24	24	40	Y	60467	Chaperonin CPN60-like 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g13860 PE=1 SV=2
294	299	A0A178VQ15	185.63	57	57	4.03E8	24	24	40	Y	60467	HSP60-3A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g14320 PE=3 SV=1
107	1539	Q07473	185.39	63	63	1.93E9	20	10	70	Y	31139	Chlorophyll a-b binding protein CP29.1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LHCB4.1 PE=1 SV=1
107	1540	A0A384LC70	185.39	63	63	1.93E9	20	10	70	Y	31139	Chlorophyll a-b binding protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g00570 PE=3 SV=1
107	1541	Q0WW97	185.39	63	63	1.93E9	20	10	70	Y	31139	Chlorophyll a-b binding protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g01530 PE=2 SV=1
358	485	Q9SAK4	185.23	46	46	2.26E8	22	22	31	Y	56559	Succinate-semialdehyde dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALDH5F1 PE=1 SV=2
358	486	A0A178W894	185.23	46	46	2.26E8	22	22	31	Y	56545	Succinate-semialdehyde dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g74230 PE=3 SV=1
247	602	Q9C8G5	185.21	37	37	5.45E8	23	23	36	Y	81935	CSC1-like protein ERD4 OS=Arabidopsis thaliana OX=3702 GN=ERD4 PE=1 SV=1
295	373	F4JKH6	185.04	25	25	9.15E7	29	24	33	Y	199114	Protein TSS OS=Arabidopsis thaliana OX=3702 GN=TSS PE=1 SV=1
379	215	Q940M2	184.79	70	70	4.23E8	23	23	33	Y	51953	Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AGT2 PE=1 SV=1
379	216	Q0WUN0	184.79	70	70	4.23E8	23	23	33	Y	51953	Alanine:glyoxylate aminotransferase 2 homolog OS=Arabidopsis thaliana OX=3702 GN=At4g39660 PE=2 SV=1
237	1358	A0A178VHF3	184.32	83	83	2.99E8	19	5	41	Y	34133	60S acidic ribosomal protein P0 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g08820 PE=3 SV=1
237	1359	Q42112	184.32	83	83	2.99E8	19	5	41	Y	34133	60S acidic ribosomal protein P0-2 OS=Arabidopsis thaliana OX=3702 GN=RPP0B PE=1 SV=2
215	456	A0A178W930	184.13	62	62	2.98E8	24	18	45	Y	56365	Protein disulfide-isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g72080 PE=3 SV=1
215	457	Q9SRG3	184.13	62	62	2.98E8	24	18	45	Y	56365	Protein disulfide isomerase-like 1-2 OS=Arabidopsis thaliana OX=3702 GN=PDIL1-2 PE=2 SV=1
216	795	P25697	183.93	67	67	1.03E9	20	20	49	Y	44464	Phosphoribulokinase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g32060 PE=1 SV=1
216	796	A0A178WLP9	183.93	67	67	1.03E9	20	20	49	Y	44464	Phosphoribulokinase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g32760 PE=3 SV=1
448	918	A0A178VST0	183.88	68	68	2.56E8	22	22	29	Y	50521	JAL22 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g36220 PE=4 SV=1
448	917	O80950	183.88	68	68	2.56E8	22	22	29	Y	50463	Jacalin-related lectin 22 OS=Arabidopsis thaliana OX=3702 GN=JAL22 PE=1 SV=1
168	1228	A0A1P8B9N1	183.82	68	68	1.71E9	27	27	54	Y	39630	Formate dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FDH PE=3 SV=1
168	1230	A0A1P8B9L1	183.82	65	65	1.71E9	27	27	54	Y	41038	Formate dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FDH PE=3 SV=1
168	1231	Q9S7E4	183.82	63	63	1.71E9	27	27	54	Y	42410	Formate dehydrogenase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FDH1 PE=1 SV=1
168	1232	A0A178UHK7	183.82	63	63	1.71E9	27	27	54	Y	42410	Formate dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g14280 PE=3 SV=1
120	2397	A0A1B1W4U0	183.55	41	41	5.86E9	25	25	67	Y	39548	Photosystem II D2 protein OS=Arabidopsis thaliana OX=3702 GN=psbD PE=3 SV=1
120	2398	P56761	183.55	41	41	5.86E9	25	25	67	Y	39548	Photosystem II D2 protein OS=Arabidopsis thaliana OX=3702 GN=psbD PE=1 SV=3
239	263	P29402	183.48	47	47	6.12E8	23	15	43	Y	60486	Calnexin homolog 1 OS=Arabidopsis thaliana OX=3702 GN=CNX1 PE=1 SV=1
230	465	O82660	183.31	62	62	6.53E8	22	22	43	N	44104	Photosystem II stability/assembly factor HCF136, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HCF136 PE=1 SV=1
230	552	A0A178UP93	183.31	62	62	6.53E8	22	22	43	N	44032	HCF136 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g22660 PE=4 SV=1
230	466	A0A1P8BG37	183.31	59	59	6.53E8	22	22	43	N	46914	Photosystem II stability/assembly factor, chloroplast (HCF136) OS=Arabidopsis thaliana OX=3702 GN=HCF136 PE=4 SV=1
279	682	A0A178W5M3	183.12	19	19	9.29E7	33	32	37	Y	284775	ILA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g58380 PE=4 SV=1
279	683	A0A1P8AT97	183.12	19	19	9.29E7	33	32	37	Y	293156	ILITYHIA OS=Arabidopsis thaliana OX=3702 GN=ILA PE=1 SV=1
139	1562	Q9XF88	182.87	64	64	1.14E9	21	10	58	Y	31194	Chlorophyll a-b binding protein CP29.2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LHCB4.2 PE=1 SV=1
307	978	A0A178V7Z2	182.86	61	61	1.1E9	19	17	38	Y	44018	ESM1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g14780 PE=3 SV=1
307	979	Q9LJG3	182.86	61	61	1.1E9	19	17	38	Y	44060	GDSL esterase/lipase ESM1 OS=Arabidopsis thaliana OX=3702 GN=ESM1 PE=1 SV=1
266	706	Q8LFC0	182.80	57	57	3.46E8	20	14	40	Y	39627	Isocitrate dehydrogenase [NAD] regulatory subunit 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH1 PE=1 SV=2
266	707	A0A178UVS2	182.80	57	57	3.46E8	20	14	40	Y	39627	IDH1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g40290 PE=4 SV=1
305	240	A0A178WCD2	182.38	39	39	2.36E8	26	25	38	Y	86058	Elongation factor G, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g56040 PE=3 SV=1
305	241	Q9SI75	182.38	39	39	2.36E8	26	25	38	Y	86058	Elongation factor G, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CPEFG PE=1 SV=1
276	326	A0A384KTL6	182.36	60	60	4.21E8	21	14	39	Y	53707	Phosphotransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g33470 PE=3 SV=1
276	327	Q0WLE0	182.36	60	60	4.21E8	21	14	39	Y	53707	Phosphotransferase OS=Arabidopsis thaliana OX=3702 GN=At4g29130 PE=2 SV=1
276	328	Q42525	182.36	60	60	4.21E8	21	14	39	Y	53707	Hexokinase-1 OS=Arabidopsis thaliana OX=3702 GN=HXK1 PE=1 SV=2
210	1030	P93819	182.22	70	70	5.85E8	21	9	49	Y	35571	Malate dehydrogenase 1, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=MDH1 PE=1 SV=2
210	1031	A0A178W4H0	182.22	70	70	5.85E8	21	9	49	Y	35571	Malate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g03690 PE=3 SV=1
222	1401	P48491	182.08	81	81	8.83E8	20	17	46	Y	27169	Triosephosphate isomerase, cytosolic OS=Arabidopsis thaliana OX=3702 GN=CTIMC PE=1 SV=2
222	1402	A0A178VM57	182.08	81	81	8.83E8	20	17	46	Y	27169	TPI OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g50030 PE=3 SV=1
316	638	F4J5S0	181.90	32	32	1.42E8	25	25	30	Y	152524	Clustered mitochondria protein homolog OS=Arabidopsis thaliana OX=3702 GN=NOXY38 PE=3 SV=1
316	617	A0A178VKH1	181.90	32	32	1.42E8	25	25	30	Y	153266	Clustered mitochondria protein homolog OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g46560 PE=3 SV=1
316	618	F4J5S1	181.90	32	32	1.42E8	25	25	30	Y	153688	Clustered mitochondria protein OS=Arabidopsis thaliana OX=3702 GN=FMT PE=2 SV=1
316	620	F4J5R9	181.90	32	32	1.42E8	25	25	30	Y	155167	Clustered mitochondria protein homolog OS=Arabidopsis thaliana OX=3702 GN=NOXY38 PE=3 SV=1
322	855	A0A178VAM3	181.84	83	83	3.73E7	21	2	37	Y	40788	V-type proton ATPase subunit OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g31380 PE=3 SV=1
322	856	Q9LHA4	181.84	83	83	3.73E7	21	2	37	Y	40788	V-type proton ATPase subunit d2 OS=Arabidopsis thaliana OX=3702 GN=VHA-d2 PE=2 SV=1
338	271	Q38882	181.71	49	49	2.14E8	24	24	33	Y	91848	Phospholipase D alpha 1 OS=Arabidopsis thaliana OX=3702 GN=PLDALPHA1 PE=1 SV=2
338	272	A0A178VKX2	181.71	49	49	2.14E8	24	24	33	Y	91848	Phospholipase D OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g16510 PE=3 SV=1
297	716	Q84WU8	181.66	50	50	1.65E8	29	20	37	Y	89353	ATP-dependent zinc metalloprotease FTSH 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FTSH3 PE=1 SV=1
297	717	A0A178VS82	181.66	50	50	1.65E8	29	20	37	Y	89353	Ftsh3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g25190 PE=3 SV=1
173	2835	Q9S7M0	181.53	58	58	3.5E9	16	14	49	Y	28707	Chlorophyll a-b binding protein 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LHCB3 PE=1 SV=1
173	2836	A0A178USW4	181.53	58	58	3.5E9	16	14	49	Y	28707	Chlorophyll a-b binding protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g53320 PE=3 SV=1
223	410	F4I576	181.45	59	59	9.25E8	23	23	48	Y	52115	Monodehydroascorbate reductase 6 OS=Arabidopsis thaliana OX=3702 GN=MDAR6 PE=4 SV=1
223	411	B9DGR6	181.45	59	59	9.25E8	23	23	48	Y	52502	AT1G63940 protein OS=Arabidopsis thaliana OX=3702 GN=At1g63940 PE=2 SV=1
223	412	A0A384KW24	181.45	59	59	9.25E8	23	23	48	Y	52502	MDAR6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g57390 PE=4 SV=1
223	413	P92947	181.45	58	58	9.25E8	23	23	48	Y	53302	Monodehydroascorbate reductase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MDAR5 PE=1 SV=3
223	414	A0A178WFH3	181.45	58	58	9.25E8	23	23	48	Y	53302	MDAR6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g57390 PE=4 SV=1
198	566	Q9SE83	181.10	48	48	4.32E7	37	16	49	Y	99166	Dynamin-2A OS=Arabidopsis thaliana OX=3702 GN=DRP2A PE=1 SV=2
198	567	A0A178WBB3	181.10	48	48	4.32E7	37	16	49	Y	99166	DRP2A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g10360 PE=3 SV=1
124	788	A0A1B1W4T6	180.92	41	41	2.71E9	29	28	64	Y	83231	Photosystem I P700 chlorophyll a apoprotein A1 OS=Arabidopsis thaliana OX=3702 GN=psaA PE=3 SV=1
124	789	P56766	180.92	41	41	2.71E9	29	28	64	Y	83231	Photosystem I P700 chlorophyll a apoprotein A1 OS=Arabidopsis thaliana OX=3702 GN=psaA PE=2 SV=1
202	1404	Q9FLQ4	180.52	51	51	3.92E8	18	11	40	N	50134	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g55070 PE=1 SV=1
147	582	A0A1B1W4V8	180.45	74	74	2.54E9	25	25	60	Y	35357	Cytochrome f OS=Arabidopsis thaliana OX=3702 GN=petA PE=3 SV=1
147	583	P56771	180.45	74	74	2.54E9	25	25	60	Y	35357	Cytochrome f OS=Arabidopsis thaliana OX=3702 GN=petA PE=3 SV=1
251	324	P55826	180.25	64	64	6.58E8	25	25	42	Y	57695	Protoporphyrinogen oxidase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPOX1 PE=1 SV=1
251	325	A0A178UVN5	180.25	64	64	6.58E8	25	25	42	Y	57695	Protoporphyrinogen oxidase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g02130 PE=3 SV=1
204	562	Q1H583	180.17	57	57	1.22E9	20	16	51	Y	43194	GDSL esterase/lipase 22 OS=Arabidopsis thaliana OX=3702 GN=GLL22 PE=1 SV=1
162	376	Q9LUT2	179.75	75	75	4.8E8	24	12	58	Y	42796	S-adenosylmethionine synthase 4 OS=Arabidopsis thaliana OX=3702 GN=METK4 PE=1 SV=1
162	377	A0A178VIP8	179.75	75	75	4.8E8	24	12	58	Y	42796	S-adenosylmethionine synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g18350 PE=3 SV=1
296	530	A0A178UTE9	179.51	72	72	4.34E8	24	24	37	Y	50296	NIFS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g65600 PE=3 SV=1
296	531	O49543	179.51	72	72	4.34E8	24	24	37	Y	50296	Cysteine desulfurase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NIFS1 PE=1 SV=1
155	1137	P56785	179.35	28	28	2.34E8	43	43	52	Y	213727	Protein TIC 214 OS=Arabidopsis thaliana OX=3702 GN=TIC214 PE=1 SV=1
155	1138	A0A1B1W4Z9	179.35	28	28	2.34E8	43	43	52	Y	213750	Protein TIC 214 OS=Arabidopsis thaliana OX=3702 GN=ycf1 PE=3 SV=1
207	487	A0A178W6T5	179.19	61	61	8.01E8	22	22	43	Y	42620	HIP1.3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g09240 PE=4 SV=1
207	488	Q9SA52	179.19	61	61	8.01E8	22	22	43	Y	42620	Chloroplast stem-loop binding protein of 41 kDa b, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CSP41B PE=1 SV=1
207	489	A0A1P8ATL2	179.19	61	61	8.01E8	22	22	43	Y	43266	Chloroplast RNA binding protein OS=Arabidopsis thaliana OX=3702 GN=CRB PE=4 SV=1
309	777	A0A178UTH3	179.17	32	32	5.74E6	17	2	37	Y	71387	Hsp70-2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g01620 PE=3 SV=1
309	778	P22954	179.17	32	32	5.74E6	17	2	37	Y	71387	Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana OX=3702 GN=MED37D PE=1 SV=2
327	266	A0A178VYR6	179.14	48	48	2.87E8	24	23	31	Y	85306	CAC3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g34880 PE=3 SV=1
327	267	Q9LD43	179.14	48	48	2.87E8	24	23	31	Y	85306	Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CAC3 PE=1 SV=1
333	693	Q9SSA5	178.87	56	56	4.46E8	17	17	34	Y	47982	Peptidyl-prolyl cis-trans isomerase CYP38, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CYP38 PE=1 SV=1
333	694	A0A178VGT1	178.87	56	56	4.46E8	17	17	34	Y	47982	CYP38 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g00580 PE=4 SV=1
298	870	A0A178VX81	178.36	49	49	1.54E8	18	12	32	Y	54490	Phosphotransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g15190 PE=3 SV=1
298	871	P93834	178.36	49	49	1.54E8	18	12	32	Y	54490	Hexokinase-2 OS=Arabidopsis thaliana OX=3702 GN=HXK2 PE=1 SV=1
246	859	A0A178VH55	178.29	46	46	7.59E8	20	20	44	Y	47631	CRD1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g51530 PE=3 SV=1
246	860	Q9M591	178.29	46	46	7.59E8	20	20	44	Y	47631	Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CRD1 PE=1 SV=2
346	935	Q56WK6	178.20	50	50	3.07E8	25	23	34	Y	64046	Patellin-1 OS=Arabidopsis thaliana OX=3702 GN=PATL1 PE=1 SV=2
90	2584	A0A178VHN7	178.10	76	76	3.97E7	23	2	73	Y	28803	Chlorophyll a-b binding protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g30210 PE=3 SV=1
90	2585	Q9XF87	178.10	76	76	3.97E7	23	2	73	Y	28803	Chlorophyll a-b binding protein 2.4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LHCB2.4 PE=1 SV=1
90	2571	A0A1I9LMB4	178.10	67	67	3.97E7	23	2	73	Y	32588	Chlorophyll a-b binding protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LHCB2.3 PE=3 SV=1
325	151	Q8VZ10	177.83	44	44	1.42E8	25	25	33	Y	114402	Protein SUPPRESSOR OF QUENCHING 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SOQ1 PE=1 SV=1
290	599	Q9SIU0	176.85	47	47	3.35E8	22	22	39	Y	69656	NAD-dependent malic enzyme 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NAD-ME1 PE=1 SV=1
290	600	A0A178VZ17	176.85	47	47	3.35E8	22	22	39	Y	69656	Malic enzyme OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g08690 PE=3 SV=1
252	718	Q9SK50	176.77	50	50	4.39E8	19	19	40	Y	60608	Protein TIC 55, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIC55 PE=1 SV=1
252	729	A0A178VZY5	176.77	36	36	4.39E8	19	19	40	Y	82240	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g20590 PE=4 SV=1
482	775	Q9FX95	176.65	45	45	2.66E7	20	3	27	Y	67944	ARP protein OS=Arabidopsis thaliana OX=3702 GN=NQR PE=2 SV=1
482	776	F4I3C3	176.65	43	43	2.66E7	20	3	27	Y	70542	ARP protein (REF) OS=Arabidopsis thaliana OX=3702 GN=NQR PE=4 SV=1
319	495	Q93Z16	176.53	50	50	3.3E8	28	28	36	Y	74668	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Arabidopsis thaliana OX=3702 GN=RPN2 PE=1 SV=1
232	847	A0A178WHX3	176.22	62	62	7.83E8	19	15	42	Y	35748	RACK1A_AT OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g18980 PE=4 SV=1
232	848	O24456	176.22	62	62	7.83E8	19	15	42	Y	35748	Receptor for activated C kinase 1A OS=Arabidopsis thaliana OX=3702 GN=RACK1A PE=1 SV=2
407	9386	A0A178W5K4	176.20	71	71	2.54E8	20	18	30	Y	50558	CRU2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g03150 PE=3 SV=1
407	9387	P15456	176.20	71	71	2.54E8	20	18	30	Y	50558	12S seed storage protein CRB OS=Arabidopsis thaliana OX=3702 GN=CRB PE=1 SV=2
441	384	A0A178UTB9	176.05	42	42	1.66E8	24	24	30	Y	81487	NSF OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g05340 PE=4 SV=1
441	385	Q9M0Y8	176.05	42	42	1.66E8	24	24	30	Y	81487	Vesicle-fusing ATPase OS=Arabidopsis thaliana OX=3702 GN=NSF PE=2 SV=2
241	395	P46644	175.98	75	75	5.71E8	24	19	43	Y	48954	Aspartate aminotransferase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ASP3 PE=1 SV=1
241	396	A0A178UKY4	175.98	75	75	5.71E8	24	19	43	Y	48954	Aspartate aminotransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g11250 PE=4 SV=1
264	2059	O81235	175.97	78	78	9.8E8	15	15	41	N	25444	Superoxide dismutase [Mn] 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MSD1 PE=1 SV=2
359	451	Q9FF55	175.83	48	48	3.97E8	23	23	32	N	66357	Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana OX=3702 GN=PDIL1-4 PE=1 SV=1
359	452	A0A178UQB2	175.83	48	48	3.97E8	23	23	32	N	66357	Protein disulfide-isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g60100 PE=3 SV=1
275	1122	Q29Q36	175.79	64	64	6.31E8	18	17	37	Y	35987	NADH-cytochrome b5 reductase OS=Arabidopsis thaliana OX=3702 GN=At5g20080 PE=2 SV=1
275	1123	A0A384KMM7	175.79	64	64	6.31E8	18	17	37	Y	35987	NADH-cytochrome b5 reductase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g20040 PE=3 SV=1
275	1124	P83291	175.79	64	64	6.31E8	18	17	37	Y	35987	NADH-cytochrome b5 reductase-like protein OS=Arabidopsis thaliana OX=3702 GN=CBR2 PE=1 SV=2
240	725	A0A178WHC3	175.47	61	61	4.99E8	21	16	43	Y	42132	Phosphoglycerate kinase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g74350 PE=3 SV=1
240	726	Q9SAJ4	175.47	61	61	4.99E8	21	16	43	Y	42132	Phosphoglycerate kinase 3, cytosolic OS=Arabidopsis thaliana OX=3702 GN=PGK3 PE=1 SV=1
271	648	A0A2P2CLH2	175.35	63	63	8.14E8	23	23	37	Y	45004	NADH dehydrogenase subunit 7 OS=Arabidopsis thaliana OX=3702 GN=nad7 PE=3 SV=1
399	827	Q9M1Z2	175.26	40	40	1.96E8	20	20	26	Y	85735	LETM1-like protein OS=Arabidopsis thaliana OX=3702 GN=F24G16.90 PE=4 SV=1
228	604	Q9SJL8	175.08	73	73	2.56E8	22	12	45	Y	42498	S-adenosylmethionine synthase 3 OS=Arabidopsis thaliana OX=3702 GN=METK3 PE=1 SV=1
228	605	A0A178VXF8	175.08	73	73	2.56E8	22	12	45	Y	42498	S-adenosylmethionine synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g33610 PE=3 SV=1
302	1408	Q9M158	174.76	31	31	9.71E8	17	17	33	N	49387	Rhodanese-like domain-containing protein 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=STR4 PE=1 SV=2
302	1409	A0A1P8B8J7	174.76	28	28	9.71E8	17	17	33	N	54469	Thylakoid rhodanese-like protein OS=Arabidopsis thaliana OX=3702 GN=TROL PE=4 SV=1
302	1410	A0A178V0X3	174.76	28	28	9.71E8	17	17	33	N	54481	TROL OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g01370 PE=4 SV=1
160	2001	A0A178UY46	174.73	59	59	1.83E9	25	23	58	N	23795	PSBQA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g24640 PE=4 SV=1
243	902	O82399	174.51	64	64	5.23E8	14	11	42	Y	37466	Malate dehydrogenase 1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=PMDH1 PE=1 SV=1
243	903	A0A384LAR8	174.51	64	64	5.23E8	14	11	42	Y	37466	Malate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g18360 PE=3 SV=1
243	904	Q0WUS4	174.51	64	64	5.23E8	14	11	42	Y	37466	Malate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=At2g22780 PE=2 SV=1
357	1420	P46283	174.45	51	51	7.25E8	17	17	32	Y	42414	Sedoheptulose-1,7-bisphosphatase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g55800 PE=2 SV=1
299	520	Q9T0A0	174.44	47	47	2.44E7	27	2	35	Y	74508	Long chain acyl-CoA synthetase 4 OS=Arabidopsis thaliana OX=3702 GN=LACS4 PE=2 SV=1
282	967	B9DHN8	174.13	50	50	4.51E8	19	19	33	Y	49710	AT3G42050 protein (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At3g42050 PE=2 SV=1
282	969	Q9LX65	174.13	49	49	4.51E8	19	19	33	Y	50285	V-type proton ATPase subunit H OS=Arabidopsis thaliana OX=3702 GN=VHA-H PE=1 SV=1
609	1466	Q9SLA8	173.74	52	52	1.52E8	17	17	22	Y	41214	Enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MOD1 PE=1 SV=1
609	1467	A0A178VTH6	173.74	52	52	1.52E8	17	17	22	Y	41191	MOD1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g05030 PE=4 SV=1
538	2726	E0Y422	173.48	62	62	2.68E9	14	14	25	Y	24350	Cytochrome b6-f complex iron-sulfur subunit OS=Arabidopsis thaliana OX=3702 GN=At4g03280 PE=3 SV=1
538	2727	A0A178UTT2	173.48	62	62	2.68E9	14	14	25	Y	24350	Cytochrome b6-f complex iron-sulfur subunit OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g04070 PE=3 SV=1
538	2728	Q9ZR03	173.48	62	62	2.68E9	14	14	25	Y	24366	Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=petC PE=1 SV=1
278	1227	Q93XM7	173.41	61	61	1.03E9	17	17	40	Y	31023	Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana OX=3702 GN=BOU PE=1 SV=1
586	3035	A0A178V395	173.33	61	61	2.5E8	15	14	24	N	33785	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g25850 PE=4 SV=1
586	3036	O49629	173.33	61	61	2.5E8	15	14	24	N	33655	Probable plastid-lipid-associated protein 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PAP2 PE=1 SV=1
300	1145	A0A384KI72	172.92	73	73	3.51E8	22	17	37	Y	44267	Aspartate aminotransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g19470 PE=4 SV=1
300	1146	P46645	172.92	73	73	3.51E8	22	17	37	Y	44267	Aspartate aminotransferase, cytoplasmic isozyme 1 OS=Arabidopsis thaliana OX=3702 GN=ASP2 PE=1 SV=2
300	1147	Q1EBW2	172.92	73	73	3.51E8	22	17	37	Y	44267	Aspartate aminotransferase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
383	1755	A0A178VGH8	172.92	71	71	5.67E8	17	16	30	Y	30455	FIB4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g25260 PE=4 SV=1
383	1756	Q9LW57	172.92	71	71	5.67E8	17	16	30	Y	30455	Plastid-lipid-associated protein 6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PAP6 PE=1 SV=1
221	1735	A0A178WK60	172.75	48	48	3.16E9	20	20	46	Y	27336	Chlorophyll a-b binding protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g16590 PE=3 SV=1
221	1736	Q9XF90	172.75	47	47	3.16E9	20	20	46	Y	27522	Chlorophyll a-b binding protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=Lhcb6 PE=2 SV=1
221	1737	Q9LMQ2	172.75	47	47	3.16E9	20	20	46	Y	27522	Chlorophyll a-b binding protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CHLOROPHYLL PROTEIN 24 PE=1 SV=1
337	534	A0A178VHJ5	172.47	45	45	3.67E8	19	19	33	Y	63812	Ketol-acid reductoisomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g53150 PE=3 SV=1
337	535	Q05758	172.47	45	45	3.67E8	19	19	33	Y	63812	Ketol-acid reductoisomerase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g58610 PE=1 SV=2
404	1480	A0A1P8B8W6	172.47	73	73	5.54E8	17	17	28	Y	31041	Ascorbate peroxidase 4 OS=Arabidopsis thaliana OX=3702 GN=TL29 PE=1 SV=1
404	1475	P82281	172.47	59	59	5.54E8	17	17	28	Y	37934	Thylakoid lumenal 29 kDa protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TL29 PE=1 SV=2
404	1476	A0A1P8B8Y3	172.47	52	52	5.54E8	17	17	28	Y	43476	Ascorbate peroxidase 4 OS=Arabidopsis thaliana OX=3702 GN=TL29 PE=1 SV=1
270	973	Q93VP9	172.46	67	67	4.2E8	23	17	36	Y	45020	SPFH/Band 7/PHB domain-containing membrane-associated protein family OS=Arabidopsis thaliana OX=3702 GN=AtSLP1 PE=1 SV=1
270	974	A0A178UVT3	172.46	67	67	4.2E8	23	17	36	Y	45020	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g31720 PE=1 SV=1
289	1655	Q9SSS9	172.42	64	64	9.56E8	18	18	39	Y	25669	ATP synthase subunit delta, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ATPD PE=1 SV=1
289	1656	A0A178V1L3	172.42	64	64	9.56E8	18	18	39	Y	25669	PDE332 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g10860 PE=3 SV=1
334	661	Q38858	172.20	67	67	2.15E8	20	12	30	Y	48157	Calreticulin-2 OS=Arabidopsis thaliana OX=3702 GN=CRT2 PE=1 SV=3
374	371	Q93VS8	172.15	36	36	8.67E7	24	24	32	Y	123825	ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=emb2734 PE=2 SV=1
374	372	A0A178UQ41	172.15	36	36	8.67E7	24	24	32	Y	123809	Emb2734 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g19740 PE=4 SV=1
339	517	O80503	172.12	62	62	3.45E8	19	19	33	Y	49831	Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g44640 PE=4 SV=2
339	518	A0A178VX46	172.12	62	62	3.45E8	19	19	33	Y	49831	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g42210 PE=4 SV=1
508	1470	Q9M1J6	172.07	52	52	2.02E8	18	18	26	Y	41458	Protein STRICTOSIDINE SYNTHASE-LIKE 9 OS=Arabidopsis thaliana OX=3702 GN=SSL9 PE=2 SV=1
508	1471	A0A178V5B5	172.07	52	52	2.02E8	18	18	26	Y	41458	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g51610 PE=4 SV=1
109	1034	B9DGS0	171.95	48	48	8.88E7	24	8	60	Y	41746	AT5G13490 protein OS=Arabidopsis thaliana OX=3702 GN=At5g13490 PE=2 SV=1
109	1035	P40941	171.95	48	48	8.88E7	24	8	60	Y	41746	ADP,ATP carrier protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AAC2 PE=1 SV=2
109	1036	A0A384L9C1	171.95	48	48	8.88E7	24	8	60	Y	41746	AAC2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g12920 PE=3 SV=1
395	958	O04309	171.86	68	68	4.54E8	20	20	31	Y	48497	Jacalin-related lectin 35 OS=Arabidopsis thaliana OX=3702 GN=JAL35 PE=1 SV=1
395	959	A0A178VLL2	171.86	68	68	4.54E8	20	20	31	Y	48521	JR1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g17330 PE=4 SV=1
434	588	A0A178W6V9	171.80	53	53	1.41E8	23	11	28	Y	60580	IPGAM1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g09740 PE=4 SV=1
434	589	O04499	171.80	53	53	1.41E8	23	11	28	Y	60580	2,3-bisphosphoglycerate-independent phosphoglycerate mutase 1 OS=Arabidopsis thaliana OX=3702 GN=PGM1 PE=2 SV=3
434	590	Q94AY0	171.80	53	53	1.41E8	23	11	28	Y	60607	At1g09780/F21M12_17 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
226	218	Q9C525	171.64	54	54	1.16E8	22	10	41	Y	59664	Beta-glucosidase 21 OS=Arabidopsis thaliana OX=3702 GN=BGLU21 PE=1 SV=1
226	219	A0A178WA93	171.64	54	54	1.16E8	22	10	41	Y	59664	BGLU21 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g59990 PE=3 SV=1
217	341	A0A178V2T4	171.56	30	30	2.89E7	17	7	41	Y	98152	Aconitate hydratase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g40960 PE=3 SV=1
217	342	Q42560	171.56	30	30	2.89E7	17	7	41	Y	98152	Aconitate hydratase 1 OS=Arabidopsis thaliana OX=3702 GN=ACO1 PE=1 SV=2
326	541	A0A178VV64	171.55	35	35	4.9E7	28	14	34	Y	109753	PPC2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g39980 PE=3 SV=1
326	542	Q5GM68	171.55	35	35	4.9E7	28	14	34	Y	109753	Phosphoenolpyruvate carboxylase 2 OS=Arabidopsis thaliana OX=3702 GN=PPC2 PE=1 SV=2
320	664	A0A178V808	171.53	58	58	2.38E8	17	9	36	Y	43359	NADPH-protochlorophyllide oxidoreductase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g31570 PE=3 SV=1
320	665	P21218	171.53	58	58	2.38E8	17	9	36	Y	43359	Protochlorophyllide reductase B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PORB PE=1 SV=3
335	1052	A0A178W1F8	171.48	64	64	5.23E8	22	21	34	Y	39497	UNE5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g45240 PE=3 SV=1
335	1053	O22263	171.48	64	64	5.23E8	22	21	34	Y	39497	Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-1 PE=2 SV=1
145	1725	A0A178U834	171.47	52	52	6.23E8	17	9	59	Y	36152	Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g08090 PE=3 SV=1
145	1726	P68209	171.47	52	52	6.23E8	17	9	59	Y	36152	Succinate--CoA ligase [ADP-forming] subunit alpha-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g08300 PE=1 SV=1
312	1625	A0A178VHS6	171.40	58	58	9.04E8	16	16	38	Y	37927	VTE3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g57680 PE=3 SV=1
312	1626	Q9LY74	171.40	58	58	9.04E8	16	16	38	Y	37927	2-methyl-6-phytyl-1,4-hydroquinone methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=VTE3 PE=1 SV=1
341	611	A0A384KX64	171.38	63	63	4.61E8	20	20	34	Y	42619	V-type proton ATPase subunit C OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g13260 PE=3 SV=1
341	612	Q9SDS7	171.38	63	63	4.61E8	20	20	34	Y	42619	V-type proton ATPase subunit C OS=Arabidopsis thaliana OX=3702 GN=VHA-C PE=1 SV=1
341	613	C0SUV0	171.38	63	63	4.61E8	20	20	34	Y	42619	V-type proton ATPase subunit C (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At1g12840 PE=2 SV=1
277	2820	O65282	171.10	67	67	1.14E9	16	16	39	N	26802	20 kDa chaperonin, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CPN20 PE=1 SV=2
277	2821	A0A178UDQ4	171.10	67	67	1.14E9	16	16	39	N	26802	CPN21 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g20700 PE=3 SV=1
442	310	Q9SD76	170.99	38	38	7.96E7	19	18	29	Y	95159	Alpha-glucan phosphorylase 2, cytosolic OS=Arabidopsis thaliana OX=3702 GN=PHS2 PE=1 SV=1
442	311	A0A178VC18	170.99	38	38	7.96E7	19	18	29	Y	95175	Alpha-1,4 glucan phosphorylase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g40890 PE=3 SV=1
442	312	W8PUR4	170.99	38	38	7.96E7	19	18	29	Y	95159	Alpha-1,4 glucan phosphorylase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT3G46970 PE=2 SV=1
273	1278	A0A178WKK0	170.87	83	83	4.37E8	22	21	40	Y	35628	Sulfurtransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g73970 PE=4 SV=1
273	1279	O64530	170.87	71	71	4.37E8	22	21	40	Y	41893	Thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=STR1 PE=1 SV=1
369	521	P38418	170.83	36	36	1.54E8	20	20	28	Y	102046	Lipoxygenase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LOX2 PE=1 SV=1
344	257	O65390	170.24	56	56	2.45E8	19	17	36	Y	54614	Aspartic proteinase A1 OS=Arabidopsis thaliana OX=3702 GN=APA1 PE=1 SV=1
344	258	A0A178WAW2	170.24	56	56	2.45E8	19	17	36	Y	54614	ATAPA1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g12280 PE=3 SV=1
344	262	A0A1P8AV08	170.24	55	55	2.45E8	19	17	36	Y	56036	Aspartic proteinase A1 OS=Arabidopsis thaliana OX=3702 GN=APA1 PE=3 SV=1
428	877	A0A178WDE4	170.16	39	39	1.86E8	20	20	26	Y	75676	Acyl-coenzyme A oxidase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g05890 PE=3 SV=1
428	878	P0CZ23	170.16	39	39	1.86E8	20	20	26	Y	75676	Acyl-coenzyme A oxidase 3, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=ACX3 PE=1 SV=1
418	1352	A0A178UMH0	170.06	47	47	1.91E8	15	15	25	Y	50413	KASI OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g44740 PE=3 SV=1
418	1353	P52410	170.06	47	47	1.91E8	15	15	25	Y	50413	3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=KAS1 PE=1 SV=2
433	543	A0A178URN6	169.97	37	37	1.98E8	21	21	29	Y	81000	RH3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g26440 PE=4 SV=1
433	544	A0A178UT03	169.97	37	37	1.98E8	21	21	29	Y	81157	RH3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g26440 PE=4 SV=1
433	545	Q8L7S8	169.97	37	37	1.98E8	21	21	29	Y	81157	DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RH3 PE=1 SV=2
238	4309	A0A178WBY7	169.74	63	63	1.71E9	13	8	46	Y	17897	Glycine cleavage system H protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g33260 PE=3 SV=1
238	4310	Q9LQL0	169.74	63	63	1.71E9	13	8	46	Y	17897	Glycine cleavage system H protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GDH3 PE=1 SV=1
231	929	P17094	169.60	45	45	8.13E8	24	12	45	Y	44559	60S ribosomal protein L3-1 OS=Arabidopsis thaliana OX=3702 GN=ARP1 PE=1 SV=5
231	930	A0A178WDT7	169.60	45	45	8.13E8	24	12	45	Y	44559	RPL3A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g39210 PE=3 SV=1
231	931	Q0WLE7	169.60	32	32	8.13E8	24	12	45	Y	63355	Uncharacterized protein At1g43170 OS=Arabidopsis thaliana OX=3702 GN=At1g43170 PE=2 SV=1
209	1709	Q9S7H1	169.47	70	70	2.45E9	17	17	46	Y	22598	Photosystem I reaction center subunit II-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=psaD1 PE=1 SV=1
209	1710	A0A178UV45	169.47	70	70	2.45E9	17	17	46	Y	22598	PSAD-1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g03480 PE=4 SV=1
281	1040	Q94BV7	169.42	48	48	1.66E8	21	15	35	Y	65059	External alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDB2 PE=1 SV=1
281	1041	A0A178V0K8	169.42	48	48	1.66E8	21	15	35	Y	65059	NDB2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g05160 PE=4 SV=1
281	1042	A0A178UYI4	169.42	48	48	1.66E8	21	15	35	Y	65187	NDB2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g05160 PE=4 SV=1
281	1043	F4JGL5	169.42	45	45	1.66E8	21	15	35	Y	69243	NAD(P)H dehydrogenase B2 OS=Arabidopsis thaliana OX=3702 GN=NDB2 PE=4 SV=1
435	884	Q9SS48	169.40	45	45	2.1E8	19	19	28	Y	68451	Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SDP6 PE=1 SV=1
435	885	A0A178VGW1	169.40	45	45	2.1E8	19	19	28	Y	68451	Glycerol-3-phosphate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g10160 PE=3 SV=1
349	1605	P32961	169.25	51	51	4.16E8	17	9	33	Y	38152	Nitrilase 1 OS=Arabidopsis thaliana OX=3702 GN=NIT1 PE=1 SV=2
349	1606	C0SVD5	169.25	51	51	4.16E8	17	9	33	Y	38152	Uncharacterized protein At3g44310 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At3g44310 PE=2 SV=1
349	1607	A0A384KJ08	169.25	51	51	4.16E8	17	9	33	Y	38152	NITI OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g37910 PE=4 SV=1
258	1786	A0A178WBG3	169.16	64	64	4.89E8	16	11	38	Y	31811	PHB2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g03130 PE=4 SV=1
258	1787	Q9ZNT7	169.16	64	64	4.89E8	16	11	38	Y	31811	Prohibitin-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PHB2 PE=1 SV=1
354	1076	Q1H5A3	169.09	51	51	4.43E7	19	2	34	Y	44524	Glutamate dehydrogenase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
354	1077	A0A384LND1	169.09	51	51	4.43E7	19	2	34	Y	44524	Glutamate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g17930 PE=3 SV=1
354	1078	Q43314	169.09	51	51	4.43E7	19	2	34	Y	44524	Glutamate dehydrogenase 1 OS=Arabidopsis thaliana OX=3702 GN=GDH1 PE=2 SV=1
321	691	Q9SRZ6	169.08	54	54	1.87E8	24	18	34	Y	45746	Cytosolic isocitrate dehydrogenase [NADP] OS=Arabidopsis thaliana OX=3702 GN=CICDH PE=1 SV=1
321	692	A0A178W7K0	169.08	54	54	1.87E8	24	18	34	Y	45746	Isocitrate dehydrogenase [NADP] OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g59590 PE=3 SV=1
304	873	Q8H118	169.07	39	39	2.26E7	24	5	35	Y	69356	Probable methyltransferase PMT1 OS=Arabidopsis thaliana OX=3702 GN=At3g23300 PE=2 SV=2
304	874	A0A178VBP4	169.07	39	39	2.26E7	24	5	35	Y	69356	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g25360 PE=4 SV=1
318	3147	O49203	168.74	55	55	1.97E9	18	18	36	Y	25734	Nucleoside diphosphate kinase III, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDPK3 PE=1 SV=1
318	3148	A0A178UTZ0	168.74	55	55	1.97E9	18	18	36	Y	25734	Nucleoside diphosphate kinase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g12390 PE=3 SV=1
318	3149	B9DHH1	168.74	55	55	1.97E9	18	18	36	Y	25665	Nucleoside diphosphate kinase OS=Arabidopsis thaliana OX=3702 GN=At4g11010 PE=2 SV=1
380	1757	A0A178WDN7	168.72	31	31	1.21E8	20	11	31	Y	67530	ADP,ATP carrier protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g16290 PE=3 SV=1
380	1758	P92935	168.72	31	31	1.21E8	20	11	31	Y	67530	ADP,ATP carrier protein 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AATP2 PE=1 SV=2
371	732	Q9SF85	168.59	57	57	2E8	15	6	34	Y	37836	Adenosine kinase 1 OS=Arabidopsis thaliana OX=3702 GN=ADK1 PE=1 SV=1
224	1534	Q96251	168.49	68	68	9.99E8	18	18	45	N	26322	ATP synthase subunit O, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g13450 PE=1 SV=2
224	1535	A0A178UJF9	168.49	68	68	9.99E8	18	18	45	N	26308	ATP5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g12870 PE=3 SV=1
388	1416	A0A178UXW7	168.43	62	62	5.74E8	18	16	29	Y	31586	APX3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g39980 PE=3 SV=1
388	1417	Q42564	168.43	62	62	5.74E8	18	16	29	Y	31572	L-ascorbate peroxidase 3 OS=Arabidopsis thaliana OX=3702 GN=APX3 PE=1 SV=1
376	760	Q9SDM9	168.35	56	56	8.97E7	20	7	33	Y	51670	Nitrile-specifier protein 1 OS=Arabidopsis thaliana OX=3702 GN=NSP1 PE=1 SV=2
361	2285	A0A178V2M2	168.32	36	36	7.25E7	13	6	26	N	49928	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g31060 PE=4 SV=1
361	2286	A0A178V3X4	168.32	36	36	7.25E7	13	6	26	N	49999	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g31060 PE=4 SV=1
361	2287	Q8H107	168.32	36	36	7.25E7	13	6	26	N	50059	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g26910 PE=1 SV=2
234	1621	A0A178UM82	168.07	62	62	1.49E9	14	14	44	Y	39176	Pyruvate dehydrogenase E1 component subunit beta OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g49650 PE=4 SV=1
234	1622	Q38799	168.07	62	62	1.49E9	14	14	44	Y	39176	Pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDH2 PE=1 SV=2
389	4934	Q9SUI4	167.97	48	48	1.44E9	14	14	31	N	23052	Photosystem I reaction center subunit XI, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSAL PE=1 SV=2
389	4935	A0A1P8B6D0	167.97	37	37	1.44E9	14	14	31	N	30441	Photosystem I subunit l OS=Arabidopsis thaliana OX=3702 GN=PSAL PE=4 SV=1
415	1276	Q42601	167.95	27	27	6.96E7	21	21	25	Y	129957	Carbamoyl-phosphate synthase large chain, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CARB PE=1 SV=1
415	1277	A0A178WB43	167.95	27	27	6.96E7	21	21	25	Y	129943	VEN3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g30290 PE=3 SV=1
212	2499	P56759	167.93	68	68	2.52E9	22	21	50	Y	21057	ATP synthase subunit b, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=atpF PE=3 SV=1
178	723	P41377	167.90	61	61	2.25E7	20	3	48	Y	46763	Eukaryotic initiation factor 4A-2 OS=Arabidopsis thaliana OX=3702 GN=TIF4A-2 PE=1 SV=1
178	724	A0A178W4U1	167.90	61	61	2.25E7	20	3	48	Y	46763	eIF4A-2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g48730 PE=3 SV=1
342	510	F4JXW9	167.89	40	40	2.37E8	25	25	31	Y	108868	Catalytics OS=Arabidopsis thaliana OX=3702 GN=At5g11560 PE=4 SV=1
248	1347	B9DHI9	167.73	57	57	1.29E8	19	7	39	Y	46661	AT1G09640 protein OS=Arabidopsis thaliana OX=3702 GN=At1g09640 PE=2 SV=1
248	1348	A0A384KT07	167.73	57	57	1.29E8	19	7	39	Y	46661	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g09580 PE=4 SV=1
248	1349	O04487	167.73	57	57	1.29E8	19	7	39	Y	46661	Probable elongation factor 1-gamma 1 OS=Arabidopsis thaliana OX=3702 GN=At1g09640 PE=1 SV=1
313	1280	A0A178UKZ2	167.66	63	63	7.23E8	13	8	30	N	30400	PHB3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g38490 PE=4 SV=1
313	1281	O04331	167.66	63	63	7.23E8	13	8	30	N	30400	Prohibitin-3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PHB3 PE=1 SV=1
287	587	Q5XF82	167.59	59	59	6.68E8	21	20	40	Y	48524	Jacalin-related lectin 11 OS=Arabidopsis thaliana OX=3702 GN=JAL11 PE=2 SV=1
285	1262	Q9C6B3	167.49	78	78	6.25E8	16	13	39	Y	30065	Gamma carbonic anhydrase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GAMMACA2 PE=1 SV=1
285	1263	A0A178WI45	167.49	78	78	6.25E8	16	13	39	Y	30065	GAMMA CA2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g41210 PE=4 SV=1
330	1639	A0A178UJU5	167.25	44	44	6.17E7	16	3	35	Y	34437	RPL5B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g37170 PE=3 SV=1
330	1640	P49227	167.25	44	44	6.17E7	16	3	35	Y	34437	60S ribosomal protein L5-2 OS=Arabidopsis thaliana OX=3702 GN=RPL5B PE=2 SV=3
323	276	Q9MAH0	167.21	36	36	2.52E7	28	8	35	Y	110286	Phosphoenolpyruvate carboxylase 1 OS=Arabidopsis thaliana OX=3702 GN=PPC1 PE=1 SV=1
323	277	B9DGT6	167.21	36	36	2.52E7	28	8	35	Y	110268	AT1G53310 protein OS=Arabidopsis thaliana OX=3702 GN=At1g53310 PE=2 SV=1
323	278	A0A178WJH6	167.21	36	36	2.52E7	28	8	35	Y	110286	PPC1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g47630 PE=3 SV=1
467	730	Q8LPS1	167.20	42	42	2.53E8	20	19	27	Y	76603	Long chain acyl-CoA synthetase 6, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=LACS6 PE=1 SV=1
570	646	A0A178W2K0	167.19	51	51	1.7E8	17	17	23	Y	47755	PDIL2-3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g29350 PE=3 SV=1
570	647	O48773	167.19	51	51	1.7E8	17	17	23	Y	47755	Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-3 PE=2 SV=1
317	1006	A0A178VUN9	166.96	50	50	2.91E8	21	16	34	Y	61718	SYTA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g16440 PE=4 SV=1
317	785	Q9SKR2	166.96	50	50	2.91E8	21	16	34	Y	61744	Synaptotagmin-1 OS=Arabidopsis thaliana OX=3702 GN=SYT1 PE=1 SV=2
317	1007	F4IFM7	166.96	48	48	2.91E8	21	16	34	Y	64490	Synaptotagmin A OS=Arabidopsis thaliana OX=3702 GN=SYTA PE=4 SV=1
350	1197	A0A178V8U1	166.66	64	64	7.54E8	19	19	32	Y	32662	UCP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g48540 PE=3 SV=1
350	1198	O81845	166.66	64	64	7.54E8	19	19	32	Y	32662	Mitochondrial uncoupling protein 1 OS=Arabidopsis thaliana OX=3702 GN=PUMP1 PE=1 SV=1
370	1738	A4FVT2	166.56	45	45	3.51E8	16	16	30	Y	53615	Aldehyde dehydrogenase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
370	1739	A0A384K8S3	166.56	45	45	3.51E8	16	16	30	Y	53615	Aldehyde dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g41400 PE=3 SV=1
370	1740	Q70E96	166.56	45	45	3.51E8	16	16	30	Y	53615	Aldehyde dehydrogenase family 3 member F1 OS=Arabidopsis thaliana OX=3702 GN=ALDH3F1 PE=2 SV=2
456	751	Q94CE4	166.44	74	74	4.67E8	17	17	28	Y	30836	Beta carbonic anhydrase 4 OS=Arabidopsis thaliana OX=3702 GN=BCA4 PE=1 SV=1
331	1716	Q8LBI1	166.32	44	44	4.37E7	16	3	35	Y	34358	60S ribosomal protein L5-1 OS=Arabidopsis thaliana OX=3702 GN=ATL5 PE=1 SV=2
331	1717	A0A178V891	166.32	44	44	4.37E7	16	3	35	Y	34358	RPL5A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g27470 PE=1 SV=1
391	834	A0A178W7M1	165.98	37	37	2.62E8	22	15	30	Y	87205	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g29860 PE=4 SV=1
391	835	Q6NPR7	165.98	37	37	2.62E8	22	15	30	Y	87205	Probable methyltransferase PMT24 OS=Arabidopsis thaliana OX=3702 GN=At1g29470 PE=2 SV=1
493	701	Q1WIQ6	165.85	47	47	2.25E8	15	15	23	Y	53060	NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=ALDH11A3 PE=1 SV=2
493	702	B9DHD2	165.85	47	47	2.25E8	15	15	23	Y	53060	AT2G24270 protein OS=Arabidopsis thaliana OX=3702 GN=At2g24270 PE=2 SV=1
493	703	A0A384L3A7	165.85	47	47	2.25E8	15	15	23	Y	53060	ALDH11A3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g19920 PE=3 SV=1
493	704	F4INS6	165.85	46	46	2.25E8	15	15	23	Y	53849	Aldehyde dehydrogenase 11A3 OS=Arabidopsis thaliana OX=3702 GN=ALDH11A3 PE=1 SV=1
493	705	A0A2H1ZE23	165.85	43	43	2.25E8	15	15	23	Y	57756	Aldehyde dehydrogenase 11A3 OS=Arabidopsis thaliana OX=3702 GN=ALDH11A3 PE=1 SV=1
506	1617	O81439	165.79	60	60	1.98E8	14	13	26	N	34948	Probable plastid-lipid-associated protein 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PAP1 PE=1 SV=1
229	2815	P27521	165.59	67	67	1.17E9	12	12	46	Y	27734	Chlorophyll a-b binding protein 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LHCA4 PE=1 SV=1
229	2816	A0A178VEE6	165.59	67	67	1.17E9	12	12	46	Y	27734	Chlorophyll a-b binding protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g41460 PE=3 SV=1
621	594	O49299	165.53	54	54	6.22E7	20	12	22	Y	63171	Probable phosphoglucomutase, cytoplasmic 1 OS=Arabidopsis thaliana OX=3702 GN=At1g23190 PE=2 SV=2
480	812	A0A178V3V9	165.51	60	60	6.22E7	15	5	26	Y	43255	S-adenosylmethionine synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g02310 PE=3 SV=1
480	813	P17562	165.51	60	60	6.22E7	15	5	26	Y	43255	S-adenosylmethionine synthase 2 OS=Arabidopsis thaliana OX=3702 GN=SAM2 PE=1 SV=1
372	3408	Q93VG5	165.30	57	57	1.08E9	17	17	32	Y	24994	40S ribosomal protein S8-1 OS=Arabidopsis thaliana OX=3702 GN=RPS8A PE=1 SV=1
372	3409	A0A178UCD3	165.30	57	57	1.08E9	17	17	32	Y	24994	40S ribosomal protein S8 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g20270 PE=3 SV=1
254	474	Q39085	165.23	47	47	4.93E8	23	23	41	Y	65394	Delta(24)-sterol reductase OS=Arabidopsis thaliana OX=3702 GN=DIM PE=1 SV=2
254	475	A0A178V7D0	165.23	47	47	4.93E8	23	23	41	Y	65394	EVE1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g21080 PE=4 SV=1
420	2883	Q96291	165.03	50	50	2.62E8	12	4	29	Y	29092	2-Cys peroxiredoxin BAS1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=BAS1 PE=1 SV=2
420	2884	A0A178VJT2	165.03	50	50	2.62E8	12	4	29	Y	29092	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g11560 PE=4 SV=1
233	752	F4I2F8	164.84	60	60	2.25E8	18	15	43	Y	43626	NADPH-protochlorophyllide oxidoreductase OS=Arabidopsis thaliana OX=3702 GN=POR C PE=3 SV=1
233	753	A0A384LMN8	164.84	60	60	2.25E8	18	15	43	Y	43883	NADPH-protochlorophyllide oxidoreductase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g02900 PE=3 SV=1
233	754	Q0WVW0	164.84	60	60	2.25E8	18	15	43	Y	43883	NADPH-protochlorophyllide oxidoreductase OS=Arabidopsis thaliana OX=3702 GN=At1g03630 PE=2 SV=1
233	755	O48741	164.84	60	60	2.25E8	18	15	43	Y	43883	Protochlorophyllide reductase C, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PORC PE=1 SV=1
591	697	Q9FMD5	164.82	47	47	2.3E8	16	16	23	Y	48903	Protein TIC 40, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIC40 PE=1 SV=1
591	698	A0A178UEV6	164.82	47	47	2.3E8	16	16	23	Y	48903	TIC40 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g16250 PE=4 SV=1
518	1004	A0A178VQU1	164.74	45	45	1.05E8	22	20	24	Y	77275	Ftsh4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g21970 PE=3 SV=1
518	1005	O80983	164.74	45	45	1.05E8	22	20	24	Y	77275	ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FTSH4 PE=1 SV=2
293	4215	P49107	164.72	41	41	1.35E9	14	14	39	Y	18429	Photosystem I reaction center subunit N, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSAN PE=1 SV=2
293	4216	A0A178UC65	164.72	41	41	1.35E9	14	14	39	Y	18429	PSAN OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g63630 PE=4 SV=1
268	940	Q8H1Y0	164.60	58	58	7.12E8	22	17	36	Y	43359	Pyruvate dehydrogenase E1 component subunit alpha-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IAR4 PE=1 SV=2
268	941	A0A178WAC1	164.60	58	58	7.12E8	22	17	36	Y	43393	Pyruvate dehydrogenase E1 component subunit alpha OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g25400 PE=4 SV=1
492	2569	Q9SKT0	164.58	50	50	4.18E8	14	14	24	Y	33796	Protein THYLAKOID FORMATION 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=THF1 PE=1 SV=1
492	2570	A0A178VVV5	164.58	50	50	4.18E8	14	14	24	Y	33796	THF1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g16340 PE=3 SV=1
256	1069	A0A178WNY2	164.56	58	58	5.56E8	21	16	38	Y	43059	Pyruvate dehydrogenase E1 component subunit alpha OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g53000 PE=4 SV=1
256	1070	P52901	164.56	58	58	5.56E8	21	16	38	Y	43059	Pyruvate dehydrogenase E1 component subunit alpha-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=E1 ALPHA PE=1 SV=2
179	806	P41376	164.43	55	55	6.37E7	21	4	49	Y	46705	Eukaryotic initiation factor 4A-1 OS=Arabidopsis thaliana OX=3702 GN=TIF4A-1 PE=1 SV=1
179	807	A0A178V707	164.43	55	55	6.37E7	21	4	49	Y	46705	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g14410 PE=3 SV=1
612	649	A0A178VYU7	164.42	49	49	9.55E7	15	12	21	Y	54509	LAP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g19830 PE=3 SV=1
612	650	P30184	164.42	49	49	9.55E7	15	12	21	Y	54509	Leucine aminopeptidase 1 OS=Arabidopsis thaliana OX=3702 GN=LAP1 PE=1 SV=1
580	1104	A0A178V7J5	164.41	58	58	2.79E8	13	13	24	Y	44834	ATSCX OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g46220 PE=3 SV=1
580	1105	Q96329	164.41	54	54	2.79E8	13	13	24	Y	47557	Acyl-coenzyme A oxidase 4, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=ACX4 PE=1 SV=1
253	550	A0A178UEW4	164.39	64	64	1.31E8	19	7	41	Y	41736	AtACT7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g09370 PE=3 SV=1
253	551	P53492	164.39	64	64	1.31E8	19	7	41	Y	41736	Actin-7 OS=Arabidopsis thaliana OX=3702 GN=ACT7 PE=1 SV=1
375	631	Q9SU40	164.26	38	38	4.16E8	17	17	32	Y	65638	Monocopper oxidase-like protein SKU5 OS=Arabidopsis thaliana OX=3702 GN=SKU5 PE=1 SV=1
375	632	A0A178V188	164.26	38	38	4.16E8	17	17	32	Y	65638	SKU5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g13970 PE=4 SV=1
387	1413	Q9SJT7	164.22	34	34	8.33E7	20	10	26	Y	93106	V-type proton ATPase subunit a2 OS=Arabidopsis thaliana OX=3702 GN=VHA-a2 PE=1 SV=1
345	1159	Q9CAV0	164.21	65	65	3.17E8	19	10	32	Y	29851	40S ribosomal protein S3a-1 OS=Arabidopsis thaliana OX=3702 GN=RPS3AA PE=1 SV=3
345	1160	A0A178VBG6	164.21	65	65	3.17E8	19	10	32	Y	29851	40S ribosomal protein S3a OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g04310 PE=3 SV=1
260	1199	Q93VH9	164.20	63	63	3.95E7	19	3	40	Y	29803	40S ribosomal protein S4-1 OS=Arabidopsis thaliana OX=3702 GN=RPS4A PE=2 SV=1
260	1200	P49204	164.20	63	63	3.95E7	19	3	40	Y	29874	40S ribosomal protein S4-2 OS=Arabidopsis thaliana OX=3702 GN=RPS4B PE=2 SV=4
260	1201	A0A178UFG0	164.20	63	63	3.95E7	19	3	40	Y	29874	40S ribosomal protein S4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g06740 PE=3 SV=1
311	1079	P37702	164.13	45	45	3.58E8	20	16	38	Y	61133	Myrosinase 1 OS=Arabidopsis thaliana OX=3702 GN=TGG1 PE=1 SV=1
311	1080	A0A178U7L7	164.13	45	45	3.58E8	20	16	38	Y	61133	TGG1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g25990 PE=3 SV=1
429	1008	O65572	164.06	55	55	4.09E8	20	20	27	Y	60908	Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Arabidopsis thaliana OX=3702 GN=CCD1 PE=1 SV=2
548	467	A0A178VGM7	163.98	52	52	2.08E8	14	13	24	Y	54918	ALDH10A9 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g42200 PE=3 SV=1
548	468	Q9STS1	163.98	52	52	2.08E8	14	13	24	Y	54918	Betaine aldehyde dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALDH10A9 PE=1 SV=1
396	1763	A0A178VJH9	163.80	61	61	2.31E8	13	8	28	Y	33650	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g29680 PE=4 SV=1
396	1764	Q9LK29	163.80	61	61	2.31E8	13	8	28	Y	33650	Cytochrome c1 1, heme protein, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CYC11 PE=1 SV=1
454	1977	O82514	163.67	61	61	3.81E8	17	15	28	Y	26932	Adenylate kinase 4 OS=Arabidopsis thaliana OX=3702 GN=ADK1 PE=1 SV=2
454	1978	A0A178UAM7	163.67	61	61	3.81E8	17	15	28	Y	26932	ADK1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g62960 PE=3 SV=1
693	1166	A0A178V3J9	163.40	57	57	1.91E8	12	12	20	Y	34436	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g14660 PE=4 SV=1
693	1167	Q9SV68	163.40	57	57	1.91E8	12	12	20	Y	34436	Chloroplast envelope quinone oxidoreductase homolog OS=Arabidopsis thaliana OX=3702 GN=CEQORH PE=1 SV=1
398	768	Q9SE50	163.37	46	46	1.66E8	18	11	25	Y	60459	Beta-D-glucopyranosyl abscisate beta-glucosidase OS=Arabidopsis thaliana OX=3702 GN=BGLU18 PE=1 SV=2
479	996	Q9M292	163.27	41	41	1.41E8	19	19	26	N	62202	Nicalin OS=Arabidopsis thaliana OX=3702 GN=T22K7_10 PE=2 SV=1
479	1009	A0A178VH21	163.27	41	41	1.41E8	19	19	26	N	62202	Nicalin OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g37940 PE=3 SV=1
390	865	Q9LFA3	163.17	58	58	2.53E8	17	17	28	Y	46487	Monodehydroascorbate reductase 1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=MDAR1 PE=1 SV=1
390	866	A0A178VLU2	163.17	58	58	2.53E8	17	17	28	Y	46487	MDAR1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g47290 PE=4 SV=1
272	1257	O04308	163.12	35	35	1.71E8	16	8	39	Y	54053	Probable mitochondrial-processing peptidase subunit alpha-2, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPPA2 PE=1 SV=1
272	1258	A0A178VGY5	163.12	35	35	1.71E8	16	8	39	Y	53992	MPPalpha OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g17340 PE=3 SV=1
422	1569	A0A178VK33	163.11	47	47	3.38E8	14	14	25	N	45092	NTMC2TYPE4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g55310 PE=4 SV=1
422	1570	Q9LEX1	163.11	39	39	3.38E8	14	14	25	N	55095	At3g61050 OS=Arabidopsis thaliana OX=3702 GN=T27I15_140 PE=1 SV=1
603	539	Q93ZV8	162.97	39	39	1.65E8	15	14	20	Y	64722	RNI-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=emb2004 PE=2 SV=1
603	540	A0A178W753	162.97	39	39	1.65E8	15	14	20	Y	64722	Emb2004 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g10590 PE=4 SV=1
343	437	F4HQD4	162.94	44	44	2.29E7	27	4	35	Y	91681	Heat shock 70 kDa protein 15 OS=Arabidopsis thaliana OX=3702 GN=HSP70-15 PE=1 SV=1
490	2074	O80725	162.89	20	20	3.63E7	17	8	23	N	139028	ABC transporter B family member 4 OS=Arabidopsis thaliana OX=3702 GN=ABCB4 PE=1 SV=1
490	2075	A0A178VT74	162.89	20	20	3.63E7	17	8	23	N	139028	PGP4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g44740 PE=4 SV=1
555	944	A0A178V9N8	162.82	45	45	2.7E8	15	13	23	Y	45728	Cysteine synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g54160 PE=3 SV=1
555	945	Q43725	162.82	45	45	2.7E8	15	13	23	Y	45815	Cysteine synthase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OASC PE=1 SV=3
555	946	Q0WWQ5	162.82	45	45	2.7E8	15	13	23	Y	45815	Cysteine synthase OS=Arabidopsis thaliana OX=3702 GN=At3g59760 PE=2 SV=1
555	947	B9DFR6	162.82	45	45	2.7E8	15	13	23	Y	46115	Cysteine synthase OS=Arabidopsis thaliana OX=3702 GN=OASC PE=2 SV=1
623	1991	Q0WUX6	162.52	43	43	6.85E7	13	9	20	Y	56175	Citrate synthase OS=Arabidopsis thaliana OX=3702 GN=At2g42790 PE=2 SV=1
623	1992	Q9SJH7	162.52	43	43	6.85E7	13	9	20	Y	56175	Citrate synthase 3, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=CSY3 PE=2 SV=1
522	1354	Q0WPE4	162.36	64	64	2.16E8	17	17	25	Y	44773	Isovaleryl-CoA-dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=At3g45300 PE=2 SV=1
522	1355	Q9SWG0	162.36	64	64	2.16E8	17	17	25	Y	44773	Isovaleryl-CoA dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IVD PE=1 SV=2
585	1993	A0A178UKW8	162.28	77	77	2.51E8	14	10	23	Y	27837	GAMMA CA3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g66460 PE=4 SV=1
585	1994	Q94AU7	162.28	77	77	2.51E8	14	10	23	Y	27837	Gamma carbonic anhydrase 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GAMMACA3 PE=1 SV=1
505	614	A0A178WCG7	162.25	42	42	1.75E8	19	18	26	Y	80396	MCCA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g02310 PE=4 SV=1
505	615	Q42523	162.25	42	42	1.75E8	19	18	26	Y	80451	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MCCA PE=1 SV=2
517	896	A0A1I9LNS4	162.15	43	43	1.71E8	16	16	22	Y	59174	Class II aaRS and biotin synthetases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g62120 PE=1 SV=1
517	897	A0A178V838	162.15	42	42	1.71E8	16	16	22	Y	60756	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g56410 PE=3 SV=1
517	898	Q9M1R2	162.15	42	42	1.71E8	16	16	22	Y	60756	Proline--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At3g62120 PE=1 SV=1
578	963	P38605	162.10	30	30	1.12E8	17	15	22	Y	86033	Cycloartenol synthase OS=Arabidopsis thaliana OX=3702 GN=CAS1 PE=1 SV=2
411	1327	Q8LPJ5	162.02	49	49	1.31E8	20	16	28	Y	54196	Isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g14590 PE=1 SV=1
411	1328	A0A178UQB8	162.02	49	49	1.31E8	20	16	28	Y	54240	Isocitrate dehydrogenase [NADP] OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g14080 PE=3 SV=1
484	2411	A0A178VBA5	161.95	75	75	1.05E9	15	15	27	Y	21445	Peroxiredoxin OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g05750 PE=3 SV=1
484	2412	Q9M7T0	161.95	75	75	1.05E9	15	15	27	Y	21445	Peroxiredoxin-2F, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PRXIIF PE=1 SV=2
691	932	W8QN98	161.93	70	70	3.44E7	17	8	20	Y	40890	Glycosyltransferase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT5G15650 PE=2 SV=1
691	933	Q9LFW1	161.93	70	70	3.44E7	17	8	20	Y	40890	UDP-arabinopyranose mutase 2 OS=Arabidopsis thaliana OX=3702 GN=RGP2 PE=1 SV=1
691	934	A0A384L2V5	161.93	70	70	3.44E7	17	8	20	Y	40890	RGP2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g15170 PE=4 SV=1
443	557	P23686	161.91	56	56	2.46E7	16	5	28	Y	43158	S-adenosylmethionine synthase 1 OS=Arabidopsis thaliana OX=3702 GN=SAM1 PE=1 SV=2
443	558	A0A178WES1	161.91	56	56	2.46E7	16	5	28	Y	43158	S-adenosylmethionine synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g01660 PE=3 SV=1
474	1309	Q9LUW5	161.81	35	35	1.59E8	16	12	23	Y	65359	DEAD-box ATP-dependent RNA helicase 53, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RH53 PE=1 SV=1
573	1064	O80452	161.74	29	29	9.97E7	16	16	20	Y	95130	AMP deaminase OS=Arabidopsis thaliana OX=3702 GN=AMPD PE=1 SV=2
573	1065	A0A178VY66	161.74	29	29	9.97E7	16	16	20	Y	95130	FAC1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g35140 PE=4 SV=1
736	886	Q9SGC1	161.74	46	46	3.71E7	16	8	18	Y	63482	Probable phosphoglucomutase, cytoplasmic 2 OS=Arabidopsis thaliana OX=3702 GN=At1g70730 PE=1 SV=1
736	887	Q0WN31	161.74	46	46	3.71E7	16	8	18	Y	63482	Putative phosphoglucomutase OS=Arabidopsis thaliana OX=3702 GN=At1g70730 PE=2 SV=1
736	888	F4I6W3	161.74	45	45	3.71E7	16	8	18	Y	65567	Phosphoglucomutase/phosphomannomutase family protein OS=Arabidopsis thaliana OX=3702 GN=PGM2 PE=1 SV=1
736	889	F4I6W4	161.74	41	41	3.71E7	16	8	18	Y	72558	Phosphoglucomutase/phosphomannomutase family protein OS=Arabidopsis thaliana OX=3702 GN=PGM2 PE=1 SV=1
308	443	A0A384KW03	161.70	63	63	2.45E8	20	8	32	Y	41877	LSR2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g19970 PE=1 SV=1
308	444	Q96293	161.70	63	63	2.45E8	20	8	32	Y	41863	Actin-8 OS=Arabidopsis thaliana OX=3702 GN=ACT8 PE=1 SV=2
308	445	Q96292	161.70	63	63	2.45E8	20	8	32	Y	41877	Actin-2 OS=Arabidopsis thaliana OX=3702 GN=ACT2 PE=1 SV=1
308	446	A0A178WDV5	161.70	63	63	2.45E8	20	8	32	Y	41863	FIZ1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g43400 PE=3 SV=1
308	447	Q0WL95	161.70	63	63	2.45E8	20	8	32	Y	41877	AT3G18780 protein OS=Arabidopsis thaliana OX=3702 GN=At3g18780 PE=1 SV=1
607	344	Q9FNB0	161.56	20	20	5.1E7	18	17	19	N	153574	Magnesium-chelatase subunit ChlH, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CHLH PE=1 SV=1
607	345	A0A178U9Q0	161.56	20	20	5.1E7	18	17	19	N	153574	GUN5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g13050 PE=4 SV=1
613	2255	Q39002	161.44	28	28	4.98E7	16	7	22	Y	68134	ADP,ATP carrier protein 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AATP1 PE=1 SV=2
613	2256	A0A178W3C1	161.44	28	28	4.98E7	16	7	22	Y	68198	ADP,ATP carrier protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g75160 PE=3 SV=1
613	2257	Q0WW68	161.44	28	28	4.98E7	16	7	22	Y	68134	ADP,ATP carrier protein OS=Arabidopsis thaliana OX=3702 GN=At1g80300 PE=2 SV=1
134	2126	A0A178V026	161.40	39	39	1.62E7	20	5	52	Y	40718	ATAAC3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g32670 PE=3 SV=1
134	2127	O49447	161.40	39	39	1.62E7	20	5	52	Y	40718	ADP,ATP carrier protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AAC3 PE=1 SV=1
403	1003	F4I7I0	161.38	40	40	4.05E8	17	15	30	Y	59821	Alanine aminotransferase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALAAT1 PE=1 SV=1
364	297	Q56ZI2	161.33	44	44	1.96E8	23	21	33	N	76008	Patellin-2 OS=Arabidopsis thaliana OX=3702 GN=PATL2 PE=1 SV=2
392	920	Q5M729	161.17	42	42	8.92E7	16	10	32	Y	58468	Dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g54220 PE=1 SV=1
392	921	A0A178W5Y1	161.17	42	42	8.92E7	16	10	32	Y	58468	Acetyltransferase component of pyruvate dehydrogenase complex OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g48680 PE=3 SV=1
753	695	B9DFI7	161.07	33	33	1.27E8	13	13	17	Y	69623	Probable methyltransferase PMT2 OS=Arabidopsis thaliana OX=3702 GN=At1g26850 PE=2 SV=2
753	696	A0A178W7C5	161.07	33	33	1.27E8	13	13	17	Y	69623	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g27280 PE=4 SV=1
301	1583	Q8LDY5	161.06	49	49	3.5E8	17	7	33	Y	30903	40S ribosomal protein S2 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
301	1584	P49688	161.06	49	49	3.5E8	17	7	33	Y	30879	40S ribosomal protein S2-3 OS=Arabidopsis thaliana OX=3702 GN=RPS2C PE=1 SV=2
386	800	Q9ASV5	160.97	48	48	2.04E8	23	23	29	N	70553	AT4g39690/T19P19_80 OS=Arabidopsis thaliana OX=3702 GN=At4g39690 PE=2 SV=1
386	801	A0A178UT09	160.97	48	48	2.04E8	23	23	29	N	70650	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g45070 PE=3 SV=1
675	633	Q9FGY1	160.95	35	35	9.06E7	16	16	19	Y	83523	Beta-D-xylosidase 1 OS=Arabidopsis thaliana OX=3702 GN=BXL1 PE=1 SV=1
589	1448	A0A178UD50	160.85	63	63	7.14E7	18	14	24	Y	43172	PKT2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g47550 PE=3 SV=1
589	1441	Q570C8	160.85	57	57	7.14E7	18	14	24	Y	47956	3-ketoacyl-CoA thiolase 5, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=KAT5 PE=1 SV=2
589	1442	A0A178UEC0	160.85	57	57	7.14E7	18	14	24	Y	47956	PKT2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g47550 PE=3 SV=1
347	1202	Q93YV7	160.72	38	38	1.43E7	22	3	32	Y	69237	Probable methyltransferase PMT3 OS=Arabidopsis thaliana OX=3702 GN=At4g14360 PE=2 SV=1
347	1203	A0A178V5A4	160.72	38	38	1.43E7	22	3	32	Y	69237	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g16540 PE=4 SV=1
516	825	Q39161	160.44	35	35	1.22E8	15	15	19	Y	65505	Ferredoxin--nitrite reductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NIR1 PE=1 SV=1
595	2369	A0A178WA88	160.35	46	46	6.59E7	13	6	20	Y	33534	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g25630 PE=4 SV=1
595	2370	P33207	160.35	46	46	6.59E7	13	6	20	Y	33548	3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g24360 PE=1 SV=2
461	580	Q9C8G9	160.22	20	20	4E7	20	15	25	Y	181926	ABC transporter C family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCC1 PE=1 SV=1
461	581	A0A178WBV0	160.22	20	20	4E7	20	15	25	Y	181926	MRP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g30830 PE=4 SV=1
549	797	Q9S850	160.22	65	65	2.11E8	18	18	24	Y	43329	Sulfite oxidase OS=Arabidopsis thaliana OX=3702 GN=SOX PE=1 SV=1
549	798	Q0WWA1	160.22	65	65	2.11E8	18	18	24	Y	43329	Sulfite oxidase OS=Arabidopsis thaliana OX=3702 GN=At3g01910 PE=2 SV=1
549	799	A0A384KPJ8	160.22	65	65	2.11E8	18	18	24	Y	43329	SOX OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g01050 PE=4 SV=1
617	970	A0A178VYA3	159.97	39	39	1.1E8	17	15	21	Y	61961	3-ketoacyl-CoA synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g22080 PE=3 SV=1
617	971	Q570B4	159.97	39	39	1.1E8	17	15	21	Y	61961	3-ketoacyl-CoA synthase 10 OS=Arabidopsis thaliana OX=3702 GN=FDH PE=1 SV=2
475	472	A0A178V742	159.95	43	43	5.01E7	20	7	27	Y	65814	ACLB-1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g06470 PE=4 SV=1
475	473	Q9C522	159.95	43	43	5.01E7	20	7	27	Y	65814	ATP-citrate synthase beta chain protein 1 OS=Arabidopsis thaliana OX=3702 GN=ACLB-1 PE=2 SV=1
336	481	A0A178W449	159.93	26	26	1.17E8	20	14	33	Y	127944	KEA1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g00920 PE=4 SV=1
336	480	Q9ZTZ7	159.93	26	26	1.17E8	20	14	33	Y	128033	K(+) efflux antiporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=KEA1 PE=1 SV=2
365	783	O23144	159.88	45	45	2.03E8	23	23	30	Y	68879	Proton pump-interactor 1 OS=Arabidopsis thaliana OX=3702 GN=PPI1 PE=1 SV=2
622	680	A0A178UTZ4	159.60	43	43	8.76E7	18	18	22	Y	64013	MCCB OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g38940 PE=4 SV=1
622	681	Q9LDD8	159.60	43	43	8.76E7	18	18	22	Y	64013	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MCCB PE=2 SV=1
402	652	O49485	159.60	46	46	1.76E8	16	12	28	Y	63325	D-3-phosphoglycerate dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGDH1 PE=1 SV=1
402	653	A0A178UWV4	159.60	46	46	1.76E8	16	12	28	Y	63325	D-3-phosphoglycerate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g39120 PE=3 SV=1
424	2007	A0A178VCX3	159.14	65	65	1.35E8	17	5	29	Y	31171	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g29870 PE=3 SV=1
424	2008	Q8LBZ7	159.14	65	65	1.35E8	17	5	29	Y	31171	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SDH2-1 PE=1 SV=2
514	4624	P93004	159.12	40	40	5.72E8	11	8	24	Y	29743	Aquaporin PIP2-7 OS=Arabidopsis thaliana OX=3702 GN=PIP2-7 PE=1 SV=2
514	4625	A0A384LEJ8	159.12	40	40	5.72E8	11	8	24	Y	29743	SIMIP OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g40080 PE=3 SV=1
514	4626	C0SVL5	159.12	40	40	5.72E8	11	8	24	Y	29743	Uncharacterized protein At4g35100 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At4g35100 PE=2 SV=1
412	1289	Q9ZPF5	159.03	66	66	2.89E8	14	9	26	Y	37980	Arginase 2, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ARGAH2 PE=1 SV=1
412	1290	A0A178V1K8	159.03	66	66	2.89E8	14	9	26	Y	37980	ARGAH2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g10060 PE=3 SV=1
450	1172	Q9ZU52	158.97	59	59	2.77E8	17	14	29	Y	42327	Fructose-bisphosphate aldolase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FBA3 PE=1 SV=1
450	1173	A0A178VVW3	158.97	59	59	2.77E8	17	14	29	Y	42327	Fructose-bisphosphate aldolase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g00100 PE=3 SV=1
423	1345	A0A178VJ02	158.94	54	54	3.42E8	17	16	30	Y	37568	Ribosomal protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g57760 PE=3 SV=1
423	1344	Q9LY66	158.94	54	54	3.42E8	17	16	30	Y	37632	50S ribosomal protein L1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPL1 PE=1 SV=1
425	1779	A0A178UU90	158.85	51	51	1.5E8	12	7	28	Y	33690	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g38530 PE=4 SV=1
425	1780	Q9FKS5	158.85	51	51	1.5E8	12	7	28	Y	33690	Cytochrome c1 2, heme protein, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CYC12 PE=1 SV=1
348	3080	A0A178UAK9	158.83	50	50	2.09E8	18	12	31	Y	43639	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g53140 PE=4 SV=1
348	3081	Q9LVW0	158.83	50	50	2.09E8	18	12	31	Y	43607	At5g54100 OS=Arabidopsis thaliana OX=3702 GN=MJP23.8 PE=2 SV=1
261	1341	A0A1I9LRA3	158.65	48	48	7.55E8	15	15	41	Y	41106	TRAF-like family protein OS=Arabidopsis thaliana OX=3702 GN=At3g20370 PE=4 SV=1
261	1342	Q9LTQ5	158.65	45	45	7.55E8	15	15	41	Y	43449	AT3g20370/MQC12_13 OS=Arabidopsis thaliana OX=3702 GN=At3g20370 PE=2 SV=1
261	1343	A0A384KW99	158.65	45	45	7.55E8	15	15	41	Y	43449	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g21710 PE=4 SV=1
737	1175	Q9CA83	158.52	41	41	1.06E8	12	11	17	Y	71161	NADP-dependent malic enzyme 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NADP-ME4 PE=1 SV=1
737	1176	A0A178W4H6	158.52	41	41	1.06E8	12	11	17	Y	71161	Malic enzyme OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g74580 PE=3 SV=1
255	4295	A0A178VV72	158.44	62	62	1.46E9	11	6	41	Y	17947	Glycine cleavage system H protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g31950 PE=3 SV=1
255	4296	P25855	158.44	62	62	1.46E9	11	6	41	Y	17947	Glycine cleavage system H protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GDH1 PE=1 SV=1
459	2827	Q42577	158.41	60	60	3.95E8	15	15	27	Y	24044	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g11770 PE=1 SV=1
459	2828	A0A178UBF2	158.41	60	60	3.95E8	15	15	27	Y	24044	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g11500 PE=3 SV=1
437	2252	P57106	158.32	53	53	2.06E7	16	4	27	Y	35675	Malate dehydrogenase 2, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=MDH2 PE=1 SV=1
437	2253	A0A178UFW3	158.32	53	53	2.06E7	16	4	27	Y	35647	Malate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g41330 PE=3 SV=1
592	2166	Q8L636	158.24	31	31	3.11E8	15	15	23	Y	63417	Sodium/calcium exchanger NCL OS=Arabidopsis thaliana OX=3702 GN=NCL PE=2 SV=1
592	2167	A0A178W2M7	158.24	31	31	3.11E8	15	15	23	Y	63431	NCL OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g47530 PE=3 SV=1
546	1014	Q9LX99	158.19	26	26	4.2E7	21	18	23	Y	141035	Kinesin-like protein KIN-14A OS=Arabidopsis thaliana OX=3702 GN=KIN14A PE=1 SV=1
353	2330	A0A384KBX2	158.13	64	64	4.1E8	16	11	27	N	23767	60S ribosomal protein L13 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g43160 PE=1 SV=1
353	2331	B9DGA4	158.13	64	64	4.1E8	16	11	27	N	23767	60S ribosomal protein L13 OS=Arabidopsis thaliana OX=3702 GN=At3g49010 PE=1 SV=1
353	2332	P41127	158.13	64	64	4.1E8	16	11	27	N	23767	60S ribosomal protein L13-1 OS=Arabidopsis thaliana OX=3702 GN=RPL13B PE=1 SV=1
583	1139	A0A178VNV2	158.10	45	45	6.95E7	13	9	20	Y	56603	Citrate synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g53300 PE=3 SV=1
583	1140	Q9LXS6	158.10	45	45	6.95E7	13	9	20	Y	56603	Citrate synthase 2, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=CSY2 PE=2 SV=1
314	3256	O04313	158.02	64	64	7.8E7	15	10	32	N	32233	PYK10-binding protein 2 OS=Arabidopsis thaliana OX=3702 GN=PBP2 PE=1 SV=1
314	3257	A0A178VEL7	158.02	64	64	7.8E7	15	10	32	N	32233	PBPII OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g17290 PE=4 SV=1
401	619	A0A178W823	157.85	38	38	9.14E7	24	24	29	Y	96959	OMA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g75270 PE=4 SV=1
401	621	Q8VZM1	157.85	36	36	9.14E7	24	24	29	Y	102147	N-terminal acetyltransferase A complex auxiliary subunit NAA15 OS=Arabidopsis thaliana OX=3702 GN=NAA15 PE=1 SV=1
401	622	F4HS68	157.85	36	36	9.14E7	24	24	29	Y	103942	Tetratricopeptide repeat (TPR)-containing protein OS=Arabidopsis thaliana OX=3702 GN=EMB2753 PE=1 SV=1
779	1102	Q42522	157.78	49	49	6.93E7	13	6	17	Y	50142	Glutamate-1-semialdehyde 2,1-aminomutase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GSA2 PE=1 SV=2
779	1103	A0A178VHC7	157.78	49	49	6.93E7	13	6	17	Y	50142	GSA2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g42870 PE=3 SV=1
377	554	Q9S7C0	157.61	39	39	2.87E6	25	2	31	Y	91750	Heat shock 70 kDa protein 14 OS=Arabidopsis thaliana OX=3702 GN=HSP70-14 PE=1 SV=1
672	1313	A0A178VPH3	157.60	41	41	5.06E8	13	13	21	Y	41857	DJ1A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g15630 PE=4 SV=1
672	1314	Q9FPF0	157.60	41	41	5.06E8	13	13	21	Y	41857	Protein DJ-1 homolog A OS=Arabidopsis thaliana OX=3702 GN=DJ1A PE=1 SV=1
351	1389	Q9SJ12	157.57	68	68	2.83E8	22	22	32	N	27597	Probable ATP synthase 24 kDa subunit, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g21870 PE=1 SV=1
668	1984	A0A178VLH8	157.56	35	35	8.11E7	13	12	19	Y	60026	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g47360 PE=4 SV=1
668	1985	Q9LF97	157.56	35	35	8.11E7	13	12	19	Y	60026	CBS domain-containing protein CBSCBSPB3 OS=Arabidopsis thaliana OX=3702 GN=CBSCBSPB3 PE=1 SV=1
775	1801	Q0WLF5	157.56	36	36	1.75E8	10	10	16	Y	53013	Cysteine synthase OS=Arabidopsis thaliana OX=3702 GN=At4g14880 PE=2 SV=1
676	1394	Q8GZ99	157.50	21	21	5.77E7	13	11	15	Y	104708	At5g49760 OS=Arabidopsis thaliana OX=3702 GN=LRR-RLK PE=1 SV=1
676	1395	A0A178UIE9	157.50	21	21	5.77E7	13	11	15	Y	104708	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g48610 PE=1 SV=1
676	1393	Q9LT97	157.50	21	21	5.77E7	13	11	15	Y	103891	Receptor protein kinase-like OS=Arabidopsis thaliana OX=3702 PE=3 SV=1
315	909	F4IX90	157.48	47	47	2.99E8	21	17	33	Y	62477	Phosphoinositide phospholipase C OS=Arabidopsis thaliana OX=3702 GN=PLC2 PE=1 SV=1
315	910	Q39033	157.48	44	44	2.99E8	21	17	33	Y	66122	Phosphoinositide phospholipase C 2 OS=Arabidopsis thaliana OX=3702 GN=PLC2 PE=1 SV=1
315	911	A0A384L124	157.48	44	44	2.99E8	21	17	33	Y	66122	Phosphoinositide phospholipase C OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g08100 PE=4 SV=1
315	912	C0Z2P3	157.48	44	44	2.99E8	21	17	33	Y	66122	Phosphoinositide phospholipase C OS=Arabidopsis thaliana OX=3702 GN=At3g08510 PE=2 SV=1
291	1836	P49209	157.43	68	68	1.29E9	15	10	41	Y	22018	60S ribosomal protein L9-1 OS=Arabidopsis thaliana OX=3702 GN=RPL9B PE=1 SV=3
291	1837	A0A178W8D1	157.43	68	68	1.29E9	15	10	41	Y	22018	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g33850 PE=4 SV=1
291	1838	Q8LCC2	157.43	68	68	1.29E9	15	10	41	Y	22049	Ribosomal protein L9, putative OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
498	576	O04485	157.33	25	25	8.14E7	18	18	25	Y	122848	AT1G09620 protein OS=Arabidopsis thaliana OX=3702 GN=F21M12.1 PE=2 SV=1
498	577	F4I116	157.33	25	25	8.14E7	18	18	25	Y	123451	Leucine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At1g09620 PE=1 SV=1
498	578	A0A178W121	157.33	22	22	8.14E7	18	18	25	Y	138466	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g09560 PE=3 SV=1
458	1681	O49460	157.32	62	62	2.11E8	13	10	27	N	31706	Prohibitin-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PHB1 PE=1 SV=1
458	1682	A0A178UY74	157.32	62	62	2.11E8	13	10	27	N	31706	PHB1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g32830 PE=4 SV=1
244	1761	A0A178UAS6	157.31	48	48	9.89E7	14	6	40	Y	35351	Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g22800 PE=3 SV=1
244	1762	Q8LAD2	157.31	48	48	9.89E7	14	6	40	Y	35317	Succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g23250 PE=1 SV=2
363	4528	Q9LYR2	157.16	33	33	9.99E7	15	4	30	Y	29902	Cytochrome b-c1 complex subunit Rieske-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=UCR1-2 PE=1 SV=1
363	4529	A0A178U9B8	157.16	33	33	9.99E7	15	4	30	Y	29902	Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g12860 PE=4 SV=1
647	255	A0A178UIA9	157.05	57	57	8.44E7	16	15	20	Y	64413	Malic enzyme OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g11400 PE=3 SV=1
647	256	Q9LYG3	157.05	57	57	8.44E7	16	15	20	Y	64413	NADP-dependent malic enzyme 2 OS=Arabidopsis thaliana OX=3702 GN=NADP-ME2 PE=1 SV=1
431	656	Q8LF21	156.92	50	50	7.79E7	19	15	28	Y	68723	Dynamin-related protein 1C OS=Arabidopsis thaliana OX=3702 GN=DRP1C PE=1 SV=2
431	657	A0A178W4V6	156.92	50	50	7.79E7	19	15	28	Y	68723	DRP1C OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g15510 PE=3 SV=1
631	7948	P28297	156.92	36	36	1.62E8	15	15	20	Y	64245	Isocitrate lyase OS=Arabidopsis thaliana OX=3702 GN=ICL PE=1 SV=2
631	7949	Q0WWE9	156.92	36	36	1.62E8	15	15	20	Y	64245	Isocitrate lyase OS=Arabidopsis thaliana OX=3702 GN=At3g21720 PE=2 SV=1
631	7950	A0A384KC84	156.92	36	36	1.62E8	15	15	20	Y	64245	Isocitrate lyase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g23300 PE=3 SV=1
427	850	Q0WL80	156.80	20	20	7.32E7	20	20	26	Y	181804	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
427	851	A0A178W3S9	156.80	20	20	7.32E7	20	20	26	Y	181804	UGGT OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g65430 PE=4 SV=1
427	852	A0A178W3V2	156.80	20	20	7.32E7	20	20	26	Y	181932	UGGT OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g65430 PE=4 SV=1
427	853	A0A1P8AVX3	156.80	20	20	7.32E7	20	20	26	Y	186413	EMS-MUTAGENIZED BRI1 SUPPRESSOR 1 OS=Arabidopsis thaliana OX=3702 GN=EBS1 PE=4 SV=1
666	975	A0A090MHY5	156.70	46	46	8.18E7	17	17	21	Y	66807	Glucose-6-phosphate isomerase OS=Arabidopsis thaliana OX=3702 GN=PGI1 (At4g24620) PE=2 SV=1
666	976	A0A178UUU3	156.70	46	46	8.18E7	17	17	21	Y	67048	Glucose-6-phosphate isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g28500 PE=3 SV=1
666	977	Q8H103	156.70	46	46	8.18E7	17	17	21	Y	67048	Glucose-6-phosphate isomerase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGI1 PE=1 SV=1
464	1428	A0A178UWS8	156.60	36	36	3.82E7	21	16	21	Y	89627	NOXY15 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g38490 PE=3 SV=1
464	1429	Q8S944	156.60	36	36	3.82E7	21	16	21	Y	89627	Dynamin-related protein 3A OS=Arabidopsis thaliana OX=3702 GN=DRP3A PE=1 SV=2
464	1430	F4JJ15	156.60	36	36	3.82E7	21	16	21	Y	89755	Dynamin-related protein 3A OS=Arabidopsis thaliana OX=3702 GN=DRP3A PE=3 SV=1
464	1431	A0A178UUQ6	156.60	36	36	3.82E7	21	16	21	Y	89755	NOXY15 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g38490 PE=3 SV=1
283	803	Q9S791	156.51	42	42	2.55E8	23	20	37	Y	66865	AT1G70770 protein OS=Arabidopsis thaliana OX=3702 GN=F15H11.2 PE=1 SV=1
283	809	A0A178WI68	156.51	42	42	2.55E8	23	20	37	Y	66817	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g64950 PE=4 SV=1
598	964	Q9CAF6	156.28	27	27	1.15E8	16	16	18	Y	104538	DNA gyrase subunit A, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GYRA PE=1 SV=2
598	965	A0A178VFU0	156.28	27	27	1.15E8	16	16	18	Y	104538	GYRA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g10540 PE=3 SV=1
598	966	A0A178VFQ6	156.28	27	27	1.15E8	16	16	18	Y	104694	GYRA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g10540 PE=3 SV=1
643	1939	Q96266	156.21	55	55	1.65E8	10	9	18	N	29232	Glutathione S-transferase F8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GSTF8 PE=1 SV=3
643	1942	A0A178VZN0	156.21	55	55	1.65E8	10	9	18	N	29319	GSTF8 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g45510 PE=3 SV=1
440	5761	Q9SLF7	156.02	85	85	8.05E7	11	4	28	N	11444	60S acidic ribosomal protein P2-2 OS=Arabidopsis thaliana OX=3702 GN=RPP2B PE=1 SV=1
440	5762	B9DGN3	156.02	85	85	8.05E7	11	4	28	N	11444	AT2G27710 protein OS=Arabidopsis thaliana OX=3702 GN=At2g27710 PE=2 SV=1
463	1883	P60040	155.97	47	47	3.15E8	12	6	22	Y	28171	60S ribosomal protein L7-2 OS=Arabidopsis thaliana OX=3702 GN=RPL7B PE=1 SV=1
463	1884	A0A178VX60	155.97	47	47	3.15E8	12	6	22	Y	28171	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g00220 PE=4 SV=1
426	1334	F4JNE4	155.96	8	8	3.98E7	23	23	24	Y	471012	Pleckstrin homology (PH) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At4g17140 PE=4 SV=1
426	1335	F4JNE3	155.96	8	8	3.98E7	23	23	24	Y	471260	Pleckstrin homology (PH) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At4g17140 PE=4 SV=1
426	1336	F4JNE2	155.96	8	8	3.98E7	23	23	24	Y	471227	Pleckstrin homology (PH) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At4g17140 PE=4 SV=1
408	1127	C0Z361	155.93	32	32	6.33E6	18	3	29	Y	63325	Chaperonin 60 subunit beta 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CPN60B3 PE=1 SV=1
408	1128	A0A178UKH6	155.93	32	32	6.33E6	18	3	29	Y	63325	Cpn60beta3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g55700 PE=3 SV=1
562	2960	A0A178WHT4	155.92	46	46	4.01E8	11	11	21	N	31139	TLP18.3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g49280 PE=4 SV=1
562	2961	Q9ZVL6	155.92	46	46	4.01E8	11	11	21	N	31139	UPF0603 protein At1g54780, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g54780 PE=1 SV=1
352	955	Q945K7	155.84	53	53	3.24E8	16	5	30	Y	40625	Isocitrate dehydrogenase [NAD] catalytic subunit 5, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH5 PE=1 SV=1
352	954	A0A178UB52	155.84	53	53	3.24E8	16	5	30	Y	40639	Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g02510 PE=3 SV=1
542	1546	Q1KPV0	155.76	29	29	4.42E7	18	18	20	Y	100730	Probable transmembrane GTPase FZO-like, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FZL PE=1 SV=1
191	3958	Q9XF91	155.72	37	37	3.78E9	12	12	45	Y	28008	Photosystem II 22 kDa protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSBS PE=2 SV=1
191	3959	A0A178WCN8	155.72	37	37	3.78E9	12	12	45	Y	28008	PSBS OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g40380 PE=4 SV=1
761	2357	F4JSM3	155.70	39	39	9.8E7	12	12	17	Y	59245	Non-intrinsic ABC protein 8 OS=Arabidopsis thaliana OX=3702 GN=ABCB28 PE=4 SV=1
761	2363	Q8LPQ6	155.70	29	29	9.8E7	12	12	17	Y	77926	ABC transporter B family member 28 OS=Arabidopsis thaliana OX=3702 GN=ABCB28 PE=2 SV=1
565	1272	A0A178UGH7	155.52	49	49	1.83E7	13	4	25	Y	37880	ADK2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g02520 PE=4 SV=1
565	1273	Q9LZG0	155.52	49	49	1.83E7	13	4	25	Y	37846	Adenosine kinase 2 OS=Arabidopsis thaliana OX=3702 GN=ADK2 PE=1 SV=1
762	1631	O65581	155.45	59	59	8.27E7	14	11	18	Y	38294	Fructose-bisphosphate aldolase 5, cytosolic OS=Arabidopsis thaliana OX=3702 GN=FBA5 PE=1 SV=1
762	1632	A0A178V385	155.45	59	59	8.27E7	14	11	18	Y	38294	Fructose-bisphosphate aldolase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g30610 PE=3 SV=1
567	3440	Q93VP3	155.33	76	76	2.48E8	11	8	24	Y	17140	Eukaryotic translation initiation factor 5A-2 OS=Arabidopsis thaliana OX=3702 GN=ELF5A-2 PE=1 SV=1
567	3441	A0A178WC68	155.33	76	76	2.48E8	11	8	24	Y	17140	Eukaryotic translation initiation factor 5A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g27010 PE=3 SV=1
579	1133	F4JTN0	155.33	20	20	9.14E7	15	15	22	Y	139971	Patched family protein OS=Arabidopsis thaliana OX=3702 GN=At4g38350 PE=4 SV=1
579	1134	F4JTN1	155.33	19	19	9.14E7	15	15	22	Y	142677	Patched family protein OS=Arabidopsis thaliana OX=3702 GN=At4g38350 PE=4 SV=1
406	2087	A0A178UZT1	155.33	58	58	1.52E8	17	8	28	Y	29803	40S ribosomal protein S3a OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g39670 PE=3 SV=1
406	2088	Q42262	155.33	58	58	1.52E8	17	8	28	Y	29803	40S ribosomal protein S3a-2 OS=Arabidopsis thaliana OX=3702 GN=RPS3AB PE=2 SV=3
659	2887	A0A1B1W4U4	155.19	91	91	5.84E8	10	6	22	Y	14499	ATP synthase epsilon chain, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=atpE PE=3 SV=1
659	2888	P09468	155.19	91	91	5.84E8	10	6	22	Y	14499	ATP synthase epsilon chain, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=atpE PE=1 SV=2
539	434	Q9SE60	155.17	52	52	1.03E8	19	13	22	Y	66289	Methylenetetrahydrofolate reductase 1 OS=Arabidopsis thaliana OX=3702 GN=MTHFR1 PE=1 SV=1
539	435	A0A178VC94	155.17	52	52	1.03E8	19	13	22	Y	66289	Methylenetetrahydrofolate reductase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g54370 PE=3 SV=1
534	779	Q9LD55	155.17	21	21	1.11E8	12	12	21	Y	114300	Eukaryotic translation initiation factor 3 subunit A OS=Arabidopsis thaliana OX=3702 GN=TIF3A1 PE=1 SV=1
534	780	Q0WW10	155.17	21	21	1.11E8	12	12	21	Y	114300	Eukaryotic translation initiation factor 3 subunit A OS=Arabidopsis thaliana OX=3702 GN=At4g11420 PE=2 SV=1
534	781	A0A178V400	155.17	21	21	1.11E8	12	12	21	Y	114358	Eukaryotic translation initiation factor 3 subunit A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g12910 PE=3 SV=1
512	2289	A0A178VHG0	155.16	56	56	4.13E8	13	13	25	Y	24684	Peroxiredoxin OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g47370 PE=3 SV=1
512	2290	Q949U7	155.16	56	56	4.13E8	13	13	25	Y	24684	Peroxiredoxin-2E, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PRXIIE PE=1 SV=2
455	1398	Q944K2	155.03	41	41	2.86E8	16	16	26	N	48744	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Arabidopsis thaliana OX=3702 GN=OST48 PE=2 SV=1
455	1399	A0A178UHG1	155.03	41	41	2.86E8	16	16	26	N	48744	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g66680 PE=3 SV=1
882	1001	P42799	154.98	49	49	4.57E7	13	6	15	Y	50370	Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GSA1 PE=1 SV=1
882	1002	A0A178UF15	154.98	49	49	4.57E7	13	6	15	Y	50354	GSA1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g63120 PE=3 SV=1
509	1645	F4HU93	154.92	70	70	4.12E8	13	11	25	Y	27520	Ascorbate peroxidase 1 OS=Arabidopsis thaliana OX=3702 GN=APX1 PE=1 SV=1
509	1646	A0A178W5I1	154.92	70	70	4.12E8	13	11	25	Y	27561	MEE6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g07590 PE=3 SV=1
509	1647	Q05431	154.92	70	70	4.12E8	13	11	25	Y	27561	L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis thaliana OX=3702 GN=APX1 PE=1 SV=2
491	1016	Q8LCE1	154.71	58	58	1.53E7	14	5	21	Y	39207	Glutamine synthetase cytosolic isozyme 1-2 OS=Arabidopsis thaliana OX=3702 GN=GLN1-2 PE=1 SV=2
491	1017	A0A178W9R9	154.71	58	58	1.53E7	14	5	21	Y	39207	Glutamine synthetase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g59890 PE=3 SV=1
491	1018	Q0WWL2	154.71	58	58	1.53E7	14	5	21	Y	39233	Glutamine synthetase OS=Arabidopsis thaliana OX=3702 GN=At1g66200 PE=2 SV=1
367	1949	A0A178VUX3	154.67	61	61	1.42E8	13	8	28	N	31637	PHB6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g15860 PE=4 SV=1
367	1950	Q9SIL6	154.67	61	61	1.42E8	13	8	28	N	31637	Prohibitin-6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PHB6 PE=1 SV=1
469	1674	A0A1P8B4I5	154.67	57	57	2.07E8	13	13	24	Y	33271	Adenine nucleotide transporter 1 OS=Arabidopsis thaliana OX=3702 GN=ADNT1 PE=1 SV=1
469	1454	O04619	154.67	49	49	2.07E8	13	13	24	Y	38325	Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana OX=3702 GN=ADNT1 PE=1 SV=1
469	1455	A0A178UTF8	154.67	49	49	2.07E8	13	13	24	Y	38325	ADNT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g01420 PE=3 SV=1
685	1981	A0A178VEW8	154.64	38	38	3.39E8	13	13	19	Y	45164	HCEF1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g48450 PE=3 SV=1
685	1982	P25851	154.64	38	38	3.39E8	13	13	19	Y	45162	Fructose-1,6-bisphosphatase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CFBP1 PE=1 SV=2
639	555	Q9FXA2	154.55	30	30	9.24E7	14	12	21	Y	72779	Polyadenylate-binding protein 8 OS=Arabidopsis thaliana OX=3702 GN=PAB8 PE=1 SV=1
639	556	A0A178W710	154.55	30	30	9.24E7	14	12	21	Y	73035	Polyadenylate-binding protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g43950 PE=3 SV=1
457	784	Q9LW85	154.53	29	29	1.32E8	19	19	28	N	81973	MAR-binding filament-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=MFP1 PE=2 SV=2
470	1415	A0A2H1ZE77	154.49	25	25	1.88E8	17	17	24	Y	109164	Lon protease homolog, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LON1 PE=1 SV=1
686	2208	F4JFY5	154.42	42	42	1.5E8	11	8	17	Y	40279	Stromal ascorbate peroxidase OS=Arabidopsis thaliana OX=3702 GN=SAPX PE=3 SV=1
686	2209	Q42592	154.42	42	42	1.5E8	11	8	17	Y	40407	L-ascorbate peroxidase S, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=APXS PE=1 SV=2
382	5968	O23482	154.38	29	29	1.79E8	13	13	31	Y	82441	Oligopeptide transporter 3 OS=Arabidopsis thaliana OX=3702 GN=OPT3 PE=2 SV=3
382	5969	A0A178UX74	154.38	29	29	1.79E8	13	13	31	Y	82441	OPT3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g19190 PE=4 SV=1
523	1144	Q7XJJ7	154.36	39	39	1.03E8	16	16	21	Y	66079	Fatty acid amide hydrolase OS=Arabidopsis thaliana OX=3702 GN=FAAH PE=1 SV=1
554	668	Q9SU56	154.19	42	42	2.23E8	19	19	25	Y	68555	L-galactono-1,4-lactone dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GLDH PE=1 SV=1
554	669	A0A178VN92	154.19	42	42	2.23E8	19	19	25	Y	68555	GLDH OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g41910 PE=4 SV=1
385	4109	B9DFR9	154.01	47	47	8.83E8	16	6	30	Y	29132	AT2G45960 protein OS=Arabidopsis thaliana OX=3702 GN=PIP1B PE=2 SV=1
385	4110	A0A384KNK4	154.01	45	45	8.83E8	16	6	30	Y	30598	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g43570 PE=3 SV=1
385	4111	D9IX99	154.01	45	45	8.83E8	16	6	30	Y	30598	Aquaporin OS=Arabidopsis thaliana OX=3702 GN=Aqua PE=2 SV=1
385	4112	Q06611	154.01	45	45	8.83E8	16	6	30	Y	30598	Aquaporin PIP1-2 OS=Arabidopsis thaliana OX=3702 GN=PIP1-2 PE=1 SV=1
385	4113	A8MRW1	154.01	43	43	8.83E8	16	6	30	Y	32455	Plasma membrane intrinsic protein 1B OS=Arabidopsis thaliana OX=3702 GN=PIP1B PE=3 SV=1
558	3072	Q42139	153.89	45	45	6.42E8	14	14	23	N	23918	AT4g32260/F10M6_100 OS=Arabidopsis thaliana OX=3702 GN=PDE334 PE=1 SV=2
558	3073	A0A178V017	153.89	45	45	6.42E8	14	14	23	N	23918	PDE334 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g37010 PE=1 SV=1
381	961	A0A178UUU1	153.86	40	40	1.73E8	24	24	30	Y	97779	Phospholipase D OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g40920 PE=3 SV=1
381	962	Q9C5Y0	153.86	40	40	1.73E8	24	24	30	Y	98917	Phospholipase D delta OS=Arabidopsis thaliana OX=3702 GN=PLDDELTA PE=1 SV=2
724	2147	Q9C641	153.84	35	35	1E7	14	2	19	Y	83179	Elongation factor G-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MEFG1 PE=1 SV=1
724	2148	A0A178WBE3	153.84	35	35	1E7	14	2	19	Y	83179	Elongation factor G, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g40950 PE=3 SV=1
436	828	O65272	153.82	26	26	4.27E7	18	12	27	Y	126157	K(+) efflux antiporter 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=KEA2 PE=1 SV=2
432	2188	O22126	153.82	37	37	5.73E8	13	13	26	N	43075	Fasciclin-like arabinogalactan protein 8 OS=Arabidopsis thaliana OX=3702 GN=FLA8 PE=2 SV=1
432	2189	A0A178VL71	153.82	37	37	5.73E8	13	13	26	N	43061	FLA8 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g43060 PE=4 SV=1
636	1311	A0A178UTX6	153.81	34	34	1.03E8	14	10	21	Y	74140	Transmembrane 9 superfamily member OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g14280 PE=3 SV=1
636	1312	F4JRE0	153.81	34	34	1.03E8	14	10	21	Y	74140	Transmembrane 9 superfamily member 12 OS=Arabidopsis thaliana OX=3702 GN=TMN12 PE=2 SV=1
590	689	Q9SRT9	153.81	66	66	5.09E7	17	7	22	Y	40629	UDP-arabinopyranose mutase 1 OS=Arabidopsis thaliana OX=3702 GN=RGP1 PE=1 SV=1
590	690	A0A178VK37	153.81	66	66	5.09E7	17	7	22	Y	40629	RGP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g01420 PE=4 SV=1
444	1589	A0A178V5U2	153.76	76	76	4.02E8	19	19	28	N	19586	ATP synthase subunit d, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g46730 PE=3 SV=1
444	1590	Q9FT52	153.76	76	76	4.02E8	19	19	28	N	19586	ATP synthase subunit d, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g52300 PE=1 SV=3
677	995	A8MQR6	153.50	39	39	2.71E8	11	11	19	Y	53406	Aldehyde dehydrogenase 6B2 OS=Arabidopsis thaliana OX=3702 GN=ALDH6B2 PE=4 SV=1
677	907	A0A178VQ51	153.50	37	37	2.71E8	11	11	19	Y	57512	ALDH6B2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g09270 PE=4 SV=1
677	908	Q0WM29	153.50	32	32	2.71E8	11	11	19	Y	65927	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALDH6B2 PE=1 SV=2
489	2110	A0A178VIY4	153.49	58	58	8.81E7	12	7	23	N	30638	PHB4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g29740 PE=4 SV=1
489	2111	Q9LK25	153.49	58	58	8.81E7	12	7	23	N	30638	Prohibitin-4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PHB4 PE=1 SV=1
487	986	Q8LG77	153.45	50	50	5.37E7	15	4	23	Y	40576	Isocitrate dehydrogenase [NAD] catalytic subunit 6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH6 PE=1 SV=2
487	987	A0A178V9M1	153.45	50	50	5.37E7	15	4	23	Y	40576	Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g09480 PE=3 SV=1
618	1108	Q96514	153.31	40	40	7.94E7	18	14	21	Y	57209	Cytochrome P450 71B7 OS=Arabidopsis thaliana OX=3702 GN=CYP71B7 PE=1 SV=1
618	1109	A0A178WGC6	153.31	40	40	7.94E7	18	14	21	Y	57209	CYP71B7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g13540 PE=3 SV=1
267	1371	Q9FJA6	153.29	72	72	3.63E7	19	3	38	Y	27458	40S ribosomal protein S3-3 OS=Arabidopsis thaliana OX=3702 GN=RPS3C PE=1 SV=1
267	1372	A0A178U7F3	153.29	72	72	3.63E7	19	3	38	Y	27458	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g32680 PE=4 SV=1
414	1843	A0A178V5V9	153.28	64	64	3.09E8	14	12	28	Y	28532	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g43870 PE=4 SV=1
414	1844	Q9M2Y6	153.28	64	64	3.09E8	14	12	28	Y	28532	Probable pectin methylesterase CGR2 OS=Arabidopsis thaliana OX=3702 GN=CGR2 PE=2 SV=1
637	1465	Q41931	153.27	70	70	1.75E8	12	11	21	Y	36183	1-aminocyclopropane-1-carboxylate oxidase 2 OS=Arabidopsis thaliana OX=3702 GN=ACO2 PE=1 SV=2
660	4096	A0A1P8BD74	153.21	44	44	3.54E7	10	2	20	N	26712	2-cysteine peroxiredoxin B OS=Arabidopsis thaliana OX=3702 GN=2-Cys Prx B PE=4 SV=1
660	4097	Q8LEA5	153.21	39	39	3.54E7	10	2	20	N	29515	2-cys peroxiredoxin-like protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
660	4098	Q9C5R8	153.21	39	39	3.54E7	10	2	20	N	29780	2-Cys peroxiredoxin BAS1-like, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g06290 PE=2 SV=3
660	4099	A0A178ULP1	153.21	39	39	3.54E7	10	2	20	N	29733	2CPB OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g05830 PE=4 SV=1
286	1425	A0A178VLH7	153.07	55	55	3.72E7	18	2	37	Y	27349	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g48240 PE=4 SV=1
286	1426	Q9M339	153.07	55	55	3.72E7	18	2	37	Y	27349	40S ribosomal protein S3-2 OS=Arabidopsis thaliana OX=3702 GN=RPS3B PE=1 SV=1
802	654	P93042	152.99	29	29	1.38E8	16	16	18	Y	89092	Protein ROOT HAIR DEFECTIVE 3 OS=Arabidopsis thaliana OX=3702 GN=RHD3 PE=1 SV=1
802	655	A0A178VD05	152.99	29	29	1.38E8	16	16	18	Y	89064	Protein ROOT HAIR DEFECTIVE 3 homolog OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g14330 PE=3 SV=1
360	989	O48963	152.96	35	35	1.16E8	25	21	28	Y	111689	Phototropin-1 OS=Arabidopsis thaliana OX=3702 GN=PHOT1 PE=1 SV=1
360	990	A0A178VFT4	152.96	35	35	1.16E8	25	21	28	Y	111689	RPT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g39640 PE=4 SV=1
378	2192	A0A178W7G7	152.74	43	43	2.03E8	15	5	25	Y	30771	XW6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g52360 PE=3 SV=1
378	2193	G1JSI6	152.74	43	43	2.03E8	15	5	25	Y	30741	At1g59359 OS=Arabidopsis thaliana OX=3702 GN=At1g59359 PE=3 SV=1
378	2194	B5BRD8	152.74	43	43	2.03E8	15	5	25	Y	30771	40S ribosomal protein S2 OS=Arabidopsis thaliana OX=3702 GN=At1g59359 orthologue PE=3 SV=1
378	2195	A0A384KXC9	152.74	43	43	2.03E8	15	5	25	Y	30771	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g52560 PE=3 SV=1
378	2196	Q8L8Y0	152.74	43	43	2.03E8	15	5	25	Y	30741	40S ribosomal protein S2-1 OS=Arabidopsis thaliana OX=3702 GN=RPS2A PE=2 SV=2
378	2197	Q93VB8	152.74	43	43	2.03E8	15	5	25	Y	30771	40S ribosomal protein S2-2 OS=Arabidopsis thaliana OX=3702 GN=RPS2B PE=2 SV=1
378	2198	G1JSH2	152.74	43	43	2.03E8	15	5	25	Y	30771	At1g58380 OS=Arabidopsis thaliana OX=3702 GN=At1g58380 PE=3 SV=1
811	2837	Q9LXZ4	152.62	47	47	1.36E8	10	10	17	Y	37266	GroES-like zinc-binding alcohol dehydrogenase family protein OS=Arabidopsis thaliana OX=3702 GN=T5P19_110 PE=2 SV=1
811	2838	A0A384KNJ3	152.62	47	47	1.36E8	10	10	17	Y	37266	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g51070 PE=4 SV=1
783	1649	P93736	152.56	21	21	3.32E7	14	14	15	Y	125926	Valine--tRNA ligase, mitochondrial 1 OS=Arabidopsis thaliana OX=3702 GN=TWN2 PE=1 SV=2
783	1650	A0A178WJB0	152.56	21	21	3.32E7	14	14	15	Y	125925	VALRS OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g15220 PE=3 SV=1
531	1778	Q9LJP2	152.55	47	47	2.74E8	12	11	25	Y	40249	GDSL esterase/lipase At3g14220 OS=Arabidopsis thaliana OX=3702 GN=At3g14220 PE=2 SV=1
292	2015	B9DG17	152.51	49	49	6.89E8	15	8	39	Y	31981	40S ribosomal protein SA OS=Arabidopsis thaliana OX=3702 GN=P40 PE=1 SV=1
292	2016	A0A178WNA1	152.51	49	49	6.89E8	15	8	39	Y	32291	40S ribosomal protein SA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g66550 PE=3 SV=1
292	2017	Q08682	152.51	49	49	6.89E8	15	8	39	Y	32291	40S ribosomal protein Sa-1 OS=Arabidopsis thaliana OX=3702 GN=RPSaA PE=1 SV=3
571	1087	Q944A7	152.48	47	47	8.98E7	18	16	22	Y	56818	Serine/threonine-protein kinase BSK1 OS=Arabidopsis thaliana OX=3702 GN=BSK1 PE=1 SV=1
362	4564	Q01667	152.20	36	36	1.15E9	11	11	32	Y	25996	Chlorophyll a-b binding protein 6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LHCA1 PE=1 SV=1
362	4565	A0A178VBT7	152.20	36	36	1.15E9	11	11	32	Y	25996	Chlorophyll a-b binding protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g49420 PE=3 SV=1
187	713	Q96528	152.18	37	37	4.75E7	15	5	48	Y	56762	Catalase-1 OS=Arabidopsis thaliana OX=3702 GN=CAT1 PE=1 SV=3
187	714	Q0WUH6	152.18	37	37	4.75E7	15	5	48	Y	56762	Catalase OS=Arabidopsis thaliana OX=3702 GN=At1g20630 PE=2 SV=1
187	715	A0A384KXY6	152.18	37	37	4.75E7	15	5	48	Y	56762	Catalase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g21610 PE=3 SV=1
725	59852	A0A178V8B4	152.16	49	49	8.7E7	14	14	16	N	55063	PAP85 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g24400 PE=4 SV=1
725	59853	Q9LUJ7	152.16	49	49	8.7E7	14	14	16	N	55063	Vicilin-like seed storage protein At3g22640 OS=Arabidopsis thaliana OX=3702 GN=PAP85 PE=2 SV=1
430	857	A0A178UXV2	152.01	65	65	7.27E8	18	18	27	Y	43723	HCF244 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g40280 PE=1 SV=1
430	858	O65502	152.01	65	65	7.27E8	18	18	27	Y	43723	AT4g35250/F23E12_190 OS=Arabidopsis thaliana OX=3702 GN=HCF244 PE=1 SV=1
593	2563	A0A178UU76	151.81	54	54	2.55E8	14	12	21	Y	35721	PGR5-LIKE A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g26570 PE=4 SV=1
593	2564	Q8H112	151.81	54	54	2.55E8	14	12	21	Y	35721	PGR5-like protein 1A, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGRL1A PE=1 SV=1
611	2833	Q9SX77	151.63	59	59	3.04E8	12	12	22	Y	28106	Succinate dehydrogenase subunit 5, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SDH5 PE=1 SV=1
601	1243	O49160	151.57	24	24	7.76E7	17	17	20	Y	102949	Eukaryotic translation initiation factor 3 subunit C OS=Arabidopsis thaliana OX=3702 GN=TIF3C1 PE=1 SV=2
651	1517	Q9SQI8	151.51	44	44	1.25E8	12	11	21	Y	50080	Dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LTA2 PE=2 SV=1
740	1954	P42644	151.42	55	55	9.19E7	12	5	17	Y	28606	14-3-3-like protein GF14 psi OS=Arabidopsis thaliana OX=3702 GN=GRF3 PE=1 SV=2
740	1955	A0A178UA42	151.42	55	55	9.19E7	12	5	17	Y	28606	RCI1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g35800 PE=3 SV=1
500	634	A0A384LAW6	151.42	34	34	1.05E8	19	19	23	Y	98491	Coatomer subunit gamma OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g39420 PE=3 SV=1
500	635	Q0WW26	151.42	34	34	1.05E8	19	19	23	Y	98491	Coatomer subunit gamma OS=Arabidopsis thaliana OX=3702 GN=At4g34450 PE=1 SV=2
500	636	B9DHT9	151.42	34	34	1.05E8	19	19	23	Y	98491	Coatomer subunit gamma OS=Arabidopsis thaliana OX=3702 GN=At4g34450 PE=2 SV=1
948	1618	P42731	151.36	33	33	8.02E7	12	10	15	Y	68672	Polyadenylate-binding protein 2 OS=Arabidopsis thaliana OX=3702 GN=PAB2 PE=1 SV=1
948	1619	A0A178UWB3	151.36	33	33	8.02E7	12	10	15	Y	68672	Polyadenylate-binding protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g39000 PE=3 SV=1
670	2032	A0A178UZI4	151.22	43	43	7.51E7	10	10	17	Y	50425	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g40980 PE=4 SV=1
670	1835	Q8VYR5	151.22	43	43	7.51E7	10	10	17	Y	50457	Pentatricopeptide repeat-containing protein At4g35850, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g35850 PE=1 SV=1
486	2921	A0A178WB32	151.18	44	44	2.6E9	12	12	27	Y	24173	PSAF OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g31980 PE=4 SV=1
486	2922	Q9SHE8	151.18	44	44	2.6E9	12	12	27	Y	24173	Photosystem I reaction center subunit III, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSAF PE=1 SV=1
604	1060	A0A178V8I8	151.13	25	25	4.82E7	15	14	21	Y	108568	Alpha-1,4 glucan phosphorylase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g32230 PE=3 SV=1
604	1061	Q9LIB2	151.13	25	25	4.82E7	15	14	21	Y	108585	Alpha-glucan phosphorylase 1 OS=Arabidopsis thaliana OX=3702 GN=PHS1 PE=1 SV=1
604	1062	W8PUS4	151.13	25	25	4.82E7	15	14	21	Y	108585	Alpha-1,4 glucan phosphorylase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT3G29320 PE=2 SV=1
596	3144	A0A178US04	150.92	57	57	3.45E8	12	12	21	N	21434	TIL OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g57400 PE=3 SV=1
596	3145	Q9FGT8	150.92	57	57	3.45E8	12	12	21	N	21434	Temperature-induced lipocalin-1 OS=Arabidopsis thaliana OX=3702 GN=TIL PE=1 SV=1
564	1118	A0A178WF69	150.92	70	70	1.25E8	16	16	22	Y	44471	Obg-like ATPase 1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g31080 PE=3 SV=1
564	1119	Q9SA73	150.92	70	70	1.25E8	16	16	22	Y	44471	Obg-like ATPase 1 OS=Arabidopsis thaliana OX=3702 GN=YchF1 PE=1 SV=1
471	2085	Q94K48	150.56	61	61	4.36E8	13	13	25	Y	24503	ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g62530 PE=2 SV=1
471	2095	Q9LZN7	150.56	39	39	4.36E8	13	13	25	Y	38170	Uncharacterized protein T12C14_230 OS=Arabidopsis thaliana OX=3702 GN=T12C14_230 PE=4 SV=1
543	1741	A0A178UIG6	150.44	25	25	1.13E7	14	4	20	Y	80819	DNA gyrase subunit B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g03500 PE=3 SV=1
543	1742	Q94BZ7	150.44	25	25	1.13E7	14	4	20	Y	81053	DNA gyrase subunit B, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GYRBM PE=2 SV=1
738	2067	F4IW10	150.25	33	33	7.16E6	14	2	19	Y	83112	Elongation factor G-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MEFG2 PE=1 SV=1
738	2068	A0A178VYH6	150.25	33	33	7.16E6	14	2	19	Y	83112	Elongation factor G, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g42610 PE=3 SV=1
468	1135	Q058N8	150.19	55	55	1.77E8	15	14	23	Y	49681	At5g39410 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
468	1136	Q8LGI2	150.19	55	55	1.77E8	15	14	23	Y	49681	Probable mitochondrial saccharopine dehydrogenase-like oxidoreductase At5g39410 OS=Arabidopsis thaliana OX=3702 GN=At5g39410 PE=1 SV=2
494	842	Q42600	150.17	50	50	1.52E8	18	18	25	Y	58721	Cytochrome P450 84A1 OS=Arabidopsis thaliana OX=3702 GN=CYP84A1 PE=1 SV=1
494	843	Q9C4Z9	150.17	50	50	1.52E8	18	18	25	Y	58705	Ferulate-5-hydroxylase OS=Arabidopsis thaliana OX=3702 GN=fah1 PE=3 SV=1
494	844	A0A178UUR1	150.17	50	50	1.52E8	18	18	25	Y	58721	FAH1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g41370 PE=3 SV=1
841	3892	A0A178VGP2	150.16	33	33	2.56E8	10	10	14	Y	35724	TSC13 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g49950 PE=4 SV=1
841	3893	Q9M2U2	150.16	33	33	2.56E8	10	10	14	Y	35724	Very-long-chain enoyl-CoA reductase OS=Arabidopsis thaliana OX=3702 GN=ECR PE=1 SV=1
727	2799	Q9ZVI9	150.09	47	47	7.96E7	13	13	19	Y	46978	Ethanolamine-phosphate cytidylyltransferase OS=Arabidopsis thaliana OX=3702 GN=PECT1 PE=1 SV=1
727	2800	A0A178VVP1	150.09	47	47	7.96E7	13	13	19	Y	46978	PECT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g35540 PE=4 SV=1
520	4532	Q94JS0	149.99	33	33	6.09E6	15	4	23	Y	29608	Cytochrome b-c1 complex subunit Rieske-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=UCR1-1 PE=1 SV=1
520	4533	A0A178USZ8	149.99	33	33	6.09E6	15	4	23	Y	29608	Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g12850 PE=4 SV=1
477	846	F4J9G2	149.99	39	39	1.53E8	19	19	24	Y	73935	Rhodanese/Cell cycle control phosphatase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g59780 PE=4 SV=1
499	1092	F4JTH0	149.94	52	52	1.58E8	16	15	22	Y	49325	Aspartate aminotransferase OS=Arabidopsis thaliana OX=3702 GN=ASP5 PE=1 SV=1
499	1093	P46248	149.94	51	51	1.58E8	16	15	22	Y	49831	Aspartate aminotransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ASP5 PE=1 SV=2
499	1094	A0A384KDZ4	149.94	51	51	1.58E8	16	15	22	Y	49831	Aspartate aminotransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g36660 PE=4 SV=1
499	1095	B9DGA8	149.94	51	51	1.58E8	16	15	22	Y	49831	Aspartate aminotransferase OS=Arabidopsis thaliana OX=3702 GN=At4g31990 PE=2 SV=1
499	1099	B9DG21	149.94	50	50	1.58E8	16	15	22	Y	50975	Aspartate aminotransferase OS=Arabidopsis thaliana OX=3702 GN=ASP5 PE=1 SV=1
527	3646	Q9LEV3	149.93	50	50	5.08E8	10	10	24	Y	22729	CBS domain-containing protein CBSX3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CBSX3 PE=1 SV=1
527	3647	A0A178UNP9	149.93	50	50	5.08E8	10	10	24	Y	22729	CBSX3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g10520 PE=4 SV=1
608	522	A0A178W2C2	149.89	41	41	1.27E8	17	15	22	Y	76162	LACS9 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g72160 PE=4 SV=1
608	523	Q9CAP8	149.89	41	41	1.27E8	17	15	22	Y	76176	Long chain acyl-CoA synthetase 9, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LACS9 PE=1 SV=1
519	890	F4JLP5	149.69	43	43	3.25E7	16	7	25	Y	60145	Dihydrolipoyl dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LPD2 PE=2 SV=2
519	891	A0A178V7V2	149.69	38	38	3.25E7	16	7	25	Y	67092	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g18960 PE=3 SV=1
462	770	Q9T0P4	149.65	18	18	1.28E8	19	10	25	Y	177751	Ferredoxin-dependent glutamate synthase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GLU2 PE=1 SV=2
462	771	A0A178VVG3	149.65	18	18	1.28E8	19	10	25	Y	177652	GLU2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g38420 PE=4 SV=1
663	528	Q9FK25	149.59	50	50	1.5E8	14	14	20	Y	39618	Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=OMT1 PE=1 SV=1
669	603	F4JZY1	149.58	18	18	4.68E7	17	17	17	N	181976	COP1-interactive protein 1 OS=Arabidopsis thaliana OX=3702 GN=CIP1 PE=1 SV=1
472	3538	Q8LC58	149.54	56	56	2.17E8	9	7	22	N	14987	Photosystem I reaction center subunit IV B, chloroplast (PSI-E B) OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
472	3539	Q9S714	149.54	55	55	2.17E8	9	7	22	N	15189	Photosystem I reaction center subunit IV B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSAE2 PE=2 SV=1
832	1264	B9DHI0	149.47	37	37	8.31E7	12	12	16	Y	48465	AT1G56110 protein (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At1g56110 PE=2 SV=1
832	1089	A0A178WNA8	149.47	30	30	8.31E7	12	12	16	Y	58673	NOP56 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g50780 PE=4 SV=1
832	1090	Q9SGT7	149.47	30	30	8.31E7	12	12	16	Y	58673	At1g56110/T6H22_9 OS=Arabidopsis thaliana OX=3702 GN=NOP56 PE=2 SV=1
746	1571	Q8RWZ3	149.42	25	25	5.61E7	14	14	16	Y	91713	Probable acyl-CoA dehydrogenase IBR3 OS=Arabidopsis thaliana OX=3702 GN=IBR3 PE=1 SV=1
746	1572	A0A178V8Y8	149.42	25	25	5.61E7	14	14	16	Y	91727	IBR3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g06690 PE=4 SV=1
804	1512	Q8LC74	149.29	51	51	1.99E8	11	11	15	Y	31041	Vegetative storage protein-like OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
804	1513	Q9FNC4	149.29	51	51	1.99E8	11	11	15	Y	31056	HAD superfamily, subfamily IIIB acid phosphatase OS=Arabidopsis thaliana OX=3702 GN=MRH10.13 PE=2 SV=1
804	1514	A0A178UIR5	149.29	51	51	1.99E8	11	11	15	Y	31056	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g42130 PE=4 SV=1
524	1846	A0A178US77	149.25	67	67	4.2E8	16	15	23	Y	31490	NADH-cytochrome b5 reductase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g17480 PE=3 SV=1
524	1847	Q9ZNT1	149.25	67	67	4.2E8	16	15	23	Y	31490	NADH--cytochrome b5 reductase 1 OS=Arabidopsis thaliana OX=3702 GN=CBR1 PE=1 SV=1
419	2220	A0A178VV73	149.13	60	60	5.77E7	16	4	25	Y	29130	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g45400 PE=4 SV=1
419	2221	P49692	149.13	60	60	5.77E7	16	4	25	Y	29130	60S ribosomal protein L7a-1 OS=Arabidopsis thaliana OX=3702 GN=RPL7AA PE=2 SV=2
521	7242	A0A178WAZ3	149.13	57	57	1.82E9	7	7	25	Y	16984	Plastocyanin OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g21300 PE=3 SV=1
521	7243	P42699	149.13	57	57	1.82E9	7	7	25	Y	16984	Plastocyanin major isoform, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DRT112 PE=1 SV=2
757	1856	Q9ZVA2	149.03	34	34	1.35E8	9	7	15	Y	50343	EP1-like glycoprotein 2 OS=Arabidopsis thaliana OX=3702 GN=At1g78830 PE=1 SV=1
625	1382	Q9FGC7	148.89	33	33	1.2E8	18	18	21	Y	73842	Zeaxanthin epoxidase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ZEP PE=1 SV=1
625	1383	A0A178UJF2	148.89	33	33	1.2E8	18	18	21	Y	73831	Zeaxanthin epoxidase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g67070 PE=4 SV=1
528	1661	Q8LCU2	148.78	35	35	2.09E8	12	12	22	Y	38694	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
528	1662	A0A178UEU0	148.78	35	35	2.09E8	12	12	22	Y	38694	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g08440 PE=4 SV=1
528	1759	Q93VT6	148.78	35	35	2.09E8	12	12	22	Y	38655	Ribosomal RNA small subunit methyltransferase J OS=Arabidopsis thaliana OX=3702 GN=MAH20.10 PE=1 SV=1
373	2912	A0A178VSS0	148.76	50	50	3.26E8	13	6	30	Y	27859	EMB2296 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g13340 PE=3 SV=1
373	2913	P46286	148.76	50	50	3.26E8	13	6	30	Y	27859	60S ribosomal protein L8-1 OS=Arabidopsis thaliana OX=3702 GN=RPL8A PE=1 SV=2
614	1831	A0A178URC5	148.73	55	55	1.44E8	13	13	19	Y	40699	S-(hydroxymethyl)glutathione dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g42040 PE=3 SV=1
614	1832	Q96533	148.73	55	55	1.44E8	13	13	19	Y	40699	Alcohol dehydrogenase class-3 OS=Arabidopsis thaliana OX=3702 GN=ADH2 PE=1 SV=2
1041	2380	A0A178V984	148.72	58	58	1.23E8	11	11	14	Y	24951	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g57810 PE=4 SV=1
1041	2381	P82658	148.72	58	58	1.23E8	11	11	14	Y	24979	Thylakoid lumenal 19 kDa protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g63540 PE=1 SV=2
473	5763	A0A178VQE0	148.64	83	83	6.12E7	12	6	26	Y	11452	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g23700 PE=3 SV=1
473	5764	P51407	148.64	83	83	6.12E7	12	6	26	Y	11452	60S acidic ribosomal protein P2-1 OS=Arabidopsis thaliana OX=3702 GN=RPP2A PE=3 SV=2
959	8546	Q9LZC3	148.63	40	40	3.76E7	13	13	14	Y	63887	Malate synthase OS=Arabidopsis thaliana OX=3702 GN=MLS PE=1 SV=1
959	8547	A0A178UKL7	148.63	40	40	3.76E7	13	13	14	Y	63887	Malate synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g03190 PE=3 SV=1
550	1852	A0A178URD4	148.49	44	44	1.64E8	14	14	21	Y	48547	Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g22850 PE=3 SV=1
550	1853	P32746	148.49	44	44	1.64E8	14	14	21	Y	48547	Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PYRD PE=1 SV=2
649	1500	Q8LKS5	148.46	30	30	6.47E7	11	10	17	Y	77353	Long chain acyl-CoA synthetase 7, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=LACS7 PE=1 SV=2
649	1501	A0A178ULH6	148.46	30	30	6.47E7	11	10	17	Y	77245	LACS7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g27510 PE=4 SV=1
449	659	A0A178W2D5	148.32	30	30	5.4E7	17	6	24	Y	70508	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g03710 PE=4 SV=1
449	660	Q940J9	148.32	30	30	5.4E7	17	6	24	Y	70508	Probable methyltransferase PMT8 OS=Arabidopsis thaliana OX=3702 GN=At1g04430 PE=2 SV=1
507	2089	O81493	148.19	54	54	4.05E7	17	3	24	N	39826	F9D12.8 protein OS=Arabidopsis thaliana OX=3702 GN=F9D12.8 PE=2 SV=1
705	629	P56765	148.03	35	35	1.06E8	11	11	17	Y	55636	Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=accD PE=1 SV=2
438	5822	Q39219	147.96	50	50	3.6E8	20	20	29	Y	39980	Ubiquinol oxidase 1a, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AOX1A PE=1 SV=2
438	5823	A0A178V8B9	147.96	50	50	3.6E8	20	20	29	Y	40012	HSR3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g24080 PE=4 SV=1
819	3423	A0A178V6C5	147.76	54	54	6.23E8	10	10	18	Y	27746	Chlorophyll a-b binding protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g55750 PE=3 SV=1
819	3424	Q9SYW8	147.76	54	54	6.23E8	10	10	18	Y	27755	Photosystem I chlorophyll a/b-binding protein 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LHCA2 PE=1 SV=1
421	6300	\|TRYP_PIG	147.58	30	30	5.82E9	9	9	31	Y	24409	SWISS-PROT:#CONTAM#P00761\|TRYP_PIG Trypsin - Sus scrofa (Pig).
447	4165	Q9T076	147.49	28	28	3.23E8	12	12	29	Y	35064	Early nodulin-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At4g27520 PE=1 SV=1
447	4166	A0A178V632	147.49	28	28	3.23E8	12	12	29	Y	35064	ENODL2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g31650 PE=4 SV=1
453	956	P93025	147.48	29	29	1.36E8	19	15	27	N	102472	Phototropin-2 OS=Arabidopsis thaliana OX=3702 GN=PHOT2 PE=1 SV=2
453	957	A0A178URG7	147.48	29	29	1.36E8	19	15	27	N	102472	PHOT2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g57480 PE=4 SV=1
741	2737	Q8S9M1	147.37	42	42	1.47E8	11	10	16	N	32986	Probable plastid-lipid-associated protein 13, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PAP13 PE=1 SV=2
741	2738	A0A178VT98	147.37	42	42	1.47E8	11	10	16	N	32986	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g39440 PE=4 SV=1
797	936	A0A178VFX9	147.26	21	21	3.8E7	15	12	18	N	112202	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g15470 PE=4 SV=1
797	937	C0LGN2	147.26	21	21	3.8E7	15	12	18	N	112276	Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 OS=Arabidopsis thaliana OX=3702 GN=LRR-RLK PE=1 SV=1
733	2868	A0A178V2S8	147.23	75	75	8.43E7	11	4	20	Y	18373	Peptidyl-prolyl cis-trans isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g44070 PE=3 SV=1
733	2869	P34790	147.23	75	75	8.43E7	11	4	20	Y	18373	Peptidyl-prolyl cis-trans isomerase CYP18-3 OS=Arabidopsis thaliana OX=3702 GN=CYP18-3 PE=1 SV=1
824	2524	A0A178WKK3	147.08	26	26	1.4E7	14	5	15	Y	89569	Ftsh10 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g07160 PE=3 SV=1
824	2525	Q8VZI8	147.08	26	26	1.4E7	14	5	15	Y	89555	ATP-dependent zinc metalloprotease FTSH 10, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FTSH10 PE=1 SV=1
557	2895	A0A178VJX5	147.01	45	45	8.81E8	10	10	24	Y	28208	Peptidyl-prolyl cis-trans isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g56320 PE=3 SV=1
557	2896	P34791	147.01	45	45	8.81E8	10	10	24	Y	28208	Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CYP20-3 PE=1 SV=1
557	2904	F4IX26	147.01	37	37	8.81E8	10	10	24	Y	34318	Rotamase CYP 4 OS=Arabidopsis thaliana OX=3702 GN=ROC4 PE=4 SV=1
599	1298	A0A178VS00	146.97	22	22	6.69E7	17	12	20	Y	108284	Calcium-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g38830 PE=3 SV=1
599	1299	O22218	146.97	21	21	6.69E7	17	12	20	Y	112749	Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=ACA4 PE=1 SV=1
368	2155	O48549	146.87	51	51	1.66E8	14	6	31	Y	28367	40S ribosomal protein S6-1 OS=Arabidopsis thaliana OX=3702 GN=RPS6A PE=1 SV=2
556	1718	A0A178UJF3	146.82	25	25	1.56E8	13	13	25	Y	83806	SVL1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g54610 PE=4 SV=1
556	1719	Q9FJ62	146.82	25	25	1.56E8	13	13	25	Y	84165	Glycerophosphodiester phosphodiesterase GDPDL4 OS=Arabidopsis thaliana OX=3702 GN=GDPDL4 PE=1 SV=1
682	1720	Q0WW95	146.81	45	45	2.17E8	13	11	21	Y	41656	Cysteine synthase OS=Arabidopsis thaliana OX=3702 GN=At2g43750 PE=2 SV=1
682	1721	A0A384KAY1	146.81	45	45	2.17E8	13	11	21	Y	41656	Cysteine synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g41270 PE=3 SV=1
682	1722	P47999	146.81	45	45	2.17E8	13	11	21	Y	41656	Cysteine synthase, chloroplastic/chromoplastic OS=Arabidopsis thaliana OX=3702 GN=OASB PE=1 SV=2
743	1596	A0A384LEI3	146.70	54	54	2.01E8	13	13	17	Y	39394	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g15740 PE=4 SV=1
743	1597	Q8LBA4	146.70	54	54	2.01E8	13	13	17	Y	39423	Zinc-binding dehydrogenase, putative OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
743	1598	Q9LK96	146.70	54	54	2.01E8	13	13	17	Y	39394	AT3g15090/K15M2_24 OS=Arabidopsis thaliana OX=3702 GN=At3g15090 PE=2 SV=1
439	1839	Q9LZH9	146.70	52	52	1.21E8	15	3	24	Y	29034	60S ribosomal protein L7a-2 OS=Arabidopsis thaliana OX=3702 GN=RPL7AB PE=2 SV=1
439	1840	A0A178V9A8	146.70	52	52	1.21E8	15	3	24	Y	29034	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g57150 PE=4 SV=1
648	919	Q9FZD1	146.69	45	45	1.64E8	15	15	20	Y	70235	Pentatricopeptide repeat-containing protein At1g26460, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g26460 PE=1 SV=1
340	3444	A0A178UQE0	146.67	81	81	1.09E9	13	13	31	N	21548	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g45510 PE=3 SV=1
340	3445	Q96252	146.67	81	81	1.09E9	13	13	31	N	21548	ATP synthase subunit delta', mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g47030 PE=1 SV=1
503	2953	Q41932	146.59	46	46	4.2E8	11	9	24	N	24643	Oxygen-evolving enhancer protein 3-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSBQ2 PE=1 SV=2
503	2954	A0A178UX57	146.59	46	46	4.2E8	11	9	24	N	24643	PSII-Q OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g04980 PE=4 SV=1
541	1685	A0A178UA38	146.46	34	34	9.99E7	18	18	22	Y	77480	Acyl-coenzyme A oxidase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g64850 PE=3 SV=1
541	1686	O65201	146.46	34	34	9.99E7	18	18	22	Y	77480	Acyl-coenzyme A oxidase 2, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=ACX2 PE=1 SV=2
726	1634	Q8H1E2	146.41	40	40	1.09E8	12	12	14	Y	48316	Malate dehydrogenase [NADP], chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g58330 PE=2 SV=1
653	2218	A0A178V804	146.39	49	49	1.85E8	11	11	20	Y	29306	EMB3119 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g04260 PE=3 SV=1
653	2219	Q9S726	146.39	49	49	1.85E8	11	11	20	Y	29306	Probable ribose-5-phosphate isomerase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPI3 PE=1 SV=1
605	757	O49650	146.37	44	44	7.05E7	18	10	22	Y	59238	Cytochrome P450 like protein OS=Arabidopsis thaliana OX=3702 GN=T12H17.80 PE=3 SV=1
605	759	F4JLY4	146.37	41	41	7.05E7	18	10	22	Y	63117	Cytochrome P450, family 706, subfamily A, polypeptide 1 OS=Arabidopsis thaliana OX=3702 GN=CYP706A1 PE=3 SV=1
466	3670	Q9LU86	146.29	55	55	5.03E8	15	15	27	Y	23678	Peroxiredoxin Q, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PRXQ PE=1 SV=1
466	3671	A0A178VD11	146.29	54	54	5.03E8	15	15	27	Y	23765	PRXQ OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g28170 PE=4 SV=1
624	1249	Q0WW92	146.29	53	53	5.02E7	15	9	21	Y	46444	DnaJ protein homolog atj3 OS=Arabidopsis thaliana OX=3702 GN=At3g44110 PE=2 SV=1
624	1250	Q94AW8	146.29	53	53	5.02E7	15	9	21	Y	46444	Chaperone protein dnaJ 3 OS=Arabidopsis thaliana OX=3702 GN=ATJ3 PE=1 SV=2
821	822	A0A178VFW0	146.23	19	19	4.76E7	12	12	12	Y	119848	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g57730 PE=4 SV=1
821	821	Q8L611	146.23	19	19	4.76E7	12	12	12	Y	119875	Protein transport protein SEC31 homolog B OS=Arabidopsis thaliana OX=3702 GN=SEC31B PE=1 SV=1
619	1576	Q93ZN9	146.16	50	50	1.12E8	15	15	22	Y	50396	LL-diaminopimelate aminotransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DAP PE=1 SV=1
619	1577	A0A178UVE7	146.16	50	50	1.12E8	15	15	22	Y	50396	AGD2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g38520 PE=3 SV=1
698	1502	Q8S9J1	145.88	52	52	1.8E8	16	16	20	Y	55630	Protoporphyrinogen oxidase 2, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PPOX2 PE=1 SV=1
698	1503	A0A178URA2	145.88	52	52	1.8E8	16	16	20	Y	55630	Protoporphyrinogen oxidase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g13680 PE=3 SV=1
698	1504	A0A1P8BE58	145.88	47	47	1.8E8	16	16	20	Y	61312	Protoporphyrinogen oxidase OS=Arabidopsis thaliana OX=3702 GN=HEMG2 PE=1 SV=1
511	1988	Q38867	145.80	73	73	3.42E8	11	8	25	Y	18920	Peptidyl-prolyl cis-trans isomerase CYP19-3 OS=Arabidopsis thaliana OX=3702 GN=CYP19-3 PE=2 SV=2
511	1989	A0A178VE97	145.80	73	73	3.42E8	11	8	25	Y	18920	Peptidyl-prolyl cis-trans isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g50710 PE=3 SV=1
533	4107	P61837	145.75	38	38	1.21E8	14	3	24	Y	30689	Aquaporin PIP1-1 OS=Arabidopsis thaliana OX=3702 GN=PIP1-1 PE=1 SV=1
533	4108	A0A178VIZ0	145.75	38	38	1.21E8	14	3	24	Y	30689	PIP1A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g55710 PE=3 SV=1
628	3996	Q39209	145.69	30	30	2.32E8	9	9	20	N	33958	RNA binding protein (Fragment) OS=Arabidopsis thaliana OX=3702 GN=rnp-D PE=2 SV=1
628	3997	A0A178V4M1	145.69	28	28	2.32E8	9	9	20	N	35787	RBP31 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g28660 PE=4 SV=1
628	3998	Q04836	145.69	28	28	2.32E8	9	9	20	N	35787	31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP31A PE=1 SV=1
451	1599	Q0WQF7	145.67	43	43	2.96E8	18	18	27	Y	68863	Dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LTA3 PE=1 SV=2
656	2112	Q2HIR7	145.61	50	50	2.55E8	14	14	20	Y	31437	Acclimation of photosynthesis to environment OS=Arabidopsis thaliana OX=3702 GN=APE1 PE=1 SV=1
656	2113	A0A384KYJ2	145.61	50	50	2.55E8	14	14	20	Y	31437	APE1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g36010 PE=1 SV=1
700	1165	Q9S7Y7	145.61	29	29	8.59E7	16	14	18	Y	102399	Alpha-xylosidase 1 OS=Arabidopsis thaliana OX=3702 GN=XYL1 PE=1 SV=1
786	1799	A0A178VN28	145.44	57	57	1.65E8	15	12	18	Y	33346	TIM OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g16600 PE=3 SV=1
786	1800	Q9SKP6	145.44	57	57	1.65E8	15	12	18	Y	33346	Triosephosphate isomerase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIM PE=1 SV=1
667	992	F4JMJ1	145.37	25	25	1.07E8	14	14	19	N	96725	Heat shock 70 kDa protein 17 OS=Arabidopsis thaliana OX=3702 GN=HSP70-17 PE=2 SV=1
667	993	A0A1P8B8R9	145.37	24	24	1.07E8	14	14	19	N	99644	Heat shock protein 70 (Hsp 70) family protein OS=Arabidopsis thaliana OX=3702 GN=At4g16660 PE=3 SV=1
515	765	A0A178UQL8	145.23	50	50	2.6E7	16	7	24	Y	53318	6-phosphogluconate dehydrogenase, decarboxylating OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g39410 PE=3 SV=1
515	766	Q9FFR3	145.23	50	50	2.6E7	16	7	24	Y	53318	6-phosphogluconate dehydrogenase, decarboxylating 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGD3 PE=1 SV=1
701	570	Q9ZPI1	145.22	34	34	8.54E7	14	14	17	Y	70888	Lysine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At3g11710 PE=1 SV=1
701	571	A0A178VAG3	145.22	34	34	8.54E7	14	14	17	Y	70888	Lysine--tRNA ligase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g11640 PE=3 SV=1
638	2404	A0A178WQ61	145.19	64	64	2.08E8	13	13	21	Y	35762	YBR159 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g61690 PE=3 SV=1
638	2405	Q8L9C4	145.19	64	64	2.08E8	13	13	21	Y	35762	Very-long-chain 3-oxoacyl-CoA reductase 1 OS=Arabidopsis thaliana OX=3702 GN=KCR1 PE=1 SV=1
808	1411	A0A178UCU2	145.02	32	32	6.47E7	13	13	15	Y	79936	TOC75-V OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g19540 PE=4 SV=1
808	1412	Q9C5J8	145.02	32	32	6.47E7	13	13	15	Y	79936	Outer envelope protein 80, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OEP80 PE=2 SV=1
692	1789	F4HR88	144.99	46	46	5.5E7	12	12	19	Y	51742	Leucine-rich repeat (LRR) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g33590 PE=4 SV=1
692	1790	Q9FW47	144.99	43	43	5.5E7	12	12	19	Y	55578	Leucine-rich repeat (LRR) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g33590 PE=4 SV=1
692	1791	A0A1P8AWX3	144.99	42	42	5.5E7	12	12	19	Y	55838	Leucine-rich repeat (LRR) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g33590 PE=4 SV=1
665	761	A0A178W6W4	144.84	25	25	6.32E7	15	14	17	Y	105172	Alanine--tRNA ligase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g44430 PE=3 SV=1
665	763	P36428	144.84	24	24	6.32E7	15	14	17	Y	110489	Alanine--tRNA ligase OS=Arabidopsis thaliana OX=3702 GN=ALATS PE=1 SV=3
488	4124	A0A178WIA6	144.80	39	39	1.82E8	11	4	24	Y	30633	TMP-B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g00690 PE=3 SV=1
488	4125	Q08733	144.80	39	39	1.82E8	11	4	24	Y	30633	Aquaporin PIP1-3 OS=Arabidopsis thaliana OX=3702 GN=PIP1-3 PE=1 SV=1
249	2238	A0A1B1W4S7	144.76	34	34	5.58E9	12	12	41	Y	38937	Photosystem II protein D1 OS=Arabidopsis thaliana OX=3702 GN=psbA PE=3 SV=1
249	2239	P83755	144.76	34	34	5.58E9	12	12	41	Y	38937	Photosystem II protein D1 OS=Arabidopsis thaliana OX=3702 GN=psbA PE=1 SV=2
588	6570	A0A384LAE0	144.62	39	39	1.72E9	7	7	24	Y	14586	PSBR OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g73790 PE=4 SV=1
588	6571	Q0WWI7	144.62	39	39	1.72E9	7	7	24	Y	14586	PSII-R protein OS=Arabidopsis thaliana OX=3702 GN=At1g79040 PE=2 SV=1
588	6572	P27202	144.62	39	39	1.72E9	7	7	24	Y	14586	Photosystem II 10 kDa polypeptide, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSBR PE=1 SV=1
265	1842	Q9FZ76	144.57	55	55	1.49E8	19	5	36	N	26153	60S ribosomal protein L6-1 OS=Arabidopsis thaliana OX=3702 GN=RPL6A PE=2 SV=1
446	2915	Q38900	144.41	71	71	2.34E8	11	6	28	Y	18492	Peptidyl-prolyl cis-trans isomerase CYP19-1 OS=Arabidopsis thaliana OX=3702 GN=CYP19-1 PE=2 SV=1
446	2916	A0A178VVJ7	144.41	71	71	2.34E8	11	6	28	Y	18492	Peptidyl-prolyl cis-trans isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g11680 PE=3 SV=1
849	1267	A0A178WIW9	144.40	45	45	8.97E7	13	13	16	Y	43796	LIN2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g02730 PE=4 SV=1
849	1268	Q9LR75	144.40	45	45	8.97E7	13	13	16	Y	43796	Coproporphyrinogen-III oxidase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CPX1 PE=2 SV=1
722	3380	Q03250	144.35	73	73	2.53E8	12	9	19	Y	16890	Glycine-rich RNA-binding protein 7 OS=Arabidopsis thaliana OX=3702 GN=RBG7 PE=1 SV=1
780	1874	Q93ZT6	144.34	23	23	7.63E7	12	12	16	Y	85572	Eukaryotic translation initiation factor isoform 4G-1 OS=Arabidopsis thaliana OX=3702 GN=EIF(ISO)4G1 PE=1 SV=1
581	1403	Q9ZUC1	144.32	56	56	1.33E8	16	16	23	Y	40986	NADPH-dependent alkenal/one oxidoreductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AOR PE=1 SV=2
900	2377	Q9LG23	144.24	40	40	7.45E7	12	12	15	N	44994	Pentatricopeptide repeat-containing protein At1g55890, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g55890 PE=1 SV=1
259	1573	A0A178W8L4	144.20	55	55	1.57E8	19	5	38	N	26107	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g68410 PE=4 SV=1
259	1574	Q9C9C5	144.20	55	55	1.57E8	19	5	38	N	26107	60S ribosomal protein L6-3 OS=Arabidopsis thaliana OX=3702 GN=RPL6C PE=2 SV=1
259	1575	Q9C9C6	144.20	55	55	1.57E8	19	5	38	N	26009	60S ribosomal protein L6-2 OS=Arabidopsis thaliana OX=3702 GN=RPL6B PE=2 SV=1
710	1236	A0A1I9LT03	144.16	40	40	6.91E7	14	7	17	Y	51116	UTP--glucose-1-phosphate uridylyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGP1 PE=1 SV=1
710	1237	A0A178V8F3	144.16	39	39	6.91E7	14	7	17	Y	51743	UTP--glucose-1-phosphate uridylyltransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g02580 PE=3 SV=1
710	1238	Q9M9P3	144.16	39	39	6.91E7	14	7	17	Y	51739	UTP--glucose-1-phosphate uridylyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=UGP2 PE=1 SV=1
710	1239	A0A1I9LT02	144.16	38	38	6.91E7	14	7	17	Y	52855	UTP--glucose-1-phosphate uridylyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGP1 PE=1 SV=1
976	1802	Q38884	144.10	55	55	9.77E7	12	12	14	Y	36388	Eukaryotic translation initiation factor 3 subunit I OS=Arabidopsis thaliana OX=3702 GN=TIF3I1 PE=2 SV=2
976	1803	A0A384L026	144.10	55	55	9.77E7	12	12	14	Y	36388	Eukaryotic translation initiation factor 3 subunit I OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g43890 PE=3 SV=1
976	1804	Q0WVZ3	144.10	55	55	9.77E7	12	12	14	Y	36388	Eukaryotic translation initiation factor 3 subunit I OS=Arabidopsis thaliana OX=3702 GN=At2g46280 PE=2 SV=1
536	2137	A0A178VYB0	144.06	47	47	8.5E7	12	6	23	Y	39149	IDH2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g12260 PE=4 SV=1
536	2140	A0A178W0H4	144.06	47	47	8.5E7	12	6	23	Y	39590	IDH2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g12260 PE=4 SV=1
536	2141	P93032	144.06	47	47	8.5E7	12	6	23	Y	39590	Isocitrate dehydrogenase [NAD] regulatory subunit 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH2 PE=1 SV=2
483	1940	Q9C9I7	143.99	51	51	5.32E8	14	14	28	N	31727	Rieske (2Fe-2S) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=PSB33 PE=2 SV=1
483	1941	A0A178W9Y8	143.99	51	51	5.32E8	14	14	28	N	31755	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g65710 PE=4 SV=1
706	1922	A0A1B1W502	143.94	39	39	1.41E8	11	11	19	Y	45503	NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhH PE=3 SV=1
706	1923	P56753	143.94	39	39	1.41E8	11	11	19	Y	45503	NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhH PE=1 SV=1
684	2284	O04630	143.93	30	30	7.72E7	16	16	18	Y	80936	Threonine--tRNA ligase, mitochondrial 1 OS=Arabidopsis thaliana OX=3702 GN=THRRS PE=1 SV=3
684	2288	A0A178UFA1	143.93	32	32	7.72E7	16	16	18	Y	77321	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g26800 PE=3 SV=1
620	3261	Q9SCX3	143.92	50	50	4.23E8	10	8	23	N	24201	Elongation factor 1-beta 2 OS=Arabidopsis thaliana OX=3702 GN=At5g19510 PE=1 SV=1
496	1379	Q39258	143.90	60	60	3.89E8	15	9	24	Y	26060	V-type proton ATPase subunit E1 OS=Arabidopsis thaliana OX=3702 GN=VHA-E1 PE=1 SV=2
714	1523	F4I0K2	143.76	40	40	7.35E7	16	16	19	Y	68980	Fructokinase-like 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FLN2 PE=1 SV=2
476	1066	Q38798	143.57	38	38	3.47E7	16	7	26	Y	60490	Calnexin homolog 2 OS=Arabidopsis thaliana OX=3702 GN=At5g07340 PE=2 SV=2
826	1919	Q0WL22	143.56	33	33	7.87E7	13	13	14	Y	65796	Uncharacterized protein At2g30510 OS=Arabidopsis thaliana OX=3702 GN=At2g30510 PE=2 SV=1
826	1920	Q682S0	143.56	33	33	7.87E7	13	13	14	Y	65854	Root phototropism protein 2 OS=Arabidopsis thaliana OX=3702 GN=RPT2 PE=1 SV=2
495	1418	A0A178V9B1	143.44	57	57	2.91E8	13	13	21	Y	34250	TOM40 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g21310 PE=4 SV=1
495	1419	Q9LHE5	143.44	57	57	2.91E8	13	13	21	Y	34250	Mitochondrial import receptor subunit TOM40-1 OS=Arabidopsis thaliana OX=3702 GN=TOM40-1 PE=1 SV=3
664	1287	Q9ZUU3	143.30	26	26	7.82E7	12	12	18	Y	85705	Pentatricopeptide repeat-containing protein At2g37230 OS=Arabidopsis thaliana OX=3702 GN=At2g37230 PE=2 SV=1
664	1288	A0A178VVU8	143.30	26	26	7.82E7	12	12	18	Y	85705	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g34030 PE=4 SV=1
986	2756	Q9SLB1	143.22	31	31	8.22E7	13	13	14	Y	84801	Amine oxidase OS=Arabidopsis thaliana OX=3702 GN=At2g42490 PE=3 SV=1
986	2757	Q8L866	143.22	30	30	8.22E7	13	13	14	Y	86691	Amine oxidase OS=Arabidopsis thaliana OX=3702 GN=MHK10.21 PE=2 SV=1
986	2758	A0A178VYJ2	143.22	30	30	8.22E7	13	13	14	Y	86691	Amine oxidase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g39860 PE=3 SV=1
796	1010	A0A178VZC8	143.17	23	23	4.13E7	13	13	16	Y	98144	26S proteasome non-ATPase regulatory subunit 2 homolog OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g15920 PE=3 SV=1
796	1011	Q9SIV2	143.17	23	23	4.13E7	13	13	16	Y	98144	26S proteasome non-ATPase regulatory subunit 2 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPN1A PE=1 SV=2
409	2893	Q9SRX2	143.14	41	41	3.25E8	9	5	26	Y	24606	60S ribosomal protein L19-1 OS=Arabidopsis thaliana OX=3702 GN=RPL19A PE=2 SV=1
807	2841	A0A1B1W512	143.14	39	39	1.34E8	9	2	16	Y	29865	50S ribosomal protein L2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rpl2 PE=3 SV=1
807	2842	P56791	143.14	39	39	1.34E8	9	2	16	Y	29865	50S ribosomal protein L2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rpl2-A PE=3 SV=1
720	2429	Q96262	143.13	60	60	3.56E8	10	10	20	N	24584	Plasma membrane-associated cation-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=PCAP1 PE=1 SV=1
742	2416	A0A178UPN0	143.04	57	57	1.39E8	15	15	19	Y	39762	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g33710 PE=4 SV=1
742	2417	P0DKC3	143.04	57	57	1.39E8	15	15	19	Y	39762	Phosphoglycolate phosphatase 1A, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGLP1A PE=1 SV=1
742	2418	P0DKC4	143.04	57	57	1.39E8	15	15	19	Y	39762	Phosphoglycolate phosphatase 1B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGLP1B PE=1 SV=1
1114	2456	A0A178VU64	142.71	28	28	6.07E7	9	9	12	N	56619	Ferrochelatase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g26470 PE=3 SV=1
1114	2457	O04921	142.71	28	28	6.07E7	9	9	12	N	56619	Ferrochelatase-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FC2 PE=1 SV=1
1114	2458	F4IMT3	142.71	28	28	6.07E7	9	9	12	N	57860	Ferrochelatase OS=Arabidopsis thaliana OX=3702 GN=FC2 PE=1 SV=1
502	1015	P42643	142.70	58	58	1.05E8	15	6	24	Y	29932	14-3-3-like protein GF14 chi OS=Arabidopsis thaliana OX=3702 GN=GRF1 PE=1 SV=3
502	1229	A0A178UZ53	142.70	58	58	1.05E8	15	6	24	Y	29904	GRF1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g10320 PE=3 SV=1
502	1234	F4JJ94	142.70	48	48	1.05E8	15	6	24	Y	35839	General regulatory factor 1 OS=Arabidopsis thaliana OX=3702 GN=GRF1 PE=1 SV=1
696	3032	A0A178UZZ4	142.53	42	42	1.46E8	10	9	19	Y	34862	SAMT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g44840 PE=3 SV=1
696	3033	Q94AG6	142.53	42	42	1.46E8	10	9	19	Y	34862	S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SAMC1 PE=1 SV=1
1035	3044	F4JJT9	142.49	31	31	5.49E7	12	11	14	Y	74517	Aspartate--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g33760 PE=2 SV=1
1035	3045	A0A178USV6	142.49	31	31	5.49E7	12	11	14	Y	74517	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g38590 PE=3 SV=1
767	3502	B9DI38	142.44	55	55	2.14E8	12	12	18	N	22205	AT1G05190 protein (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At1g05190 PE=2 SV=1
767	3503	O23049	142.44	49	49	2.14E8	12	12	18	N	24706	50S ribosomal protein L6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPL6 PE=2 SV=1
767	3504	A0A178W979	142.44	49	49	2.14E8	12	12	18	N	24706	Emb2394 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g04580 PE=3 SV=1
822	482	F4IIM1	142.39	10	10	1.95E7	12	11	13	Y	230703	Protein CELLULOSE SYNTHASE INTERACTIVE 1 OS=Arabidopsis thaliana OX=3702 GN=CSI1 PE=1 SV=1
848	2529	Q9FFG3	142.35	31	31	7.8E7	12	10	15	Y	58520	Outer membrane OMP85 family protein OS=Arabidopsis thaliana OX=3702 GN=MOP10.6 PE=2 SV=1
848	2530	A0A178UFQ9	142.35	31	31	7.8E7	12	10	15	Y	58493	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g05020 PE=4 SV=1
1027	3082	A8MQP6	142.33	48	48	1.47E8	9	8	12	N	23115	Nascent polypeptide-associated complex (NAC), alpha subunit family protein OS=Arabidopsis thaliana OX=3702 GN=At4g10480 PE=1 SV=1
1027	2625	Q9SZY1	142.33	48	48	1.47E8	9	8	12	N	23172	Nascent polypeptide-associated complex subunit alpha-like protein 4 OS=Arabidopsis thaliana OX=3702 GN=At4g10480 PE=1 SV=1
1027	2626	A0A384KL47	142.33	48	48	1.47E8	9	8	12	N	23172	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g11750 PE=4 SV=1
1027	2627	Q0WWN5	142.33	48	48	1.47E8	9	8	12	N	23172	Putative alpha NAC OS=Arabidopsis thaliana OX=3702 GN=At4g10480 PE=2 SV=1
831	1594	Q9SRL6	142.26	35	35	1.01E8	12	10	15	Y	57209	Outer membrane OMP85 family protein OS=Arabidopsis thaliana OX=3702 GN=F9F8.12 PE=1 SV=1
689	4885	Q9SVM8	142.09	45	45	4.42E8	7	7	19	N	15702	Glycine-rich RNA-binding protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RBG2 PE=1 SV=1
689	4886	A0A178UU67	142.09	45	45	4.42E8	7	7	19	N	15702	GRP2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g15800 PE=4 SV=1
689	5015	A8MSB9	142.09	49	49	4.42E8	7	7	19	N	14691	Glycine-rich RNA-binding protein 2 OS=Arabidopsis thaliana OX=3702 GN=GR-RBP2 PE=4 SV=1
689	5016	F4JTU2	142.09	46	46	4.42E8	7	7	19	N	15417	Glycine-rich RNA-binding protein 2 OS=Arabidopsis thaliana OX=3702 GN=GR-RBP2 PE=4 SV=1
600	1022	Q0WV19	142.01	21	21	8.01E7	14	14	16	Y	116174	Calcium-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=At5g57110 PE=2 SV=1
600	1023	A0A384L942	142.01	21	21	8.01E7	14	14	16	Y	116174	Calcium-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g56340 PE=3 SV=1
600	1024	Q9LF79	142.01	21	21	8.01E7	14	14	16	Y	116174	Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=ACA8 PE=1 SV=1
711	623	A0A178VA38	141.98	23	23	4.24E7	13	13	15	Y	116605	SEC8 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g10170 PE=4 SV=1
711	624	Q93YU5	141.98	23	23	4.24E7	13	13	15	Y	116605	Exocyst complex component SEC8 OS=Arabidopsis thaliana OX=3702 GN=SEC8 PE=1 SV=1
650	1038	A0A178UM28	141.85	32	32	4.41E6	15	2	21	Y	65828	ACLB-2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g48220 PE=4 SV=1
650	1039	Q9FGX1	141.85	32	32	4.41E6	15	2	21	Y	65828	ATP-citrate synthase beta chain protein 2 OS=Arabidopsis thaliana OX=3702 GN=ACLB-2 PE=1 SV=1
886	1915	O65787	141.82	29	29	5.71E7	12	12	14	Y	57009	Cytochrome P450 71B6 OS=Arabidopsis thaliana OX=3702 GN=CYP71B6 PE=2 SV=1
964	2150	A0A178V976	141.75	45	45	9.29E7	13	13	15	Y	41630	TGD2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g21660 PE=4 SV=1
964	2151	Q9LTR2	141.75	45	45	9.29E7	13	13	15	Y	41630	Protein TRIGALACTOSYLDIACYLGLYCEROL 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TGD2 PE=1 SV=1
754	1363	Q96529	141.75	42	42	8.69E7	13	13	18	Y	52964	Adenylosuccinate synthetase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PURA PE=1 SV=1
791	1380	Q9SF16	141.69	32	32	4.48E7	13	13	14	Y	59776	T-complex protein 1 subunit eta OS=Arabidopsis thaliana OX=3702 GN=CCT7 PE=1 SV=1
791	1381	A0A178VGX5	141.69	32	32	4.48E7	13	13	14	Y	59776	T-complex protein 1 subunit eta OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g11770 PE=3 SV=1
481	4134	Q9SY97	141.67	43	43	1.39E9	10	10	27	Y	29181	Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LHCA3 PE=1 SV=1
481	4135	A0A178W5Y6	141.67	43	43	1.39E9	10	10	27	Y	29181	Chlorophyll a-b binding protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g54730 PE=3 SV=1
513	5690	O04616	141.58	38	38	7.71E8	13	12	22	N	17698	Protein CURVATURE THYLAKOID 1A, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CURT1A PE=1 SV=1
513	5691	A0A178UVW5	141.58	38	38	7.71E8	13	12	22	N	17698	CURT1A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g01490 PE=4 SV=1
566	2439	A0A178UH56	141.57	24	24	9.61E7	13	5	24	Y	74120	Transmembrane 9 superfamily member OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g24960 PE=3 SV=1
566	2440	Q9C5N2	141.57	24	24	9.61E7	13	5	24	Y	74120	Transmembrane 9 superfamily member 9 OS=Arabidopsis thaliana OX=3702 GN=TMN9 PE=2 SV=1
1164	1284	A0A178USJ1	141.15	25	25	2.7E7	10	10	11	Y	78927	NADPH--cytochrome P450 reductase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g34640 PE=3 SV=1
1164	1285	Q9SUM3	141.15	25	25	2.7E7	10	10	11	Y	78927	NADPH--cytochrome P450 reductase 2 OS=Arabidopsis thaliana OX=3702 GN=ATR2 PE=1 SV=1
1164	1286	A0A1P8B3S1	141.15	23	23	2.7E7	10	10	11	Y	85989	NADPH--cytochrome P450 reductase OS=Arabidopsis thaliana OX=3702 GN=ATR2 PE=1 SV=1
731	2226	Q42406	141.01	65	65	1.73E8	11	7	18	Y	18378	Peptidyl-prolyl cis-trans isomerase CYP18-4 OS=Arabidopsis thaliana OX=3702 GN=CYP18-4 PE=1 SV=1
731	2227	A0A178UWH6	141.01	65	65	1.73E8	11	7	18	Y	18378	Peptidyl-prolyl cis-trans isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g39850 PE=3 SV=1
950	1531	A0A178VX82	140.95	31	31	5.97E5	9	3	12	Y	57508	Pyruvate kinase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g33300 PE=1 SV=1
950	1532	Q8LFE1	140.95	31	31	5.97E5	9	3	12	Y	57509	Pyruvate kinase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
950	1533	Q9SJQ0	140.95	31	31	5.97E5	9	3	12	Y	57508	Pyruvate kinase OS=Arabidopsis thaliana OX=3702 GN=At2g36580 PE=1 SV=2
1248	4384	Q8VZL4	140.84	35	35	4.05E7	9	8	11	N	53884	Mechanosensitive ion channel protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MSL1 PE=2 SV=1
789	1931	Q0WWY5	140.82	37	37	2.84E8	10	10	17	Y	29364	50S ribosomal protein L3 OS=Arabidopsis thaliana OX=3702 GN=At2g43030 PE=2 SV=1
789	1932	A0A384KFF7	140.82	37	37	2.84E8	10	10	17	Y	29364	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g40490 PE=3 SV=1
789	1933	Q9SKX4	140.82	37	37	2.84E8	10	10	17	Y	29364	50S ribosomal protein L3-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPL3A PE=2 SV=1
834	2472	A0A178VQN7	140.80	33	33	6.72E7	12	12	16	Y	69151	ATSLY1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g13300 PE=3 SV=1
834	2473	Q9SL48	140.80	33	33	6.72E7	12	12	16	Y	69151	SEC1 family transport protein SLY1 OS=Arabidopsis thaliana OX=3702 GN=SLY1 PE=1 SV=1
460	1472	A0A178V3C5	140.63	60	60	2.91E8	15	15	25	Y	33796	CHLM OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g28980 PE=4 SV=1
460	1473	Q9SW18	140.63	60	60	2.91E8	15	15	25	Y	33796	Magnesium protoporphyrin IX methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CHLM PE=1 SV=1
460	1474	A0A1P8B4G1	140.63	58	58	2.91E8	15	15	25	Y	35592	Magnesium-protoporphyrin IX methyltransferase OS=Arabidopsis thaliana OX=3702 GN=CHLM PE=4 SV=1
332	364	A0A178W7G9	140.61	36	36	2.43E7	18	7	30	Y	59795	BGLU22 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g60000 PE=3 SV=1
837	1578	Q9SCY0	140.60	33	33	6.69E7	14	14	16	Y	67989	Phosphoglucomutase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGMP PE=1 SV=2
837	1579	A0A178UGL7	140.60	33	33	6.69E7	14	14	16	Y	68019	STF1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g50680 PE=4 SV=1
766	2399	A0A178VNV6	140.59	56	56	1.27E8	11	11	18	Y	34852	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g34470 PE=4 SV=1
766	2400	O80934	140.59	56	56	1.27E8	11	11	18	Y	34880	Uncharacterized protein At2g37660, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g37660 PE=1 SV=2
1075	1701	A0A178VD97	140.53	25	25	6.51E7	12	12	12	Y	80481	GCN4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g48980 PE=4 SV=1
1075	1702	Q9M1H3	140.53	25	25	6.51E7	12	12	12	Y	80481	ABC transporter F family member 4 OS=Arabidopsis thaliana OX=3702 GN=ABCF4 PE=2 SV=1
716	2677	A0A178VB22	140.50	46	46	1.71E8	14	14	17	Y	42979	EBP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g46170 PE=4 SV=1
716	2678	Q96327	140.50	46	46	1.71E8	14	14	17	Y	42979	ERBB-3 BINDING PROTEIN 1 OS=Arabidopsis thaliana OX=3702 GN=EBP1 PE=1 SV=1
704	2143	A0A1P8AMX1	140.48	23	23	4.64E6	16	5	18	Y	105007	Presequence protease 2 OS=Arabidopsis thaliana OX=3702 GN=PREP2 PE=4 SV=1
704	2157	Q8VY06	140.48	20	20	4.64E6	16	5	18	Y	121131	Presequence protease 2, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PREP2 PE=1 SV=1
814	3087	O48529	140.46	50	50	4.37E8	8	8	18	Y	25510	Rhodanese-like domain-containing protein 9, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=STR9 PE=2 SV=1
814	3088	A0A178VVC6	140.46	50	50	4.37E8	8	8	18	Y	25510	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g39530 PE=4 SV=1
874	861	A0A178V993	140.43	32	32	8.01E7	11	11	14	N	58940	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g03370 PE=3 SV=1
874	862	Q94K05	140.43	32	32	8.01E7	11	11	14	N	58940	T-complex protein 1 subunit theta OS=Arabidopsis thaliana OX=3702 GN=CCT8 PE=1 SV=1
877	2436	A0A1P8APU0	140.27	38	38	1.75E8	10	9	13	Y	45644	Thylakoidal ascorbate peroxidase OS=Arabidopsis thaliana OX=3702 GN=TAPX PE=3 SV=1
877	2437	Q42593	140.27	38	38	1.75E8	10	9	13	Y	46092	L-ascorbate peroxidase T, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APXT PE=2 SV=2
702	740	A0A178V0W7	140.16	44	44	5.04E7	13	10	18	Y	58897	Importin subunit alpha OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g18920 PE=3 SV=1
702	833	F4JL11	140.16	44	44	5.04E7	13	10	18	Y	58907	Importin subunit alpha-2 OS=Arabidopsis thaliana OX=3702 GN=IMPA2 PE=1 SV=1
597	1487	A0A1I9LL70	140.15	40	40	7.34E7	13	13	23	Y	60722	Translocon at the outer membrane of chloroplasts 64-III OS=Arabidopsis thaliana OX=3702 GN=TOC64-III PE=4 SV=1
597	1488	Q9LVH5	140.15	38	38	7.34E7	13	13	23	Y	64026	Outer envelope protein 64, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OEP64 PE=1 SV=1
778	1386	Q9SYI0	140.13	20	20	4.42E7	14	14	17	Y	115183	Protein translocase subunit SECA1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SECA1 PE=1 SV=2
778	1387	A0A1P8B485	140.13	20	20	4.42E7	14	14	17	Y	115315	Protein translocase subunit SecA OS=Arabidopsis thaliana OX=3702 GN=AGY1 PE=1 SV=1
778	1388	F4JG57	140.13	20	20	4.42E7	14	14	17	Y	117414	Albino or Glassy Yellow 1 OS=Arabidopsis thaliana OX=3702 GN=AGY1 PE=1 SV=1
759	2291	Q56WN1	140.10	39	39	1.18E7	8	4	13	Y	39115	Glutamine synthetase cytosolic isozyme 1-1 OS=Arabidopsis thaliana OX=3702 GN=GLN1-1 PE=1 SV=2
633	1641	P60039	140.07	52	52	6.48E7	11	2	17	Y	27940	60S ribosomal protein L7-3 OS=Arabidopsis thaliana OX=3702 GN=RPL7C PE=2 SV=1
633	1642	A0A178VVS2	140.07	52	52	6.48E7	11	2	17	Y	27940	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g41670 PE=4 SV=1
633	1643	F4IT48	140.07	51	51	6.48E7	11	2	17	Y	28520	Ribosomal protein L30/L7 family protein OS=Arabidopsis thaliana OX=3702 GN=At2g44120 PE=4 SV=1
324	2294	P51418	140.05	62	62	4.12E8	16	11	34	Y	21307	60S ribosomal protein L18a-2 OS=Arabidopsis thaliana OX=3702 GN=RPL18AB PE=1 SV=2
324	2295	A0A178VW11	140.05	62	62	4.12E8	16	11	34	Y	21307	60S ribosomal protein L18a OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g31020 PE=3 SV=1
324	2303	A0A1P8AY36	140.05	51	51	4.12E8	16	11	34	Y	25730	Ribosomal protein L18ae/LX family protein OS=Arabidopsis thaliana OX=3702 GN=At2g34480 PE=1 SV=1
501	1854	A0A2P2CLF6	140.00	74	74	4.78E8	16	16	25	Y	22881	NADH dehydrogenase subunit 9 OS=Arabidopsis thaliana OX=3702 GN=nad9 PE=3 SV=1
883	1498	Q9C8E6	140.00	25	25	4.19E7	15	15	15	Y	93875	Protein PLASTID MOVEMENT IMPAIRED 1 OS=Arabidopsis thaliana OX=3702 GN=PMI1 PE=1 SV=1
883	1499	A0A178W9F4	140.00	25	25	4.19E7	15	15	15	Y	93872	PMI1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g38800 PE=4 SV=1
576	4397	A0A178VPB8	139.62	34	34	1.17E8	16	16	21	Y	72505	EMB2785 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g27210 PE=4 SV=1
576	4398	Q682V3	139.62	34	34	1.17E8	16	16	21	Y	72506	Putative GTP-binding protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
576	4399	F4IPW4	139.62	34	34	1.17E8	16	16	21	Y	72505	Elongation factor family protein OS=Arabidopsis thaliana OX=3702 GN=EMB2785 PE=4 SV=1
576	4400	F4IPW5	139.62	34	34	1.17E8	16	16	21	Y	72935	Elongation factor family protein OS=Arabidopsis thaliana OX=3702 GN=EMB2785 PE=4 SV=1
1039	2382	Q9ASS6	139.46	46	46	1.39E8	11	10	14	Y	28306	Photosynthetic NDH subunit of lumenal location 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PNSL5 PE=1 SV=1
1039	2383	A0A178UN74	139.46	46	46	1.39E8	11	10	14	Y	28306	Peptidyl-prolyl cis-trans isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g12530 PE=3 SV=1
201	2651	P59233	139.44	65	65	4.28E8	13	6	45	Y	17797	Ubiquitin-40S ribosomal protein S27a-3 OS=Arabidopsis thaliana OX=3702 GN=RPS27AC PE=2 SV=2
201	2652	A0A178V9X1	139.44	65	65	4.28E8	13	6	45	Y	17797	UBQ5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g56540 PE=4 SV=1
745	1192	F4JLJ2	139.28	25	25	6.15E7	14	13	18	Y	104351	Non-lysosomal glucosylceramidase OS=Arabidopsis thaliana OX=3702 GN=At4g10060 PE=3 SV=1
529	2502	A0A178VLB7	139.27	32	32	3.96E8	12	12	26	Y	40505	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g32060 PE=4 SV=1
529	2503	O82291	139.27	32	32	3.96E8	12	12	26	Y	40505	Probable plastid-lipid-associated protein 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PAP3 PE=1 SV=1
790	1384	A0A178US90	139.26	20	20	5.95E7	11	10	15	Y	99244	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g38160 PE=4 SV=1
1036	1580	Q96255	139.19	41	41	2.16E7	12	8	13	Y	47359	Phosphoserine aminotransferase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSAT1 PE=1 SV=1
1036	1581	A0A178UW75	139.19	41	41	2.16E7	12	8	13	Y	47331	Phosphoserine aminotransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g40680 PE=3 SV=1
526	1049	A0A178V1V4	139.06	43	43	8.04E7	18	17	23	Y	70338	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g21180 PE=4 SV=1
526	1050	Q94EJ6	139.06	43	43	8.04E7	18	17	23	Y	70338	Probable methyltransferase PMT14 OS=Arabidopsis thaliana OX=3702 GN=At4g18030 PE=2 SV=1
703	1120	P93028	138.98	24	24	4.05E7	16	14	17	Y	120251	Ubiquitin-activating enzyme E1 1 OS=Arabidopsis thaliana OX=3702 GN=UBA1 PE=1 SV=1
703	1121	A0A178VN59	138.98	24	24	4.05E7	16	14	17	Y	120251	UBA1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g26190 PE=3 SV=1
884	3664	A0A178W3Z6	138.97	29	29	5.95E7	11	10	13	Y	67282	PPR596 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g75130 PE=4 SV=1
884	3665	Q9C977	138.97	29	29	5.95E7	11	10	13	Y	67282	Pentatricopeptide repeat-containing protein At1g80270, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g80270 PE=2 SV=1
355	4676	P43286	138.97	37	37	5.73E8	12	5	31	Y	30474	Aquaporin PIP2-1 OS=Arabidopsis thaliana OX=3702 GN=PIP2-1 PE=1 SV=1
355	4677	A0A178V8P4	138.97	37	37	5.73E8	12	5	31	Y	30474	PIP2A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g47810 PE=3 SV=1
827	2719	A0A178UDY2	138.90	34	34	3.44E7	10	10	14	Y	56941	NDC1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g08660 PE=4 SV=1
827	2720	Q8GXR9	138.90	34	34	3.44E7	10	10	14	Y	56916	Alternative NAD(P)H-ubiquinone oxidoreductase C1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDC1 PE=1 SV=2
1037	1591	A0A178UX29	138.81	30	30	2.59E7	12	10	14	Y	63314	NDB1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g32490 PE=4 SV=1
1037	1592	Q1JPL4	138.81	30	30	2.59E7	12	10	14	Y	63314	External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDB1 PE=1 SV=1
629	2044	A0A178UAU0	138.81	65	65	9.17E7	11	5	22	Y	27570	GAMMA CAL1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g63060 PE=4 SV=1
629	2045	Q9FMV1	138.81	65	65	9.17E7	11	5	22	Y	27570	Gamma carbonic anhydrase-like 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GAMMACAL1 PE=1 SV=1
626	1223	Q84W89	138.71	35	35	1.71E7	15	7	22	Y	67626	DEAD-box ATP-dependent RNA helicase 37 OS=Arabidopsis thaliana OX=3702 GN=RH37 PE=2 SV=2
626	1224	A0A178VXF4	138.71	35	35	1.71E7	15	7	22	Y	67656	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g39900 PE=4 SV=1
809	2442	Q9FYR6	138.67	29	29	6.37E7	12	12	16	Y	60747	Proline--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA6 PE=2 SV=1
809	2443	A0A178UAQ2	138.67	29	29	6.37E7	12	12	16	Y	60775	PRORS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g51390 PE=3 SV=1
582	1149	Q42479	138.66	35	35	9.84E7	14	13	19	Y	59336	Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana OX=3702 GN=CPK3 PE=1 SV=1
582	1150	A0A178V4I3	138.66	35	35	9.84E7	14	13	19	Y	59336	CPK3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g27410 PE=4 SV=1
1147	1774	Q9LJX0	138.65	14	14	1.49E7	10	9	11	Y	136788	ABC transporter B family member 19 OS=Arabidopsis thaliana OX=3702 GN=ABCB19 PE=1 SV=1
1147	1775	A0A178V9I8	138.65	14	14	1.49E7	10	9	11	Y	136810	PGP19 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g31560 PE=4 SV=1
903	2878	O81815	138.59	35	35	6.58E7	9	9	15	Y	43979	Monooxygenase 1 OS=Arabidopsis thaliana OX=3702 GN=MO1 PE=2 SV=1
903	2879	Q682A3	138.59	35	35	6.58E7	9	9	15	Y	43960	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
903	2880	Q67XF5	138.59	35	35	6.58E7	9	9	15	Y	44051	Uncharacterized protein At4g15760 OS=Arabidopsis thaliana OX=3702 GN=At4g15760 PE=2 SV=1
903	2881	Q681Q2	138.59	35	35	6.58E7	9	9	15	Y	43980	mRNA, clone: RAFL21-98-L18 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
903	2882	F4JK85	138.59	32	32	6.58E7	9	9	15	Y	48339	Monooxygenase 1 OS=Arabidopsis thaliana OX=3702 GN=MO1 PE=4 SV=2
805	2222	Q9FHX0	138.55	43	43	1.01E8	12	12	16	Y	35550	Glutathione S-transferase family protein OS=Arabidopsis thaliana OX=3702 GN=MJC20.26 PE=2 SV=1
805	2223	A0A178UT50	138.55	43	43	1.01E8	12	12	16	Y	35550	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g39970 PE=4 SV=1
930	3098	A0A178V4R8	138.51	35	35	8.29E7	10	10	15	Y	53871	Glutathione reductase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g26110 PE=3 SV=1
930	3099	P48641	138.51	35	35	8.29E7	10	10	15	Y	53871	Glutathione reductase, cytosolic OS=Arabidopsis thaliana OX=3702 GN=At3g24170 PE=1 SV=1
553	4329	Q7FY22	138.47	79	79	7.58E8	10	8	21	N	11710	AT4g28750 OS=Arabidopsis thaliana OX=3702 GN=At4g28750/F16A16_140 PE=2 SV=1
553	4331	Q9FDY5	138.47	76	76	7.58E8	10	8	21	N	12254	Putative photosystem I subunit PSI-E (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At4g28750 PE=2 SV=2
553	4335	Q8H127	138.47	62	62	7.58E8	10	8	21	N	14765	Putative photosystem I subunit PSI-E protein OS=Arabidopsis thaliana OX=3702 GN=At4g28750 PE=2 SV=1
553	4336	A0A178V4E9	138.47	61	61	7.58E8	10	8	21	N	14967	PSAE-1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g33090 PE=4 SV=1
553	4337	Q9S831	138.47	61	61	7.58E8	10	8	21	N	14967	Photosystem I reaction center subunit IV A, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSAE1 PE=1 SV=1
1367	2516	A0A178WE81	138.43	26	26	2.87E8	8	6	9	Y	56141	Glutamate decarboxylase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g59620 PE=3 SV=1
1367	2517	Q42472	138.43	26	26	2.87E8	8	6	9	Y	56141	Glutamate decarboxylase 2 OS=Arabidopsis thaliana OX=3702 GN=GAD2 PE=1 SV=1
1165	1885	A0A178V6B2	138.33	12	12	2.09E7	9	9	9	Y	174980	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g44830 PE=4 SV=1
1165	1886	A0A1I9LNN0	138.33	12	12	2.09E7	9	9	9	Y	174992	Transducin/WD40 repeat-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g50590 PE=4 SV=1
1165	1887	F4J0P2	138.33	12	12	2.09E7	9	9	9	Y	176304	Transducin/WD40 repeat-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g50590 PE=4 SV=1
860	4559	Q9S834	138.26	51	51	2.25E8	9	9	17	Y	32356	ATP-dependent Clp protease proteolytic subunit 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPP5 PE=1 SV=1
860	4560	A0A178WMF0	138.26	51	51	2.25E8	9	9	17	Y	32356	ATP-dependent Clp protease proteolytic subunit OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g01720 PE=3 SV=1
687	3368	A0A2H1ZE37	138.24	55	55	3.79E8	8	8	21	Y	24096	HARMLESS TO OZONE LAYER 1 OS=Arabidopsis thaliana OX=3702 GN=HOL1 PE=1 SV=1
687	3369	A0A178VXT1	138.24	53	53	3.79E8	8	8	21	Y	25289	HOL1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g41430 PE=4 SV=1
687	3370	Q0WP12	138.24	53	53	3.79E8	8	8	21	Y	25289	Thiocyanate methyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=HOL1 PE=1 SV=2
584	1760	Q9FNK4	138.14	45	45	1.8E8	13	13	23	Y	52178	Ornithine aminotransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DELTA-OAT PE=1 SV=1
945	1784	A0A178VES2	137.95	34	34	1.07E8	12	12	15	Y	53526	MDAR4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g30320 PE=4 SV=1
945	1785	Q9LK94	137.95	34	34	1.07E8	12	12	15	Y	53526	Monodehydroascorbate reductase 4, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=MDAR4 PE=1 SV=1
803	1432	Q07356	137.92	33	33	1.14E8	13	13	17	Y	62964	15-cis-phytoene desaturase, chloroplastic/chromoplastic OS=Arabidopsis thaliana OX=3702 GN=PDS PE=1 SV=1
803	1433	A0A178UUG9	137.92	33	33	1.14E8	13	13	17	Y	62964	PDS3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g16320 PE=4 SV=1
803	1434	Q93ZB4	137.92	33	33	1.14E8	13	13	17	Y	62980	AT4g14210/dl3145c OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
936	3416	Q9ZUU4	137.90	52	52	2.02E8	9	9	15	N	30718	RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP29B PE=1 SV=1
769	1365	A0A178VPS0	137.73	11	11	2.02E7	13	9	14	Y	218277	GSL8 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g33580 PE=4 SV=1
769	1366	Q9SJM0	137.73	11	11	2.02E7	13	9	14	Y	218376	Callose synthase 10 OS=Arabidopsis thaliana OX=3702 GN=CALS10 PE=2 SV=5
932	3460	O23680	137.35	47	47	8.49E7	8	7	13	N	32925	Translocase of chloroplast 33, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC33 PE=1 SV=1
932	3461	A0A178W9C6	137.35	47	47	8.49E7	8	7	13	N	32925	Translocase of chloroplast OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g01390 PE=3 SV=1
987	2069	A0A178U7L1	137.30	36	36	7.04E7	13	13	14	Y	61625	TIC56 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g00650 PE=4 SV=1
987	2070	Q7Y1W1	137.30	36	36	7.04E7	13	13	14	Y	61625	Protein TIC 56, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIC56 PE=1 SV=1
1058	4133	A0A178UVG3	137.28	47	47	3.91E8	8	8	14	N	23634	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g03170 PE=4 SV=1
1058	3476	O22773	137.28	47	47	3.91E8	8	8	14	N	23663	Thylakoid lumenal 16.5 kDa protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At4g02530 PE=1 SV=3
1058	3480	A0A1P8B5H3	137.28	38	38	3.91E8	8	8	14	N	29713	Chloroplast thylakoid lumen protein OS=Arabidopsis thaliana OX=3702 GN=At4g02530 PE=4 SV=1
870	2053	Q9C9C0	137.19	22	22	7.76E7	11	11	12	Y	75095	Serine protease SPPA, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SPPA PE=2 SV=1
870	2054	A0A178WBG0	137.19	22	22	7.76E7	11	11	12	Y	75095	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g68290 PE=4 SV=1
750	1468	Q9LZ66	137.13	27	27	4.42E7	9	8	13	Y	71950	Assimilatory sulfite reductase (ferredoxin), chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SIR PE=1 SV=1
750	1469	A0A178UPZ1	137.13	27	27	4.42E7	9	8	13	Y	71950	SIR OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g04000 PE=4 SV=1
852	1873	A0A1P8AUN1	137.05	40	40	8.11E7	13	13	17	N	62328	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Arabidopsis thaliana OX=3702 GN=At1g76400 PE=3 SV=1
852	1871	A0A178WGG6	137.05	36	36	8.11E7	13	13	17	N	68642	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g70860 PE=3 SV=1
852	1872	Q9SFX3	137.05	36	36	8.11E7	13	13	17	N	68642	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1A OS=Arabidopsis thaliana OX=3702 GN=OST1A PE=2 SV=1
574	3059	F4IFG1	136.81	21	21	1.62E7	15	9	17	Y	86692	Dynamin related protein OS=Arabidopsis thaliana OX=3702 GN=DRP3B PE=1 SV=1
574	3060	Q8LFT2	136.81	21	21	1.62E7	15	9	17	Y	86644	Dynamin-related protein 3B OS=Arabidopsis thaliana OX=3702 GN=DRP3B PE=1 SV=2
574	3064	F4IFG2	136.81	20	20	1.62E7	15	9	17	Y	89836	Dynamin related protein OS=Arabidopsis thaliana OX=3702 GN=DRP3B PE=1 SV=1
713	942	Q9FWA3	136.66	33	33	7.33E7	12	9	16	Y	53577	6-phosphogluconate dehydrogenase, decarboxylating 2 OS=Arabidopsis thaliana OX=3702 GN=PGD2 PE=1 SV=1
713	943	A0A178VK18	136.66	33	33	7.33E7	12	9	16	Y	53577	6-phosphogluconate dehydrogenase, decarboxylating OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g01580 PE=3 SV=1
913	1506	Q56YU0	136.58	36	36	3.57E7	10	10	15	Y	54360	Aldehyde dehydrogenase family 2 member C4 OS=Arabidopsis thaliana OX=3702 GN=ALDH2C4 PE=1 SV=2
887	1495	A8MR07	136.50	42	42	1.86E7	10	4	13	Y	51890	Pyruvate kinase OS=Arabidopsis thaliana OX=3702 GN=At3g52990 PE=2 SV=1
887	1295	Q9LF93	136.50	38	38	1.86E7	10	4	13	Y	55952	Pyruvate kinase OS=Arabidopsis thaliana OX=3702 GN=F8J2_160 PE=3 SV=1
887	1296	Q94KE3	136.50	37	37	1.86E7	10	4	13	Y	57495	Pyruvate kinase OS=Arabidopsis thaliana OX=3702 GN=At3g52990 PE=2 SV=1
658	2872	P41916	136.42	55	55	2.85E8	11	11	22	Y	25276	GTP-binding nuclear protein Ran-1 OS=Arabidopsis thaliana OX=3702 GN=RAN1 PE=1 SV=1
658	2873	A0A178UC18	136.42	55	55	2.85E8	11	11	22	Y	25276	GTP-binding nuclear protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g19960 PE=3 SV=1
1187	1751	Q96325	136.39	25	25	7.99E7	10	10	11	Y	85444	Voltage-gated chloride channel OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1187	1752	A0A178UNE2	136.39	25	25	7.99E7	10	10	11	Y	85388	CLCA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g38620 PE=3 SV=1
1187	1753	P92941	136.39	25	25	7.99E7	10	10	11	Y	85406	Chloride channel protein CLC-a OS=Arabidopsis thaliana OX=3702 GN=CLC-A PE=1 SV=2
678	814	A0A178UDJ9	136.36	52	52	2.16E8	17	17	21	Y	53720	Xylose isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g56930 PE=3 SV=1
678	816	Q9FKK7	136.36	52	52	2.16E8	17	17	21	Y	53720	Xylose isomerase OS=Arabidopsis thaliana OX=3702 GN=XYLA PE=2 SV=2
1300	4621	Q9SIP1	136.35	45	45	6.28E7	9	9	10	Y	28865	Stress-response A/B barrel domain-containing protein UP3 OS=Arabidopsis thaliana OX=3702 GN=UP3 PE=1 SV=1
1300	4622	A0A178VYV2	136.35	45	45	6.28E7	9	9	10	Y	28865	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g27890 PE=4 SV=1
960	2138	A0A178WJP3	136.20	15	15	4.04E7	10	10	13	Y	153978	PUR4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g68640 PE=3 SV=1
960	2139	Q9M8D3	136.20	15	15	4.04E7	10	10	13	Y	153953	Probable phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g74260 PE=2 SV=3
655	1170	A0A178VH17	136.16	28	28	1.41E7	11	5	21	Y	66026	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g53050 PE=4 SV=1
655	1171	Q8LA13	136.16	28	28	1.41E7	11	5	21	Y	66026	DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana OX=3702 GN=RH11 PE=1 SV=1
1140	839	Q9FF91	136.15	15	15	3.39E7	10	10	12	Y	103927	GPI-anchored adhesin-like protein OS=Arabidopsis thaliana OX=3702 GN=MRO11.7 PE=1 SV=1
774	1859	Q9LYR4	136.11	42	42	1.08E8	12	12	17	Y	47699	Aldolase-type TIM barrel family protein OS=Arabidopsis thaliana OX=3702 GN=TRA2 PE=2 SV=1
774	1860	A0A178UD24	136.11	42	42	1.08E8	12	12	17	Y	47699	TRA2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g12840 PE=3 SV=1
715	1446	A0A178UW48	136.05	53	53	4.41E7	12	7	16	Y	37345	ARGAH1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g10120 PE=3 SV=1
715	1447	P46637	136.05	53	53	4.41E7	12	7	16	Y	37345	Arginase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ARGAH1 PE=1 SV=1
1093	1457	A0A178UHP9	136.00	23	23	7.95E7	12	12	12	N	81876	Eukaryotic translation initiation factor 3 subunit B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g27600 PE=3 SV=1
1093	1458	Q9C5Z1	136.00	23	23	7.95E7	12	12	12	N	81876	Eukaryotic translation initiation factor 3 subunit B OS=Arabidopsis thaliana OX=3702 GN=TIF3B1 PE=1 SV=1
1093	1529	F4K4D5	136.00	22	22	7.95E7	12	12	12	N	84914	Eukaryotic translation initiation factor 3 subunit B OS=Arabidopsis thaliana OX=3702 GN=TIF3B1 PE=1 SV=1
532	5081	A0A178USZ7	135.91	39	39	2.21E8	12	5	23	Y	30693	TMP-C OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g00560 PE=3 SV=1
532	5082	Q39196	135.91	39	39	2.21E8	12	5	23	Y	30693	Probable aquaporin PIP1-4 OS=Arabidopsis thaliana OX=3702 GN=PIP1.4 PE=1 SV=1
394	2462	A0A178USM6	135.90	47	47	1.17E8	12	3	32	Y	28162	40S ribosomal protein S6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g10020 PE=3 SV=1
394	2463	P51430	135.90	47	47	1.17E8	12	3	32	Y	28162	40S ribosomal protein S6-2 OS=Arabidopsis thaliana OX=3702 GN=RPS6B PE=1 SV=3
747	1046	Q9SRD2	135.85	18	18	2.66E7	13	9	16	Y	140708	Putative translation initiation factor IF-2; 73082-68138 OS=Arabidopsis thaliana OX=3702 GN=F28O16.18 PE=4 SV=1
747	1047	F4I420	135.85	18	18	2.66E7	13	9	16	Y	142116	Eukaryotic translation initiation factor 2 (eIF-2) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g76810 PE=1 SV=1
1109	4024	A0A178UYS7	135.79	43	43	5.23E7	9	9	13	Y	45500	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g36420 PE=3 SV=1
1109	4025	Q8RXN4	135.79	43	43	5.23E7	9	9	13	Y	45500	3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g31810 PE=1 SV=1
544	1713	Q9LVA0	135.69	27	27	1.83E8	12	12	18	Y	51567	BAG family molecular chaperone regulator 7 OS=Arabidopsis thaliana OX=3702 GN=BAG7 PE=1 SV=1
544	1714	A0A178ULD7	135.69	27	27	1.83E8	12	12	18	Y	51467	BAG7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g61920 PE=4 SV=1
881	3624	A0A178VSS7	135.59	50	50	1.29E8	8	8	15	N	23779	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g42510 PE=4 SV=1
881	3625	O22160	135.59	50	50	1.29E8	8	8	15	N	23779	Thylakoid lumenal 15 kDa protein 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g44920 PE=1 SV=2
817	3308	A0A178VZD7	135.40	26	26	9.04E7	9	9	15	N	59492	SCY1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g14050 PE=3 SV=1
817	3309	Q38885	135.40	26	26	9.04E7	9	9	15	N	59492	Preprotein translocase subunit SCY1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SCY1 PE=1 SV=2
749	2522	Q8LB47	135.27	49	49	2.03E8	13	13	17	N	36116	GrpE protein homolog 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=Mge2 PE=1 SV=1
749	2523	A0A178V1B9	135.27	49	49	2.03E8	13	13	17	N	36048	GrpE protein homolog OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g30930 PE=3 SV=1
765	1376	Q9LYA9	135.07	33	33	1.83E7	9	2	12	Y	43930	Chloroplast stem-loop binding protein of 41 kDa a, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CSP41A PE=1 SV=1
863	5006	A0A1P8BBC4	134.99	54	54	1.8E8	10	10	17	Y	24237	NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g15910 PE=4 SV=1
863	5007	Q8LD22	134.99	49	49	1.8E8	10	10	17	Y	26719	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
863	5008	Q949S7	134.99	46	46	1.8E8	10	10	17	Y	28826	NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g15910 PE=2 SV=1
671	1247	Q9FN05	134.83	26	26	1.12E8	16	16	18	Y	104275	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
671	1248	A0A1P8BAU5	134.83	25	25	1.12E8	16	16	18	Y	107394	Glycosyl hydrolases family 31 protein OS=Arabidopsis thaliana OX=3702 GN=RSW3 PE=3 SV=1
961	901	Q9XEE2	134.81	52	52	8.93E7	12	11	15	Y	36266	Annexin D2 OS=Arabidopsis thaliana OX=3702 GN=ANN2 PE=1 SV=1
961	1000	A0A178UJ47	134.81	52	52	8.93E7	12	11	15	Y	36252	Annexin OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g64740 PE=3 SV=1
1189	3401	A0A178VTX0	134.78	35	35	8.67E6	9	4	12	N	50722	FTSZ2-1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g32900 PE=3 SV=1
1189	3402	O82533	134.78	35	35	8.67E6	9	4	12	N	50722	Cell division protein FtsZ homolog 2-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FTSZ2-1 PE=1 SV=2
748	2395	Q8RWG1	134.45	24	24	3.09E7	11	11	12	Y	76757	Protein ACTIVITY OF BC1 COMPLEX KINASE 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABC1K1 PE=1 SV=1
748	2396	A0A178V5V0	134.45	24	24	3.09E7	11	11	12	Y	76757	AtACDO1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g35950 PE=4 SV=1
1111	2307	Q9C8P0	134.43	35	35	4.53E7	8	7	12	N	48307	Dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=EMB3003 PE=2 SV=1
1111	2308	A0A178W4F9	134.43	35	35	4.53E7	8	7	12	N	48307	Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g35370 PE=3 SV=1
914	1489	Q96254	134.40	34	34	2.73E7	10	4	12	Y	49819	Guanosine nucleotide diphosphate dissociation inhibitor 1 OS=Arabidopsis thaliana OX=3702 GN=GDI1 PE=1 SV=1
914	1490	A0A178VSJ6	134.40	34	34	2.73E7	10	4	12	Y	49819	Guanosine nucleotide diphosphate dissociation inhibitor OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g41650 PE=3 SV=1
630	793	Q9LV03	134.36	12	12	4.39E7	13	13	15	Y	241897	Glutamate synthase 1 [NADH], chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GLT1 PE=1 SV=2
630	794	A0A178UR11	134.36	12	12	4.39E7	13	13	15	Y	241957	GLT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g52410 PE=4 SV=1
885	1483	Q0WT48	134.30	28	28	5.38E7	13	12	16	Y	76904	DnaJ protein ERDJ2A OS=Arabidopsis thaliana OX=3702 GN=ERDJ2A PE=1 SV=1
885	1484	A0A178W1G8	134.30	28	28	5.38E7	13	12	16	Y	76904	ATERDJ2A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g74790 PE=4 SV=1
815	3189	Q9FV81	134.28	31	31	5.2E7	13	13	16	Y	60941	Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GATB PE=2 SV=1
815	3190	A0A178W7I9	134.28	31	31	5.2E7	13	13	16	Y	60941	Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GATB PE=3 SV=1
1117	2339	A0A178UIF2	133.66	31	31	1.24E8	8	8	12	Y	44865	FLA1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g54890 PE=4 SV=1
1117	2340	Q9FM65	133.66	31	31	1.24E8	8	8	12	Y	44849	Fasciclin-like arabinogalactan protein 1 OS=Arabidopsis thaliana OX=3702 GN=FLA1 PE=1 SV=1
868	2183	P56763	133.66	28	28	4.3E7	13	13	16	Y	78583	DNA-directed RNA polymerase subunit beta' OS=Arabidopsis thaliana OX=3702 GN=rpoC1 PE=3 SV=1
868	2184	A0A1B1W4T7	133.66	28	28	4.3E7	13	13	16	Y	78682	DNA-directed RNA polymerase subunit beta' OS=Arabidopsis thaliana OX=3702 GN=rpoC1 PE=3 SV=1
572	1696	A0A178VKQ6	133.62	27	27	3.71E7	15	11	19	Y	91481	UMP-CMP kinase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g54590 PE=3 SV=1
712	1421	A0A178UB21	133.60	29	29	4.58E7	13	8	17	Y	80204	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g65460 PE=3 SV=1
712	1422	Q94AM1	133.60	26	26	4.58E7	13	8	17	Y	88757	Organellar oligopeptidase A, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OOP PE=1 SV=1
712	1423	A0A1R7T3A4	133.60	25	25	4.58E7	13	8	17	Y	90369	Zincin-like metalloproteases family protein OS=Arabidopsis thaliana OX=3702 GN=OOP PE=3 SV=1
978	2292	Q9SXP7	133.53	72	72	1.12E8	10	10	14	Y	26421	Octanoyltransferase LIP2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LIP2 PE=1 SV=1
978	2293	A0A178WI01	133.53	72	72	1.12E8	10	10	14	Y	26421	LIP2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g03970 PE=3 SV=1
594	2373	Q9FLX7	133.45	75	75	2.8E8	12	12	22	Y	19179	Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g52840 PE=1 SV=1
594	2374	A0A178UMH4	133.45	75	75	2.8E8	12	12	22	Y	19179	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g51710 PE=4 SV=1
561	3052	Q940B0	133.38	53	53	6.66E7	12	4	21	Y	20967	60S ribosomal protein L18-3 OS=Arabidopsis thaliana OX=3702 GN=RPL18C PE=2 SV=1
561	3053	A0A178UKW4	133.38	53	53	6.66E7	12	4	21	Y	20967	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g27840 PE=4 SV=1
770	1958	A0A178UMZ8	133.32	35	35	1.38E8	10	10	16	Y	45497	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g63190 PE=4 SV=1
770	1959	Q8LDF7	133.32	35	35	1.38E8	10	10	16	Y	45469	Alcohol dehydrogenase-like protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
770	1960	Q93ZM6	133.32	35	35	1.38E8	10	10	16	Y	45497	AT5g63620/MBK5_9 OS=Arabidopsis thaliana OX=3702 GN=MBK5.9 PE=2 SV=1
770	1961	F4KAS6	133.32	35	35	1.38E8	10	10	16	Y	45541	GroES-like zinc-binding alcohol dehydrogenase family protein OS=Arabidopsis thaliana OX=3702 GN=MBK5.9 PE=4 SV=1
634	630	Q9SH69	133.30	39	39	1.9E7	13	3	21	Y	53378	6-phosphogluconate dehydrogenase, decarboxylating 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGD1 PE=1 SV=1
717	2179	O04603	133.25	59	59	3.19E8	13	13	20	Y	28344	50S ribosomal protein L5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPL5 PE=2 SV=1
717	2180	A0A178V3W4	133.25	59	59	3.19E8	13	13	20	Y	28344	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g01660 PE=3 SV=1
897	4614	Q9C514	133.22	47	47	1.35E8	8	8	16	N	21922	40S ribosomal protein S7-1 OS=Arabidopsis thaliana OX=3702 GN=RPS7A PE=2 SV=1
897	4615	A0A178WGF0	133.22	47	47	1.35E8	8	8	16	N	21922	40S ribosomal protein S7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g42950 PE=3 SV=1
1020	2482	Q93Z74	133.18	36	36	1.02E8	8	8	12	Y	37147	AT3g27570/MMJ24_12 OS=Arabidopsis thaliana OX=3702 GN=At3g27570 PE=1 SV=1
1020	2483	B9DGQ8	133.18	33	33	1.02E8	8	8	12	Y	40706	AT3G27570 protein (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At3g27570 PE=2 SV=1
1020	2484	Q0WR20	133.18	32	32	1.02E8	8	8	12	Y	41240	Sucrose cleavage like protein (Fragment) OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1020	2485	A0A178VAL2	133.18	32	32	1.02E8	8	8	12	Y	41584	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g30110 PE=4 SV=1
1020	2486	F4IWK4	133.18	32	32	1.02E8	8	8	12	Y	41612	Sucrase/ferredoxin-like family protein OS=Arabidopsis thaliana OX=3702 GN=At3g27570 PE=1 SV=1
640	1745	Q9SS38	133.17	23	23	2.84E6	13	3	18	Y	81048	DNA gyrase subunit B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GYRBC PE=2 SV=3
640	1746	A0A178VN89	133.17	23	23	2.84E6	13	3	18	Y	81829	DNA gyrase subunit B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g10050 PE=3 SV=1
640	1747	A0A1I9LTQ6	133.17	23	23	2.84E6	13	3	18	Y	82083	DNA gyrase subunit B OS=Arabidopsis thaliana OX=3702 GN=GYRB1 PE=3 SV=1
911	1812	A0A178UGL2	133.16	16	16	2.81E7	13	13	15	N	148083	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g24580 PE=4 SV=1
911	1813	Q0WLS8	133.16	16	16	2.81E7	13	13	15	N	148156	Uncharacterized protein At5g24710 OS=Arabidopsis thaliana OX=3702 PE=1 SV=1
911	1814	F4KIH8	133.16	16	16	2.81E7	13	13	15	N	148070	Transducin/WD40 repeat-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MXC17.10 PE=4 SV=1
1014	2011	A0A178WCT0	133.13	43	43	6.77E7	10	10	12	Y	46690	Delta-aminolevulinic acid dehydratase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g63860 PE=3 SV=1
1014	2012	Q9SFH9	133.13	43	43	6.77E7	10	10	12	Y	46690	Delta-aminolevulinic acid dehydratase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HEMB1 PE=2 SV=1
999	5618	Q9S7G6	133.11	19	19	5.74E7	10	10	11	Y	107772	Polyribonucleotide nucleotidyltransferase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PNP2 PE=2 SV=1
966	2885	A0A178V2Z3	133.08	36	36	4.5E7	12	12	15	Y	46548	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g41780 PE=4 SV=1
966	2886	Q9M065	133.08	36	36	4.5E7	12	12	15	Y	46548	Pentatricopeptide repeat-containing protein At4g36680, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g36680 PE=1 SV=1
1317	1337	O04509	132.96	30	30	3.62E7	9	9	10	Y	52791	F21M12.26 protein OS=Arabidopsis thaliana OX=3702 GN=F21M12.26 PE=3 SV=1
1317	1338	Q941B2	132.96	29	29	3.62E7	9	9	10	Y	54855	At1g09870/F21M12_26 OS=Arabidopsis thaliana OX=3702 GN=At1g09870 PE=2 SV=1
1317	1339	A0A178W2B9	132.96	29	29	3.62E7	9	9	10	Y	54855	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g09880 PE=3 SV=1
755	1585	F6M3L4	132.90	57	57	5.03E7	11	7	19	Y	33216	Pyridoxine biosynthesis protein OS=Arabidopsis thaliana OX=3702 GN=PDX1.3 PE=2 SV=1
755	1586	Q8L940	132.90	57	57	5.03E7	11	7	19	Y	33216	Pyridoxal 5'-phosphate synthase subunit PDX1.3 OS=Arabidopsis thaliana OX=3702 GN=PDX13 PE=1 SV=2
755	1587	A0A384KHQ3	132.90	57	57	5.03E7	11	7	19	Y	33216	RSR4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g00450 PE=3 SV=1
577	4259	A0A178WJT1	132.79	51	51	3.8E8	11	11	21	Y	19925	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g27830 PE=3 SV=1
577	4260	Q93VI3	132.79	51	51	3.8E8	11	11	21	Y	19897	60S ribosomal protein L17-1 OS=Arabidopsis thaliana OX=3702 GN=RPL17A PE=2 SV=1
850	1449	Q39227	132.72	42	42	8.37E7	12	10	17	Y	40450	24-methylenesterol C-methyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=SMT2 PE=1 SV=2
850	1450	A0A178WHI4	132.72	42	42	8.37E7	12	10	17	Y	40450	Methyltransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g21290 PE=3 SV=1
792	1664	Q24JJ0	132.64	46	46	1.21E8	9	9	15	Y	41682	At2g43360 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
792	1665	Q84WG4	132.64	46	46	1.21E8	9	9	15	Y	41683	Putative biotin synthase (Bio B) OS=Arabidopsis thaliana OX=3702 GN=At2g43360 PE=2 SV=1
792	1666	P54967	132.64	46	46	1.21E8	9	9	15	Y	41682	Biotin synthase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=BIO2 PE=1 SV=1
792	1667	A0A384KLW7	132.64	46	46	1.21E8	9	9	15	Y	41682	BIOB OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g40830 PE=3 SV=1
1003	922	A0A178WN90	132.63	29	29	4.9E7	12	12	13	Y	82708	Phox2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g55690 PE=1 SV=1
1003	923	O48802	132.63	29	29	4.9E7	12	12	13	Y	82708	Protein CLMP1 OS=Arabidopsis thaliana OX=3702 GN=CLMP1 PE=1 SV=1
615	2538	A0A178W8Q3	132.61	39	39	2.5E8	11	11	23	Y	46072	MVP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g48450 PE=3 SV=1
615	2539	Q7XA74	132.61	39	39	2.5E8	11	11	23	Y	46083	Inactive GDSL esterase/lipase-like protein 25 OS=Arabidopsis thaliana OX=3702 GN=MVP1 PE=1 SV=1
784	1096	X5JB51	132.58	25	25	7.09E7	13	13	13	Y	90256	Exocyst complex component SEC10b OS=Arabidopsis thaliana OX=3702 GN=SEC10b PE=1 SV=1
784	1097	A0A178U724	132.58	25	25	7.09E7	13	13	13	Y	90256	SEC10 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g12130 PE=4 SV=1
929	2978	C0Z3C1	132.57	38	38	1.11E8	10	10	15	Y	49750	Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex OS=Arabidopsis thaliana OX=3702 GN=At3g06850 PE=2 SV=1
929	2983	Q9M7Z1	132.57	35	35	1.11E8	10	10	15	Y	52706	Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=BCE2 PE=1 SV=1
895	2343	P46010	132.50	27	27	2.42E6	8	2	15	Y	38022	Nitrilase 3 OS=Arabidopsis thaliana OX=3702 GN=NIT3 PE=1 SV=1
895	2344	A0A178VEJ6	132.50	27	27	2.42E6	8	2	15	Y	38022	NIT3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g37920 PE=4 SV=1
1095	3499	A0A178V478	132.33	26	26	8.47E7	10	10	12	N	68615	ATATH10 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g02090 PE=4 SV=1
1095	3500	Q9SBB2	132.33	26	26	8.47E7	10	10	12	N	68627	Protein ABC transporter 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ABC1 PE=2 SV=1
1094	1948	Q9M0X9	132.30	30	30	5.82E7	11	11	13	Y	59850	4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana OX=3702 GN=4CLL7 PE=1 SV=1
1094	2329	A0A178UXS2	132.30	30	30	5.82E7	11	11	13	Y	59834	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g05000 PE=4 SV=1
949	1481	Q944P7	132.26	34	34	2.26E7	11	8	12	Y	61307	Leucine aminopeptidase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LAP2 PE=2 SV=2
825	1436	Q0WMB2	132.23	27	27	1E8	11	11	14	N	56811	Uncharacterized protein At5g24690 OS=Arabidopsis thaliana OX=3702 GN=At5g24690 PE=2 SV=1
825	1437	Q0WL68	132.23	27	27	1E8	11	11	14	N	56840	Uncharacterized protein At5g24690 OS=Arabidopsis thaliana OX=3702 GN=At5g24690 PE=2 SV=1
825	1438	Q93W02	132.23	27	27	1E8	11	11	14	N	56812	AT5g24690/MXC17_8 OS=Arabidopsis thaliana OX=3702 GN=MXC17.8 PE=2 SV=1
915	2616	Q9ZRT5	132.17	56	56	9.78E7	9	6	15	Y	27653	Glutathione S-transferase T1 OS=Arabidopsis thaliana OX=3702 GN=GSTT1 PE=2 SV=1
925	3381	Q9SU13	132.17	33	33	9.81E7	10	10	15	Y	43448	Fasciclin-like arabinogalactan protein 2 OS=Arabidopsis thaliana OX=3702 GN=FLA2 PE=2 SV=1
925	3382	A0A178USM3	132.17	33	33	9.81E7	10	10	15	Y	43443	FLA2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g14360 PE=4 SV=1
559	3696	A0A178V8M9	132.06	47	47	8.39E7	12	4	21	Y	20926	RPL18 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g05160 PE=4 SV=1
559	3697	P42791	132.06	47	47	8.39E7	12	4	21	Y	20926	60S ribosomal protein L18-2 OS=Arabidopsis thaliana OX=3702 GN=RPL18B PE=1 SV=2
729	2695	A0A178W8F0	132.01	75	75	1.61E8	10	10	18	Y	23641	DHAR5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g20540 PE=3 SV=1
729	2696	Q9FWR4	132.01	75	75	1.61E8	10	10	18	Y	23641	Glutathione S-transferase DHAR1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DHAR1 PE=1 SV=1
1088	2336	A0A178W4F8	131.90	29	29	2.48E7	8	6	10	Y	50626	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g73490 PE=4 SV=1
1088	2337	Q9ZVA1	131.90	29	29	2.48E7	8	6	10	Y	50595	EP1-like glycoprotein 1 OS=Arabidopsis thaliana OX=3702 GN=At1g78820 PE=2 SV=1
1021	2734	Q9SMQ9	131.86	37	37	3.35E7	12	11	13	Y	42404	DnaJ-like protein OS=Arabidopsis thaliana OX=3702 GN=T5J17.130 PE=3 SV=1
1021	2735	A0A178UVJ3	131.86	32	32	3.35E7	12	11	13	Y	48013	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g45400 PE=3 SV=1
1021	2736	Q940V1	131.86	32	32	3.35E7	12	11	13	Y	48032	AT4g39960/T5J17_130 OS=Arabidopsis thaliana OX=3702 GN=DJA5 PE=2 SV=1
707	1697	A0A178V326	131.86	49	49	1.31E8	11	10	18	Y	38934	CAD9 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g44720 PE=3 SV=1
707	1698	P42734	131.86	49	49	1.31E8	11	10	18	Y	38934	Probable cinnamyl alcohol dehydrogenase 9 OS=Arabidopsis thaliana OX=3702 GN=CAD9 PE=2 SV=2
642	2603	Q9ZQP2	131.80	27	27	1.21E7	11	7	14	Y	74298	Putative peroxisomal acyl-coenzyme A oxidase 1.2 OS=Arabidopsis thaliana OX=3702 GN=ACX1.2 PE=2 SV=1
642	2604	A0A178W176	131.80	27	27	1.21E7	11	7	14	Y	74300	Acyl-coenzyme A oxidase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g32320 PE=3 SV=1
1038	2262	A0A1P8AVY3	131.78	26	26	1.23E8	9	9	11	Y	57716	Triacylglycerol lipase-like 1 OS=Arabidopsis thaliana OX=3702 GN=TLL1 PE=4 SV=1
798	1356	A0A178UN53	131.57	26	26	3.7E7	15	15	17	Y	82257	ISPG OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g60050 PE=3 SV=1
798	1357	F4K0E8	131.57	26	26	3.7E7	15	15	17	Y	82257	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ISPG PE=1 SV=1
1091	4094	Q9FFJ2	131.53	41	41	2.37E8	7	7	12	Y	28459	Rubredoxin family protein OS=Arabidopsis thaliana OX=3702 GN=ENH1 PE=2 SV=1
851	1361	A0A178VGZ6	131.48	32	32	3.3E6	12	3	16	Y	60757	Dihydrolipoyl dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g17830 PE=3 SV=1
851	1362	A8MS68	131.48	30	30	3.3E6	12	3	16	Y	66661	Dihydrolipoyl dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LPD1 PE=2 SV=1
1213	2987	A0A178VJD9	131.23	42	42	1.73E7	8	3	11	N	21982	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g12410 PE=4 SV=1
1213	2988	Q9LHG9	131.23	42	42	1.73E7	8	3	11	N	21982	Nascent polypeptide-associated complex subunit alpha-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=At3g12390 PE=1 SV=1
1106	1903	O22173	131.23	20	20	7.17E7	10	10	12	Y	71652	Polyadenylate-binding protein 4 OS=Arabidopsis thaliana OX=3702 GN=PAB4 PE=1 SV=1
1106	1904	A0A178VSF7	131.23	20	20	7.17E7	10	10	12	Y	71652	Polyadenylate-binding protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g19000 PE=3 SV=1
694	2615	A0A178U909	131.15	19	19	1.92E7	11	3	19	N	74479	Transmembrane 9 superfamily member OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g10500 PE=3 SV=1
694	2614	F4KIB2	131.15	19	19	1.92E7	11	3	19	N	74467	Transmembrane 9 superfamily member 8 OS=Arabidopsis thaliana OX=3702 GN=TMN8 PE=2 SV=1
1229	4444	Q7Y208	131.09	20	20	4.2E7	10	9	11	Y	83788	Glycerophosphodiester phosphodiesterase GDPDL1 OS=Arabidopsis thaliana OX=3702 GN=GDPDL1 PE=1 SV=2
1229	4445	A0A178WCT5	131.09	20	20	4.2E7	10	9	11	Y	83788	SVL2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g60800 PE=4 SV=1
1229	4446	F4HQ30	131.09	20	20	4.2E7	10	9	11	Y	86377	SHV3-like 2 OS=Arabidopsis thaliana OX=3702 GN=SVL2 PE=4 SV=1
947	2038	Q9SAJ6	131.08	31	31	2.21E7	9	3	15	Y	44831	Glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GAPCP1 PE=1 SV=1
947	2009	A0A178WL08	131.08	31	31	2.21E7	9	3	15	Y	44804	Glyceraldehyde-3-phosphate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g74330 PE=3 SV=1
833	1323	A0A178UCA6	130.95	30	30	1.23E7	10	3	14	Y	51920	UTP--glucose-1-phosphate uridylyltransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g16960 PE=3 SV=1
833	1324	P57751	130.95	30	30	1.23E7	10	3	14	Y	51920	UTP--glucose-1-phosphate uridylyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=UGP1 PE=2 SV=1
1126	59258	O22854	130.93	33	33	4.09E7	10	10	11	Y	70128	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ETFQO PE=2 SV=1
1126	59259	A0A178VYB8	130.93	33	33	4.09E7	10	10	11	Y	70128	ETFQO OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g40890 PE=4 SV=1
708	3857	O22769	130.93	39	39	2.86E8	8	8	18	Y	28389	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g02580 PE=1 SV=3
800	2018	Q8LF48	130.79	44	44	9.21E6	11	7	18	Y	46611	3-ketoacyl-CoA thiolase 1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=KAT1 PE=1 SV=2
800	2019	A0A178W7T5	130.79	44	44	9.21E6	11	7	18	Y	46611	PKT4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g04050 PE=3 SV=1
1105	2158	Q8LAH7	130.78	47	47	1.68E7	11	7	12	Y	41168	12-oxophytodienoate reductase 1 OS=Arabidopsis thaliana OX=3702 GN=OPR1 PE=1 SV=2
1105	2159	A0A178WIM4	130.78	47	47	1.68E7	11	7	12	Y	41168	OPR1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g71160 PE=4 SV=1
485	2809	Q9LXG1	130.58	52	52	5.17E8	14	14	23	Y	23036	40S ribosomal protein S9-1 OS=Arabidopsis thaliana OX=3702 GN=RPS9B PE=1 SV=1
485	2810	A0A178UUQ0	130.58	52	52	5.17E8	14	14	23	Y	23036	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g14690 PE=3 SV=1
1233	3003	Q8LAZ1	130.54	32	32	2.6E7	10	7	10	Y	55871	3-ketoacyl-CoA synthase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1233	2731	A0A178WCX7	130.54	32	32	2.6E7	10	7	10	Y	56396	3-ketoacyl-CoA synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g62580 PE=3 SV=1
1233	2732	Q9XF43	130.54	32	32	2.6E7	10	7	10	Y	56396	3-ketoacyl-CoA synthase 6 OS=Arabidopsis thaliana OX=3702 GN=CUT1 PE=1 SV=1
1144	2845	Q41969	130.51	41	41	4.27E7	9	9	10	Y	30663	Eukaryotic translation initiation factor 2 subunit beta OS=Arabidopsis thaliana OX=3702 GN=EIF2B PE=1 SV=3
563	5537	A0A219HZH3	130.37	29	29	1.11E9	10	10	22	Y	43494	Glucose-6-phosphate/phosphate translocator-like protein OS=Arabidopsis thaliana OX=3702 GN=APE2 PE=1 SV=1
563	5539	Q9ZSR7	130.37	28	28	1.11E9	10	10	22	Y	44633	Triose phosphate/phosphate translocator TPT, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TPT PE=1 SV=1
563	5544	A0A178UCH2	130.37	28	28	1.11E9	10	10	22	Y	44647	TPT OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g44540 PE=4 SV=1
563	5540	A0A219I0W9	130.37	28	28	1.11E9	10	10	22	Y	45237	Glucose-6-phosphate/phosphate translocator-like protein OS=Arabidopsis thaliana OX=3702 GN=APE2 PE=1 SV=1
888	1477	A0A178VBD4	130.22	28	28	4.28E7	11	11	11	Y	59229	TCP-1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g21390 PE=3 SV=1
888	1478	P28769	130.22	28	28	4.28E7	11	11	11	Y	59229	T-complex protein 1 subunit alpha OS=Arabidopsis thaliana OX=3702 GN=CCT1 PE=1 SV=1
781	2634	Q9SMT7	130.21	42	42	2.32E8	11	11	18	Y	55544	Oxalate--CoA ligase OS=Arabidopsis thaliana OX=3702 GN=AAE3 PE=1 SV=1
781	2635	A0A178V7A3	130.21	42	42	2.32E8	11	11	18	Y	55544	AAE3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g43140 PE=4 SV=1
843	2504	Q8VZB9	130.15	50	50	7.92E6	10	2	16	Y	24469	60S ribosomal protein L10a-1 OS=Arabidopsis thaliana OX=3702 GN=RPL10AA PE=1 SV=1
843	2505	A0A178W6A5	130.15	50	50	7.92E6	10	2	16	Y	24469	Ribosomal protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g08180 PE=3 SV=1
1202	4205	Q9FN42	130.12	50	50	1.1E8	9	9	11	Y	26283	ATP-dependent Clp protease proteolytic subunit 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CLPP2 PE=1 SV=1
1202	4206	A0A178U8I8	130.12	50	50	1.1E8	9	9	11	Y	26283	ATP-dependent Clp protease proteolytic subunit OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g22680 PE=3 SV=1
1363	2124	A0A178UMV6	130.04	17	17	2.31E7	9	9	9	Y	80388	STA1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g57610 PE=4 SV=1
1363	2125	Q9LVM1	130.04	17	17	2.31E7	9	9	9	Y	80420	ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ABCB25 PE=1 SV=1
865	3746	Q9SSB8	130.03	61	61	6.16E7	8	5	16	Y	18583	Cytochrome c oxidase subunit 5b-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COX5B-2 PE=1 SV=1
865	3747	A0A178WMQ6	130.03	61	61	6.16E7	8	5	16	Y	18598	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g75090 PE=4 SV=1
602	1294	Q9FVQ1	129.99	26	26	1.98E8	15	15	20	Y	58773	Nucleolin 1 OS=Arabidopsis thaliana OX=3702 GN=NUCL1 PE=1 SV=1
899	1699	A0A178V823	129.97	39	39	1.29E8	10	10	13	N	46674	DEGP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g30490 PE=4 SV=1
899	1700	O22609	129.97	39	39	1.29E8	10	10	13	N	46674	Protease Do-like 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DEGP1 PE=1 SV=2
478	3021	Q9SUR0	129.94	75	75	6.03E8	14	13	28	N	17518	AT4G23670 protein OS=Arabidopsis thaliana OX=3702 GN=At4g23670 PE=2 SV=1
478	3022	A0A178URY2	129.94	75	75	6.03E8	14	13	28	N	17518	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g27430 PE=4 SV=1
989	1731	A0A178VL03	129.91	36	36	4.54E7	10	10	13	N	51750	Eukaryotic translation initiation factor 3 subunit E OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g51870 PE=3 SV=1
989	1732	Q9C5Z3	129.91	36	36	4.54E7	10	10	13	N	51750	Eukaryotic translation initiation factor 3 subunit E OS=Arabidopsis thaliana OX=3702 GN=TIF3E1 PE=1 SV=1
1291	3448	Q9SZ91	129.84	48	48	5.13E7	8	8	11	Y	35159	NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g09750 PE=2 SV=1
1291	3449	A0A178UV38	129.84	48	48	5.13E7	8	8	11	Y	35200	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g10930 PE=4 SV=1
1048	1307	A0A178VAY0	129.82	27	27	2.12E7	9	7	11	Y	59003	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g04550 PE=4 SV=1
1048	1308	Q9MAB3	129.82	27	27	2.12E7	9	7	11	Y	59003	Probable nucleolar protein 5-2 OS=Arabidopsis thaliana OX=3702 GN=NOP5-2 PE=1 SV=1
977	2010	Q9LM02	129.76	45	45	8.95E7	12	12	14	Y	38268	Cycloartenol-C-24-methyltransferase OS=Arabidopsis thaliana OX=3702 GN=SMT1 PE=1 SV=1
679	1600	A0A178VI18	129.54	42	42	1.11E8	15	15	21	N	45326	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g16280 PE=4 SV=1
679	1601	P82869	129.54	38	38	1.11E8	15	15	21	N	50483	Peptidyl-prolyl cis-trans isomerase CYP37, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CYP37 PE=1 SV=3
1219	1168	Q9FGM0	129.49	21	21	3.39E7	11	10	11	Y	88717	ATP-dependent zinc metalloprotease FTSH 11, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FTSH11 PE=1 SV=1
1219	1169	A0A178UR45	129.49	21	21	3.39E7	11	10	11	Y	88717	FTSH11 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g52110 PE=3 SV=1
933	2390	Q93VR3	129.44	33	33	1.2E8	9	9	16	Y	42759	GDP-mannose 3,5-epimerase OS=Arabidopsis thaliana OX=3702 GN=At5g28840 PE=1 SV=1
933	2391	A0A384LF84	129.44	33	33	1.2E8	9	9	16	Y	42759	GME OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g29330 PE=4 SV=1
933	2392	Q0WWW3	129.44	33	33	1.2E8	9	9	16	Y	42759	GDP-mannose 3',5'-epimerase OS=Arabidopsis thaliana OX=3702 GN=At5g28840 PE=2 SV=1
1115	1963	Q9MA79	129.33	35	35	3.58E7	8	8	12	Y	37287	Fructose-1,6-bisphosphatase, cytosolic OS=Arabidopsis thaliana OX=3702 GN=CYFBP PE=1 SV=1
1115	1964	A0A178WCE5	129.33	35	35	3.58E7	8	8	12	Y	37287	FINS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g39530 PE=3 SV=1
962	1537	P16127	129.29	49	49	1.59E8	13	13	14	Y	46270	Magnesium-chelatase subunit ChlI-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CHLI1 PE=1 SV=1
962	1538	A0A178UXM0	129.29	49	49	1.59E8	13	13	14	Y	46270	Mg-protoporphyrin IX chelatase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g21730 PE=3 SV=1
1063	2433	A0A178V006	129.25	31	31	3.94E7	8	8	10	Y	40419	RD19A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g44450 PE=3 SV=1
1063	2434	P43296	129.25	31	31	3.94E7	8	8	10	Y	40419	Cysteine protease RD19A OS=Arabidopsis thaliana OX=3702 GN=RD19A PE=1 SV=1
965	1319	Q9LIK0	129.11	24	24	3.64E7	9	9	10	Y	65131	Plastidial pyruvate kinase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PKP1 PE=1 SV=1
965	1320	A0A178VM70	129.11	24	24	3.64E7	9	9	10	Y	65127	Pyruvate kinase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g24740 PE=3 SV=1
1193	3115	A0A178UNQ5	129.06	42	42	6.92E7	9	9	11	Y	33125	GrpE protein homolog OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g54330 PE=3 SV=1
1193	3116	Q9FLP3	129.06	42	42	6.92E7	9	9	11	Y	33203	GrpE protein homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=Mge1 PE=2 SV=1
1204	3034	O80858	128.99	71	71	6.62E7	9	9	12	N	16936	Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g30930 PE=1 SV=1
1131	4550	P42760	128.80	51	51	6.23E7	7	7	11	N	23486	Glutathione S-transferase F6 OS=Arabidopsis thaliana OX=3702 GN=GSTF6 PE=2 SV=2
1131	4551	A0A178WN35	128.80	51	51	6.23E7	7	7	11	N	23486	GSTF6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g02130 PE=3 SV=1
923	3568	P82538	128.60	50	50	1.59E8	9	9	16	N	25623	PsbP-like protein 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPL1 PE=1 SV=1
923	3569	A0A178VEI8	128.60	50	50	1.59E8	9	9	16	N	25623	PPL1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g49920 PE=4 SV=1
963	2102	Q9T0K7	128.54	48	48	5.52E7	13	13	15	Y	46251	3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g13360 PE=1 SV=2
963	2101	A0A178UTL3	128.54	54	54	5.52E7	13	13	15	Y	41433	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g15150 PE=3 SV=1
739	1106	Q84WV1	128.44	32	32	7E7	13	13	18	Y	60340	T-complex protein 1 subunit gamma OS=Arabidopsis thaliana OX=3702 GN=CCT3 PE=1 SV=1
739	1107	A0A178UHF4	128.44	32	32	7E7	13	13	18	Y	60340	T-complex protein 1 subunit gamma OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g26390 PE=3 SV=1
1209	1370	Q94AQ8	128.35	42	42	6.21E7	9	9	11	Y	38006	Photosynthetic NDH subunit of subcomplex B 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PNSB2 PE=2 SV=1
853	1083	Q8LCW6	128.13	51	51	9.25E7	12	12	14	N	35907	Similar to late embryogenesis abundant proteins OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
853	1084	A0A178VUS5	128.13	51	51	9.25E7	12	12	14	N	36036	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g41600 PE=4 SV=1
853	1085	O80576	128.13	51	51	9.25E7	12	12	14	N	36036	At2g44060 OS=Arabidopsis thaliana OX=3702 GN=late embryogenesis abundant 26 PE=2 SV=1
723	2556	A0A178W1V2	128.11	49	49	5.02E7	9	3	20	Y	24425	Ribosomal protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g23540 PE=3 SV=1
723	2557	P59230	128.11	49	49	5.02E7	9	3	20	Y	24425	60S ribosomal protein L10a-2 OS=Arabidopsis thaliana OX=3702 GN=RPL10AB PE=1 SV=1
1326	3851	A0A178UP20	128.06	29	29	2.98E7	9	9	10	Y	68894	DGS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g12020 PE=4 SV=1
1326	3852	Q8GUK1	128.06	29	29	2.98E7	9	9	10	Y	68894	Protein DGS1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DGS1 PE=1 SV=1
1158	2861	A0A178VFQ5	127.99	42	42	1.48E8	9	9	12	N	27748	PSRP2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g46570 PE=4 SV=1
1158	2862	Q8VYM4	127.99	42	42	1.48E8	9	9	12	N	27748	30S ribosomal protein 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSRP2 PE=2 SV=1
1148	1265	Q9FXI5	127.79	21	21	2.15E7	10	10	11	Y	86882	Protein IQ-DOMAIN 32 OS=Arabidopsis thaliana OX=3702 GN=IQD32 PE=1 SV=3
1148	1266	A0A178WED9	127.79	21	21	2.15E7	10	10	11	Y	86882	Iqd32 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g20840 PE=4 SV=1
904	2750	Q8S8T4	127.74	37	37	2.92E6	10	3	16	Y	49945	UDP-glucuronic acid decarboxylase 4 OS=Arabidopsis thaliana OX=3702 GN=UXS4 PE=2 SV=1
904	2751	A0A178VT54	127.74	37	37	2.92E6	10	3	16	Y	49945	UXS4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g45440 PE=4 SV=1
904	2752	C0Z2I3	127.74	37	37	2.92E6	10	3	16	Y	50676	AT2G47650 protein OS=Arabidopsis thaliana OX=3702 GN=UXS4 PE=2 SV=1
699	1496	P92939	127.61	14	14	9.28E6	12	5	15	Y	116366	Calcium-transporting ATPase 1, endoplasmic reticulum-type OS=Arabidopsis thaliana OX=3702 GN=ECA1 PE=1 SV=2
844	2946	A0A178VDY8	127.55	77	77	4.58E6	10	2	17	Y	20404	ATARLA1C OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g44040 PE=3 SV=1
844	2947	Q8VY57	127.55	77	77	4.58E6	10	2	17	Y	20404	ADP-ribosylation factor-like protein 8a OS=Arabidopsis thaliana OX=3702 GN=ARL8A PE=2 SV=1
901	1558	Q43316	127.52	37	37	1.75E8	12	12	15	Y	41043	Porphobilinogen deaminase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HEMC PE=1 SV=1
935	3142	Q9SCK3	127.48	58	58	1.18E8	12	11	15	N	27982	Chloroplastic import inner membrane translocase subunit HP30-1 OS=Arabidopsis thaliana OX=3702 GN=HP30-1 PE=1 SV=1
935	3143	A0A178VH26	127.48	58	58	1.18E8	12	11	15	N	27982	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g43690 PE=4 SV=1
1000	2144	Q9FWR5	127.38	64	64	1.36E8	10	7	14	Y	29971	Gamma carbonic anhydrase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GAMMACA1 PE=1 SV=1
1000	2145	A0A178WHZ1	127.38	64	64	1.36E8	10	7	14	Y	29971	GAMMA CA1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g20550 PE=4 SV=1
552	3290	A0A384KMY9	127.21	46	46	4.63E8	11	11	23	N	15505	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g31240 PE=4 SV=1
552	3291	B9DHP0	127.21	46	46	4.63E8	11	11	23	N	15505	AT4G27090 protein OS=Arabidopsis thaliana OX=3702 GN=At4g27090 PE=2 SV=1
552	3292	Q9T043	127.21	46	46	4.63E8	11	11	23	N	15505	60S ribosomal protein L14-2 OS=Arabidopsis thaliana OX=3702 GN=RPL14B PE=1 SV=1
552	3295	A0A178UTG0	127.21	44	44	4.63E8	11	11	23	N	15862	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g31240 PE=4 SV=1
979	1610	Q9LZI2	127.17	39	39	5.55E6	9	2	15	Y	49971	UDP-glucuronic acid decarboxylase 2 OS=Arabidopsis thaliana OX=3702 GN=UXS2 PE=1 SV=1
979	1611	A0A178VKB0	127.17	39	39	5.55E6	9	2	15	Y	49971	UXS2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g57120 PE=4 SV=1
839	2024	Q01525	127.14	45	45	2.83E7	10	4	14	Y	29162	14-3-3-like protein GF14 omega OS=Arabidopsis thaliana OX=3702 GN=GRF2 PE=2 SV=2
839	2025	A0A178WBI7	127.14	45	45	2.83E7	10	4	14	Y	29178	GRF2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g72930 PE=3 SV=1
988	1463	Q9C5C2	127.14	33	33	4.54E7	12	9	14	Y	62732	Myrosinase 2 OS=Arabidopsis thaliana OX=3702 GN=TGG2 PE=1 SV=1
1173	1252	A0A178VYM2	127.12	41	41	3.02E7	9	9	12	Y	35275	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g27620 PE=3 SV=1
1173	1253	Q9SID0	127.12	41	41	3.02E7	9	9	12	Y	35275	Probable fructokinase-1 OS=Arabidopsis thaliana OX=3702 GN=At2g31390 PE=2 SV=1
992	4179	Q9FWS4	127.12	47	47	1.21E8	8	8	14	Y	16033	50S ribosomal protein L31, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPL31 PE=2 SV=1
992	4180	A0A178WG49	127.12	47	47	1.21E8	8	8	14	Y	16033	50S ribosomal protein L31 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g69800 PE=3 SV=1
752	3462	B9DFJ8	127.11	54	54	2.21E8	9	6	18	Y	16579	AT4G39260 protein OS=Arabidopsis thaliana OX=3702 GN=At4g39260 PE=2 SV=1
752	3463	Q03251	127.11	54	54	2.21E8	9	6	18	Y	16579	Glycine-rich RNA-binding protein 8 OS=Arabidopsis thaliana OX=3702 GN=RBG8 PE=1 SV=1
752	3464	A0A384L218	127.11	54	54	2.21E8	9	6	18	Y	16579	GRP8 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g44660 PE=4 SV=1
968	1524	Q8S3U9	127.08	15	15	2.62E7	9	9	10	Y	121902	Exocyst complex component SEC5A OS=Arabidopsis thaliana OX=3702 GN=SEC5A PE=1 SV=1
968	1525	A0A178WKT0	127.08	15	15	2.62E7	9	9	10	Y	121866	Exocyst complex component SEC5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g71350 PE=3 SV=1
465	2621	A0A178WF16	127.06	49	49	1.84E8	15	5	23	Y	24917	SAC52 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g14900 PE=4 SV=1
465	2622	Q93VT9	127.06	49	49	1.84E8	15	5	23	Y	24917	60S ribosomal protein L10-1 OS=Arabidopsis thaliana OX=3702 GN=RPL10A PE=1 SV=1
838	2046	Q9SZ11	127.04	21	21	9.9E7	14	14	17	Y	82562	Glycerophosphodiester phosphodiesterase GDPDL3 OS=Arabidopsis thaliana OX=3702 GN=GDPDL3 PE=2 SV=3
858	2511	Q38922	126.93	67	67	2.65E7	11	4	16	Y	23175	Ras-related protein RABB1b OS=Arabidopsis thaliana OX=3702 GN=RABB1B PE=2 SV=1
859	3119	Q8W471	126.78	22	22	2.1E7	10	6	14	Y	81466	Long-chain-fatty-acid--[acyl-carrier-protein] ligase AEE15, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AAE15 PE=1 SV=1
1149	3673	Q56Y53	126.62	21	21	2.26E7	9	9	9	Y	88464	Uncharacterized protein At3g11560 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At3g11560 PE=2 SV=1
1149	3675	A0A178VFF9	126.62	21	21	2.26E7	9	9	9	Y	89432	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g11490 PE=4 SV=1
1149	3679	Q9CAX2	126.62	21	21	2.26E7	9	9	9	Y	89394	Uncharacterized protein F24K9.23 OS=Arabidopsis thaliana OX=3702 GN=F24K9.23 PE=4 SV=1
1149	3688	A0A178VIP0	126.62	20	20	2.26E7	9	9	9	Y	93482	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g11490 PE=4 SV=1
1149	3700	Q8H0W4	126.62	19	19	2.26E7	9	9	9	Y	97795	AT3G11560 protein OS=Arabidopsis thaliana OX=3702 GN=At3g11560 PE=2 SV=1
728	1564	F4HRH4	126.56	18	18	1.08E7	12	6	16	Y	110231	Leucine-rich repeat transmembrane protein kinase OS=Arabidopsis thaliana OX=3702 GN=At1g53430 PE=1 SV=1
728	1565	C0LGG8	126.56	17	17	1.08E7	12	6	16	Y	114945	Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana OX=3702 GN=At1g53430 PE=1 SV=1
728	1566	A0A178WAA7	126.56	17	17	1.08E7	12	6	16	Y	114942	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g47760 PE=4 SV=1
1096	1925	Q8RWY6	126.54	9	9	1.79E7	8	8	9	N	158951	CLIP-associated protein OS=Arabidopsis thaliana OX=3702 GN=CLASP PE=1 SV=1
1096	1924	A0A178VPD0	126.54	9	9	1.79E7	8	8	9	N	158822	CLASP OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g15500 PE=4 SV=1
1146	3968	F4J3P1	126.48	56	56	4.54E8	7	7	11	Y	13406	Ribosomal protein L14p/L23e family protein OS=Arabidopsis thaliana OX=3702 GN=emb2171 PE=3 SV=1
1146	3947	O22686	126.48	45	45	4.54E8	7	7	11	Y	16998	F19P19.5 protein OS=Arabidopsis thaliana OX=3702 GN=F19P19.5 PE=3 SV=1
1146	3969	A0A384L7B8	126.48	50	50	4.54E8	7	7	11	Y	15027	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g03760 PE=3 SV=1
1146	3970	P49690	126.48	50	50	4.54E8	7	7	11	Y	15027	60S ribosomal protein L23 OS=Arabidopsis thaliana OX=3702 GN=RPL23A PE=2 SV=3
1146	3971	A0A178VEM4	126.48	50	50	4.54E8	7	7	11	Y	15027	At2g33370 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
616	2654	Q940I2	126.42	44	44	2.7E8	10	10	20	Y	37040	Thioredoxin family protein OS=Arabidopsis thaliana OX=3702 GN=MED24.18 PE=2 SV=1
616	2655	A0A178UFD7	126.42	44	44	2.7E8	10	10	20	Y	37040	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g03210 PE=4 SV=1
1343	2190	A0A178WMD1	126.41	42	42	3.92E7	8	8	9	Y	39872	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g30030 PE=3 SV=1
1343	2191	Q9C7N4	126.41	42	42	3.92E7	8	8	9	Y	39872	GDSL esterase/lipase At1g29670 OS=Arabidopsis thaliana OX=3702 GN=At1g29670 PE=2 SV=1
1343	2163	A0A1P8ASL8	126.41	35	35	3.92E7	8	8	9	Y	47730	GDSL-like Lipase/Acylhydrolase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g29670 PE=3 SV=1
953	1074	A0A178WGZ8	126.40	36	36	8.19E7	9	8	14	Y	36204	Annexin OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g36510 PE=3 SV=1
953	1075	Q9SYT0	126.40	36	36	8.19E7	9	8	14	Y	36204	Annexin D1 OS=Arabidopsis thaliana OX=3702 GN=ANN1 PE=1 SV=1
869	1848	Q9LIR4	126.28	33	33	6.1E7	11	11	11	Y	64914	Dihydroxy-acid dehydratase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DHAD PE=1 SV=1
869	1849	A0A178VEH1	126.28	33	33	6.1E7	11	11	11	Y	64914	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g25840 PE=3 SV=1
816	3208	Q0WVF7	126.17	26	26	3.42E7	12	7	16	Y	69567	P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g03060 PE=2 SV=1
683	2245	Q8VZF3	126.12	21	21	4.19E7	12	12	15	Y	106103	Probable glutamyl endopeptidase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GEP PE=2 SV=2
683	2246	A0A178VYA2	126.12	21	21	4.19E7	12	12	15	Y	106452	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g45150 PE=4 SV=1
776	2658	Q9LRX8	126.12	50	50	1.78E8	12	7	19	Y	23459	60S ribosomal protein L13a-2 OS=Arabidopsis thaliana OX=3702 GN=RPL13AB PE=2 SV=1
776	2659	A0A178V860	126.12	50	50	1.78E8	12	7	19	Y	23459	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g26870 PE=3 SV=1
1208	5380	Q9SVA6	126.01	36	36	6.13E7	9	9	11	Y	41144	Developmentally-regulated G-protein 3 OS=Arabidopsis thaliana OX=3702 GN=DRG3 PE=1 SV=1
1208	5381	A0A178UVT9	126.01	36	36	6.13E7	9	9	11	Y	41144	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g44900 PE=4 SV=1
898	4488	Q9S7L9	126.00	37	37	1.2E8	8	8	14	Y	21195	Cytochrome c oxidase subunit 6b-1 OS=Arabidopsis thaliana OX=3702 GN=COX6B-1 PE=1 SV=1
898	4489	A0A178WPQ4	126.00	37	37	1.2E8	8	8	14	Y	21195	COX6B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g23580 PE=4 SV=1
1015	2807	Q06327	125.97	20	20	2.96E7	12	12	13	Y	98045	Linoleate 9S-lipoxygenase 1 OS=Arabidopsis thaliana OX=3702 GN=LOX1 PE=1 SV=1
1015	2808	A0A178W151	125.97	20	20	2.96E7	12	12	13	Y	98033	Lipoxygenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g49480 PE=3 SV=1
627	1155	O23627	125.93	25	25	5.94E7	15	15	19	Y	81944	Glycine--tRNA ligase, mitochondrial 1 OS=Arabidopsis thaliana OX=3702 GN=At1g29880 PE=1 SV=1
560	2908	A0A178UYN8	125.91	48	48	6.29E7	10	3	21	Y	27948	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g41290 PE=3 SV=1
560	2909	Q42064	125.91	48	48	6.29E7	10	3	21	Y	27948	60S ribosomal protein L8-3 OS=Arabidopsis thaliana OX=3702 GN=RPL8C PE=2 SV=2
1004	2579	Q9ZU35	125.88	30	30	2.88E7	10	10	13	Y	78899	ABC transporter G family member 7 OS=Arabidopsis thaliana OX=3702 GN=ABCG7 PE=2 SV=1
1004	2580	A0A178VRW2	125.88	30	30	2.88E7	10	10	13	Y	78899	ABCG7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g00290 PE=4 SV=1
1004	2581	A0NAA8	125.88	30	30	2.88E7	10	10	13	Y	79100	ABC-2 type transporter family protein OS=Arabidopsis thaliana OX=3702 GN=ABCG7 PE=2 SV=1
1004	2582	A0A178VTF8	125.88	30	30	2.88E7	10	10	13	Y	79100	ABCG7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g00290 PE=4 SV=1
1004	2583	A0A178VSW5	125.88	30	30	2.88E7	10	10	13	Y	79172	ABCG7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g00290 PE=4 SV=1
1006	3550	Q5XF06	125.63	32	32	7.09E7	13	13	14	Y	53646	Mitochondrial import inner membrane translocase subunit TIM44-2 OS=Arabidopsis thaliana OX=3702 GN=TIM44-2 PE=1 SV=1
641	1212	C0LGT4	125.63	27	27	4.96E7	11	7	16	Y	67463	Leucine-rich repeat receptor-like protein kinase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=LRR-RLK PE=2 SV=1
641	1213	A0A384LF24	125.63	27	27	4.96E7	11	7	16	Y	67463	LRR1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g16200 PE=4 SV=1
641	1214	Q9FMD7	125.63	27	27	4.96E7	11	7	16	Y	67463	Probable inactive receptor kinase At5g16590 OS=Arabidopsis thaliana OX=3702 GN=At5g16590 PE=1 SV=1
892	4370	Q94K73	125.57	29	29	6.7E7	10	10	14	Y	49252	Phenylalanine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g58140 PE=1 SV=1
892	4371	A0A178V6D3	125.57	29	29	6.7E7	10	10	14	Y	49252	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g52700 PE=4 SV=1
828	721	A0A178WAY4	125.54	18	18	1.8E6	13	2	14	Y	136566	Coatomer subunit alpha OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g55270 PE=4 SV=1
828	722	Q94A40	125.54	18	18	1.8E6	13	2	14	Y	136566	Coatomer subunit alpha-1 OS=Arabidopsis thaliana OX=3702 GN=At1g62020 PE=2 SV=2
842	4409	Q93VH5	125.51	53	53	9.67E7	8	8	14	Y	31045	AT5g10730/MAJ23_90 OS=Arabidopsis thaliana OX=3702 GN=MAJ23.90 PE=2 SV=1
842	4410	A0A178UIN4	125.51	53	53	9.67E7	8	8	14	Y	31045	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g10380 PE=4 SV=1
842	4411	Q9FT59	125.51	50	50	9.67E7	8	8	14	Y	32663	Uncharacterized protein AT5g10730 OS=Arabidopsis thaliana OX=3702 GN=At5g10730 PE=4 SV=1
1302	4151	A0A178W7F2	125.49	40	40	1.36E8	8	8	11	N	23170	TOM20-2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g27820 PE=4 SV=1
1302	4152	P82873	125.49	40	40	1.36E8	8	8	11	N	23170	Mitochondrial import receptor subunit TOM20-2 OS=Arabidopsis thaliana OX=3702 GN=TOM20-2 PE=1 SV=2
1156	1979	A0A178V0L0	125.44	26	26	6.64E7	8	8	12	Y	53846	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g28730 PE=3 SV=1
1156	1980	Q9SZX3	125.44	26	26	6.64E7	8	8	12	Y	53846	Argininosuccinate synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At4g24830 PE=1 SV=3
606	2128	P56798	125.37	52	52	2.23E8	11	11	17	Y	25188	30S ribosomal protein S3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rps3 PE=3 SV=1
606	2129	A0A1B1W4X6	125.37	52	52	2.23E8	11	11	17	Y	25188	30S ribosomal protein S3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rps3 PE=3 SV=1
1297	2839	A0A178WM36	125.32	68	68	4.29E7	9	9	11	Y	18350	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g19100 PE=4 SV=1
1297	2840	Q9LE22	125.32	68	68	4.29E7	9	9	11	Y	18350	Probable calcium-binding protein CML27 OS=Arabidopsis thaliana OX=3702 GN=CML27 PE=1 SV=1
1099	4153	Q9SEU8	125.24	58	58	1.35E8	8	8	12	Y	20312	Thioredoxin M2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TRXM2 PE=1 SV=2
1099	4154	A0A178V0B8	125.24	58	58	1.35E8	8	8	12	Y	20298	ATHM2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g04460 PE=4 SV=1
1166	5106	Q9LI77	125.16	29	29	2.91E7	10	10	11	Y	57181	Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GATA PE=2 SV=1
1269	5062	A0A178W3P2	125.15	50	50	5.98E7	8	8	10	Y	40746	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g15490 PE=3 SV=1
1269	5063	Q8VYI4	125.15	50	50	5.98E7	8	8	10	Y	40746	Aspartate-semialdehyde dehydrogenase, putative OS=Arabidopsis thaliana OX=3702 GN=At1g14810 PE=2 SV=1
1078	1058	F4HQR5	125.09	30	30	2.11E7	11	4	13	Y	59999	Protein phosphatase 2A subunit A3 OS=Arabidopsis thaliana OX=3702 GN=PP2AA3 PE=1 SV=1
1078	1059	Q38951	125.09	27	27	2.11E7	11	4	13	Y	65517	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A gamma isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA3 PE=1 SV=2
810	1749	A0A178V9J1	125.08	45	45	4.71E6	12	2	14	Y	35842	RACK1C_AT OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g19190 PE=4 SV=1
810	1750	Q9LV28	125.08	45	45	4.71E6	12	2	14	Y	35828	Receptor for activated C kinase 1C OS=Arabidopsis thaliana OX=3702 GN=RACK1C PE=1 SV=1
1139	3704	A0A178VTY4	124.86	43	43	6.48E7	7	5	11	Y	30212	Chlorophyll a-b binding protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g37140 PE=3 SV=1
1139	3705	Q9S7W1	124.86	43	43	6.48E7	7	5	11	Y	30212	Chlorophyll a-b binding protein CP29.3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LHCB4.3 PE=2 SV=1
902	1151	Q9SYP2	124.85	29	29	1.98E7	13	6	14	Y	67119	Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha 1 OS=Arabidopsis thaliana OX=3702 GN=PFP-ALPHA1 PE=2 SV=1
902	1152	A0A178WMV9	124.85	29	29	1.98E7	13	6	14	Y	67119	Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha OS=Arabidopsis thaliana OX=3702 GN=PFP-ALPHA PE=3 SV=1
1107	11905	Q9SKT7	124.85	27	27	4.25E7	10	9	13	Y	65372	External alternative NAD(P)H-ubiquinone oxidoreductase B4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDB4 PE=1 SV=1
1107	11906	A0A178VT71	124.85	27	27	4.25E7	10	9	13	Y	65371	NDB4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g16200 PE=4 SV=1
760	3247	A0A178WRI5	124.70	38	38	2.14E8	11	11	19	N	30142	RPL4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g06940 PE=3 SV=1
760	3248	Q2V4Q4	124.70	38	38	2.14E8	11	11	19	N	30142	AT1G07320 protein OS=Arabidopsis thaliana OX=3702 GN=RPL4 PE=2 SV=1
760	3251	Q3EDH2	124.70	38	38	2.14E8	11	11	19	N	30414	Ribosomal protein L4 OS=Arabidopsis thaliana OX=3702 GN=RPL4 PE=3 SV=1
760	3252	O50061	124.70	38	38	2.14E8	11	11	19	N	30559	50S ribosomal protein L4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPL4 PE=2 SV=2
760	3253	Q0WW46	124.70	38	38	2.14E8	11	11	19	N	30559	Uncharacterized protein At1g07320 OS=Arabidopsis thaliana OX=3702 GN=At1g07320 PE=2 SV=1
760	3254	A0A384KN11	124.70	38	38	2.14E8	11	11	19	N	30559	RPL4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g06940 PE=3 SV=1
1001	1304	Q9SFU6	124.69	8	8	1.7E7	12	8	12	Y	217085	Callose synthase 9 OS=Arabidopsis thaliana OX=3702 GN=CALS9 PE=2 SV=2
1001	1305	A0A384KXN3	124.69	8	8	1.7E7	12	8	12	Y	217377	GSL10 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g07070 PE=4 SV=1
1001	1306	A0A178V7F9	124.69	8	8	1.7E7	12	8	12	Y	217377	Glucan synthase-like 10 OS=Arabidopsis thaliana OX=3702 GN=GSL10 PE=4 SV=1
1201	4276	P32962	124.60	33	33	6.71E6	7	3	11	Y	37153	Nitrilase 2 OS=Arabidopsis thaliana OX=3702 GN=NIT2 PE=1 SV=1
1201	4277	A0A384LD03	124.60	33	33	6.71E6	7	3	11	Y	37153	NIT2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g37900 PE=4 SV=1
1201	4279	Q1LYZ1	124.60	33	33	6.71E6	7	3	11	Y	37153	At3g44300 OS=Arabidopsis thaliana OX=3702 GN=At3g44300 PE=2 SV=1
785	285	Q9SJT9	124.59	16	16	7.29E6	14	3	15	Y	136467	Coatomer subunit alpha-2 OS=Arabidopsis thaliana OX=3702 GN=At2g21390 PE=2 SV=1
785	286	A0A178VW28	124.59	16	16	7.29E6	14	3	15	Y	136501	Coatomer subunit alpha OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g16870 PE=4 SV=1
1168	2160	Q9LIK9	124.59	33	33	1.03E8	11	11	11	N	51459	ATP sulfurylase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APS1 PE=1 SV=1
1168	2161	A0A178VCV2	124.59	33	33	1.03E8	11	11	11	N	51459	APS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g24660 PE=4 SV=1
829	2060	A0A384KB73	124.54	43	43	1.39E8	11	11	16	N	29059	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g53280 PE=4 SV=1
829	2061	Q9XGM1	124.54	43	43	1.39E8	11	11	16	N	29059	V-type proton ATPase subunit D OS=Arabidopsis thaliana OX=3702 GN=VHA-D PE=1 SV=2
829	2062	Q0WWD3	124.54	43	43	1.39E8	11	11	16	N	29059	Vacuolar-type H+-ATPase (V-ATPase) subunit D OS=Arabidopsis thaliana OX=3702 GN=At3g58730 PE=2 SV=1
1068	4985	A0A178USU5	124.53	63	63	2.92E8	8	8	13	Y	15084	CB5-E OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g52520 PE=3 SV=1
1068	4986	Q42342	124.53	63	63	2.92E8	8	8	13	Y	15084	Cytochrome b5 isoform E OS=Arabidopsis thaliana OX=3702 GN=CYTB5-E PE=1 SV=2
788	3238	Q9LU85	124.44	48	48	1.31E8	11	11	16	Y	27163	Probable plastid-lipid-associated protein 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PAP4 PE=1 SV=1
1159	2637	A0A178UCV4	124.38	30	30	1.24E8	9	9	12	Y	45927	PCB2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g18460 PE=4 SV=1
1159	2638	Q1H537	124.38	30	30	1.24E8	9	9	12	Y	45893	Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DVR PE=1 SV=1
1267	2319	Q9M8M7	124.20	43	43	3.25E7	10	10	10	Y	48827	Acetylornithine aminotransferase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=WIN1 PE=1 SV=1
1267	2320	A0A178WEJ5	124.20	43	43	3.25E7	10	10	10	Y	48781	WIN1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g75450 PE=3 SV=1
994	4635	A0A178U8E7	124.07	31	31	1.83E8	5	5	11	N	29505	VDAC4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g56740 PE=4 SV=1
994	4636	Q9FKM2	124.07	31	31	1.83E8	5	5	11	N	29505	Mitochondrial outer membrane protein porin 4 OS=Arabidopsis thaliana OX=3702 GN=VDAC4 PE=1 SV=1
1130	3938	Q9S795	123.99	31	31	2.79E7	8	7	11	Y	54432	Betaine aldehyde dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ALDH10A8 PE=2 SV=1
1130	3939	A0A178W4Y2	123.99	31	31	2.79E7	8	7	11	Y	54432	ALDH10A8 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g69310 PE=3 SV=1
856	2776	A0A178UQS9	123.94	62	62	2.19E8	9	9	16	Y	23425	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g40900 PE=4 SV=1
856	2438	Q8H0Y1	123.94	62	62	2.19E8	9	9	16	Y	23411	Outer envelope pore protein 24B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OEP24B PE=2 SV=1
917	3482	A0A178W4J8	123.90	54	54	3.66E7	9	4	15	Y	22980	RABG3E OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g43460 PE=4 SV=1
917	3483	Q9XI98	123.90	54	54	3.66E7	9	4	15	Y	22980	Ras-related protein RABG3e OS=Arabidopsis thaliana OX=3702 GN=RABG3E PE=2 SV=1
1025	3385	Q38814	123.87	32	32	1.05E8	7	7	13	Y	36664	Thiamine thiazole synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=THI1 PE=1 SV=1
1025	3386	A0A178UNL2	123.87	32	32	1.05E8	7	7	13	Y	36664	Thiamine thiazole synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=THI1 PE=3 SV=1
1171	2051	A0A178UQT1	123.85	25	25	2.46E7	10	10	11	N	72299	Exocyst subunit Exo70 family protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g02810 PE=3 SV=1
1171	2052	Q9LZD3	123.85	25	25	2.46E7	10	10	11	N	72299	Exocyst complex component EXO70A1 OS=Arabidopsis thaliana OX=3702 GN=EXO70A1 PE=1 SV=1
1171	2055	F4KGM7	123.85	24	24	2.46E7	10	10	11	N	75675	Exocyst subunit Exo70 family protein OS=Arabidopsis thaliana OX=3702 GN=EXO70A1 PE=3 SV=1
1085	1451	Q949P2	123.62	21	21	9.42E6	8	3	9	Y	79044	Probable cytosolic oligopeptidase A OS=Arabidopsis thaliana OX=3702 GN=CYOP PE=1 SV=1
1085	1452	A0A178UD97	123.62	21	21	9.42E6	8	3	9	Y	79044	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g10200 PE=3 SV=1
1167	1526	Q9FJ95	123.59	42	42	5.34E7	9	9	11	Y	39256	Sorbitol dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=SDH PE=1 SV=1
1167	1527	A0A178UB81	123.59	42	42	5.34E7	9	9	11	Y	39256	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g50840 PE=3 SV=1
876	1218	Q9SV20	123.53	15	15	3.7E7	9	9	11	Y	106078	Coatomer subunit beta-2 OS=Arabidopsis thaliana OX=3702 GN=At4g31490 PE=2 SV=2
876	1219	A0A178V1V6	123.53	15	15	3.7E7	9	9	11	Y	106078	Coatomer subunit beta OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g36080 PE=4 SV=1
876	1332	Q9SV21	123.53	15	15	3.7E7	9	9	11	Y	106145	Coatomer subunit beta-1 OS=Arabidopsis thaliana OX=3702 GN=At4g31480 PE=3 SV=2
876	1333	A0A1P8B4C2	123.53	14	14	3.7E7	9	9	11	Y	108809	Coatomer subunit beta OS=Arabidopsis thaliana OX=3702 GN=At4g31480 PE=4 SV=1
756	3089	Q8RWT4	123.47	42	42	5.62E7	15	13	19	Y	45780	Ribosomal protein L1p/L10e family OS=Arabidopsis thaliana OX=3702 GN=At2g42710 PE=2 SV=1
756	3090	A0A178VQC0	123.47	42	42	5.62E7	15	13	19	Y	45780	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g40100 PE=4 SV=1
1292	2852	A0A178UUI2	123.26	56	56	2.82E7	9	6	11	Y	22751	RABG3A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g10900 PE=4 SV=1
1292	2853	Q948K8	123.26	56	56	2.82E7	9	6	11	Y	22751	Ras-related protein RABG3a OS=Arabidopsis thaliana OX=3702 GN=RABG3A PE=2 SV=1
1292	2854	F4JKR7	123.26	55	55	2.82E7	9	6	11	Y	23368	RAB GTPase homolog G3A OS=Arabidopsis thaliana OX=3702 GN=RABG3A PE=4 SV=1
1292	2855	F4JKR6	123.26	53	53	2.82E7	9	6	11	Y	24024	RAB GTPase homolog G3A OS=Arabidopsis thaliana OX=3702 GN=RABG3A PE=4 SV=1
1482	3535	Q8RXN0	123.18	15	15	7.15E7	7	6	8	Y	78412	ABC transporter G family member 11 OS=Arabidopsis thaliana OX=3702 GN=ABCG11 PE=1 SV=1
1482	3536	A0A178WKJ6	123.18	15	15	7.15E7	7	6	8	Y	78412	WBC11 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g18740 PE=4 SV=1
1108	1905	A0A178UY42	123.12	26	26	5.28E7	11	11	11	Y	67545	QUA3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g00920 PE=4 SV=1
1108	1906	Q93W95	123.12	26	26	5.28E7	11	11	11	Y	67555	Probable methyltransferase PMT13 OS=Arabidopsis thaliana OX=3702 GN=At4g00740 PE=2 SV=1
758	1711	Q9LHH7	123.10	46	46	7.63E7	10	10	16	Y	31590	Bifunctional protein FolD 2 OS=Arabidopsis thaliana OX=3702 GN=FOLD2 PE=2 SV=1
758	1712	A0A178VD60	123.10	46	46	7.63E7	10	10	16	Y	31567	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g12320 PE=3 SV=1
951	4049	A0A178US34	123.06	29	29	1.02E8	8	8	11	Y	41323	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g12240 PE=4 SV=1
951	4050	Q94CJ5	123.06	29	29	1.02E8	8	8	11	Y	41323	Protein RETICULATA-RELATED 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RER4 PE=2 SV=1
697	3356	Q56XI5	123.03	27	27	2.06E8	10	10	18	Y	47835	Cysteine proteinase RD21A OS=Arabidopsis thaliana OX=3702 GN=At1g47128 PE=2 SV=1
697	3357	Q94BX1	123.03	25	25	2.06E8	10	10	18	Y	50996	F2G19.31/F2G19.31 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
697	3358	P43297	123.03	25	25	2.06E8	10	10	18	Y	50966	Cysteine proteinase RD21A OS=Arabidopsis thaliana OX=3702 GN=RD21A PE=1 SV=1
697	3359	A0A178WIH7	123.03	25	25	2.06E8	10	10	18	Y	50966	RD21A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g41130 PE=3 SV=1
1190	1045	A0A178V8H5	123.00	15	15	1.48E7	8	8	8	Y	96411	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g08520 PE=4 SV=1
1190	1317	F4IYK3	123.00	15	15	1.48E7	8	8	8	Y	96473	ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g08943 PE=1 SV=2
1190	1100	A0A178VBV4	123.00	15	15	1.48E7	8	8	8	Y	96623	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g08530 PE=4 SV=1
938	4477	A0A2P2CLF0	122.92	40	40	3.57E8	8	8	15	Y	29685	Cytochrome c oxidase subunit 2 OS=Arabidopsis thaliana OX=3702 GN=cox2 PE=3 SV=2
688	4079	A0A178VXV5	122.85	27	27	5.7E7	9	3	18	Y	30481	PIP2B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g33960 PE=3 SV=1
688	4080	P43287	122.85	27	27	5.7E7	9	3	18	Y	30453	Aquaporin PIP2-2 OS=Arabidopsis thaliana OX=3702 GN=PIP2-2 PE=1 SV=2
688	4083	A0A1P8AYA1	122.85	23	23	5.7E7	9	3	18	Y	35411	Plasma membrane intrinsic protein 2 OS=Arabidopsis thaliana OX=3702 GN=PIP2B PE=3 SV=1
763	2393	A0A178UH95	122.80	29	29	5.14E7	15	15	16	Y	100407	Emb2746 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g62980 PE=4 SV=1
763	2394	Q84W56	122.80	29	29	5.14E7	15	15	16	Y	100554	Ribonuclease J OS=Arabidopsis thaliana OX=3702 GN=RNJ PE=1 SV=1
918	2242	A0A178WGD0	122.79	40	40	6.53E7	9	9	12	Y	37410	ZKT OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g50090 PE=4 SV=1
918	2243	Q94BS2	122.79	40	40	6.53E7	9	9	12	Y	37410	Protein MET1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MET1 PE=1 SV=1
1197	6674	A0A178UJR3	122.64	24	24	5.97E7	8	8	10	Y	49438	GFA2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g46550 PE=3 SV=1
1197	6675	Q8GWW8	122.64	24	24	5.97E7	8	8	10	Y	49438	Chaperone protein dnaJ GFA2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GFA2 PE=2 SV=1
537	2923	Q93W22	122.46	50	50	2.95E7	13	3	20	Y	24929	60S ribosomal protein L10-3 OS=Arabidopsis thaliana OX=3702 GN=RPL10C PE=2 SV=1
537	2924	A0A178W7N6	122.46	50	50	2.95E7	13	3	20	Y	24929	SAG24 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g60330 PE=4 SV=1
922	2997	Q93Y31	122.44	74	74	9.8E6	10	2	16	Y	20404	ADP-ribosylation factor-like protein 8b OS=Arabidopsis thaliana OX=3702 GN=ARL8B PE=2 SV=1
922	2998	A0A178UPH6	122.44	74	74	9.8E6	10	2	16	Y	20404	ATARLA1D OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g67670 PE=3 SV=1
732	3643	B3LF87	122.43	67	67	1.48E8	12	8	20	Y	25132	At1g30230 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
732	3644	P48006	122.43	67	67	1.48E8	12	8	20	Y	25132	Elongation factor 1-delta 1 OS=Arabidopsis thaliana OX=3702 GN=At1g30230 PE=1 SV=2
732	3645	A8MRC4	122.43	59	59	1.48E8	12	8	20	Y	28777	Translation elongation factor EF1B/ribosomal protein S6 family protein OS=Arabidopsis thaliana OX=3702 GN=eEF-1Bb1 PE=1 SV=1
1370	3005	Q94JQ4	122.43	49	49	1.61E8	7	7	9	N	19816	Reactive Intermediate Deaminase A, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RIDA PE=1 SV=1
1370	3006	A0A1I9LS34	122.43	36	36	1.61E8	7	7	9	N	27800	Endoribonuclease L-PSP family protein OS=Arabidopsis thaliana OX=3702 GN=RidA PE=4 SV=1
991	4266	O48528	122.40	64	64	1.51E8	8	8	12	Y	16999	Outer envelope pore protein 16-3, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OEP163 PE=1 SV=1
991	4267	A0A178W2E8	122.40	64	64	1.51E8	8	8	12	Y	16999	OEP16-3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g39520 PE=4 SV=1
1634	4224	Q9LSV0	122.35	35	35	4.94E7	7	7	8	N	30692	Glyoxylate/succinic semialdehyde reductase 1 OS=Arabidopsis thaliana OX=3702 GN=GLYR1 PE=1 SV=1
1634	4225	A0A178VK60	122.35	35	35	4.94E7	7	7	8	N	30692	GR1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g27480 PE=4 SV=1
1016	2822	A0A178VKC8	122.31	31	31	4.78E7	10	10	12	Y	44914	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g13310 PE=4 SV=1
1016	2823	Q9LK57	122.31	31	31	4.78E7	10	10	12	Y	44928	Pentatricopeptide repeat-containing protein At3g13160, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g13160 PE=1 SV=1
973	3923	A0A178VCS9	122.26	44	44	1.86E8	8	8	11	N	18880	TCTP OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g17520 PE=3 SV=1
973	3922	P31265	122.26	44	44	1.86E8	8	8	11	N	18910	Translationally-controlled tumor protein 1 OS=Arabidopsis thaliana OX=3702 GN=TCTP1 PE=1 SV=2
1077	1652	Q94JQ3	122.23	34	34	4.3E7	11	11	11	Y	57983	Serine hydroxymethyltransferase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SHM3 PE=1 SV=2
1077	1653	A0A178UTK1	122.23	34	34	4.3E7	11	11	11	Y	57983	Serine hydroxymethyltransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g37310 PE=3 SV=1
1198	5102	Q9LSW8	122.21	60	60	3.72E7	8	8	10	Y	27400	Electron transfer flavoprotein subunit beta, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ETFB PE=1 SV=1
1198	5103	A0A1R7T3K7	122.21	54	54	3.72E7	8	8	10	Y	31015	Electron transfer flavoprotein beta OS=Arabidopsis thaliana OX=3702 GN=ETFBETA PE=4 SV=1
1022	2282	A0A178UDW2	122.17	45	45	1.21E8	8	3	12	Y	27976	GRF6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g10110 PE=3 SV=1
1022	2283	P48349	122.17	45	45	1.21E8	8	3	12	Y	27976	14-3-3-like protein GF14 lambda OS=Arabidopsis thaliana OX=3702 GN=GRF6 PE=1 SV=1
1022	2747	F4KGV2	122.17	46	46	1.21E8	8	3	12	Y	27718	G-box regulating factor 6 OS=Arabidopsis thaliana OX=3702 GN=GRF6 PE=3 SV=1
1022	2748	F4KGV5	122.17	43	43	1.21E8	8	3	12	Y	29131	G-box regulating factor 6 OS=Arabidopsis thaliana OX=3702 GN=GRF6 PE=3 SV=1
818	2803	A0A178VFT9	122.16	45	45	1.21E8	11	11	17	Y	29707	RPL15 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g28030 PE=3 SV=1
818	2804	P25873	122.16	45	45	1.21E8	11	11	17	Y	29707	50S ribosomal protein L15, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPL15 PE=1 SV=2
864	3242	A0A178V0L6	122.14	47	47	4.81E7	8	3	16	Y	21974	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g11720 PE=4 SV=1
864	3243	Q9SZX9	122.14	47	47	4.81E7	8	3	16	Y	21974	60S ribosomal protein L9-2 OS=Arabidopsis thaliana OX=3702 GN=RPL9D PE=2 SV=1
970	5335	Q9LUW6	122.11	19	19	1.17E7	8	4	12	Y	63609	DEAD-box ATP-dependent RNA helicase 9, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RH9 PE=1 SV=1
970	5334	A0A178VE40	122.11	19	19	1.17E7	8	4	12	Y	63580	PMH1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g24010 PE=4 SV=1
1135	5587	A8MRD7	122.09	36	36	1.1E8	5	2	11	Y	19316	Rubredoxin-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g15640 PE=4 SV=1
1135	5589	A0A178VCD0	122.09	36	36	1.1E8	5	2	11	Y	19416	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g16420 PE=4 SV=1
1135	5590	Q9LW15	122.09	36	36	1.1E8	5	2	11	Y	19416	Cytochrome c oxidase subunit 5b-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COX5B-1 PE=1 SV=1
718	2021	A0A178UDC3	122.01	32	32	5.44E7	13	12	16	Y	56651	Glucose-1-phosphate adenylyltransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g46810 PE=3 SV=1
718	2022	P55228	122.01	32	32	5.44E7	13	12	16	Y	56651	Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APS1 PE=2 SV=2
952	747	P50546	121.91	15	15	4.89E7	9	9	13	Y	121059	DNA-directed RNA polymerase subunit beta OS=Arabidopsis thaliana OX=3702 GN=rpoB PE=3 SV=4
952	748	A0A1B1W4T9	121.91	15	15	4.89E7	9	9	13	Y	121059	DNA-directed RNA polymerase subunit beta OS=Arabidopsis thaliana OX=3702 GN=rpoB PE=3 SV=1
952	749	A0A178W0J6	121.91	15	15	4.89E7	9	9	13	Y	121705	DNA-directed RNA polymerase subunit beta OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g10990 PE=3 SV=1
875	579	F4JLM5	121.89	18	18	3.31E7	11	11	13	Y	135484	Isoleucine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g10320 PE=2 SV=1
912	1542	A0A178UVT6	121.89	12	12	2.58E7	12	12	12	Y	152367	TPP2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g24180 PE=4 SV=1
912	1543	F4JVN6	121.89	12	12	2.58E7	12	12	12	Y	152367	Tripeptidyl-peptidase 2 OS=Arabidopsis thaliana OX=3702 GN=TPP2 PE=1 SV=1
1231	1916	A0A178WLX2	121.85	24	24	2.42E7	9	7	11	Y	51486	ENO1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g68380 PE=3 SV=1
1231	1917	Q9C9C4	121.85	24	24	2.42E7	9	7	11	Y	51475	Enolase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ENO1 PE=1 SV=1
721	1944	A0A178VLR0	121.84	19	19	1.79E7	10	2	20	Y	68078	Transmembrane 9 superfamily member OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g00990 PE=3 SV=1
721	1945	Q9ZPS7	121.84	19	19	1.79E7	10	2	20	Y	68049	Transmembrane 9 superfamily member 3 OS=Arabidopsis thaliana OX=3702 GN=TMN3 PE=2 SV=1
931	2185	P92963	121.80	59	59	4.61E7	11	4	15	Y	23164	Ras-related protein RABB1c OS=Arabidopsis thaliana OX=3702 GN=RABB1C PE=1 SV=1
931	2186	A0A178V4V1	121.80	59	59	4.61E7	11	4	15	Y	23164	RABB1C OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g20220 PE=4 SV=1
1042	2981	Q9ZUA0	121.69	25	25	7.33E7	7	7	12	N	52219	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1B OS=Arabidopsis thaliana OX=3702 GN=OST1B PE=1 SV=1
879	3011	P27323	121.65	15	15	1.15E7	9	3	13	Y	80636	Heat shock protein 90-1 OS=Arabidopsis thaliana OX=3702 GN=HSP90-1 PE=1 SV=3
879	3096	A0A178UIU1	121.65	14	14	1.15E7	9	3	13	Y	81150	HSP90.1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g51520 PE=3 SV=1
1188	2224	Q9SQT8	121.58	27	27	3.32E7	11	11	11	Y	65796	Bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=EMB3004 PE=1 SV=1
1188	2225	A0A178VBC4	121.58	27	27	3.32E7	11	11	11	Y	65796	MEE32 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g06080 PE=3 SV=1
1542	2407	Q9FWQ6	121.55	22	22	3.12E7	8	8	8	N	64140	F17F16.7 protein OS=Arabidopsis thaliana OX=3702 GN=F17F16.7 PE=4 SV=1
1542	2408	A0A178WDD3	121.55	22	22	3.12E7	8	8	8	N	65697	HCF173 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g17490 PE=4 SV=1
1542	2409	Q8W4D6	121.55	22	22	3.12E7	8	8	8	N	65709	High chlorophyll fluorescence phenotype 173 OS=Arabidopsis thaliana OX=3702 GN=F17F16.7 PE=2 SV=1
1542	2410	A0A1P8AWU9	121.55	20	20	3.12E7	8	8	8	N	69416	High chlorophyll fluorescence phenotype 173 OS=Arabidopsis thaliana OX=3702 GN=HCF173 PE=4 SV=1
1542	2602	A0A1P8AWY1	121.55	23	23	3.12E7	8	8	8	N	61830	High chlorophyll fluorescence phenotype 173 OS=Arabidopsis thaliana OX=3702 GN=HCF173 PE=4 SV=1
1278	5562	Q9C6I6	121.55	32	32	5.88E7	7	7	10	Y	38408	Electron transfer flavoprotein subunit alpha, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ETFA PE=1 SV=1
1278	5563	A0A178WJP1	121.55	32	32	5.88E7	7	7	10	Y	38408	ETFALPHA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g45120 PE=4 SV=1
1246	4239	A0A178V810	121.53	34	34	3.69E6	9	4	10	N	50317	FTSZ2-2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g47180 PE=3 SV=1
1246	4240	Q9LXJ0	121.53	34	34	3.69E6	9	4	10	N	50317	Cell division protein FtsZ homolog 2-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FTSZ2-2 PE=1 SV=1
813	2918	A0A178UHV6	121.50	68	68	1.57E8	9	9	17	N	13568	SCP2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g40810 PE=4 SV=1
813	2919	Q9FMN0	121.50	68	68	1.57E8	9	9	17	N	13568	Sterol carrier protein 2 OS=Arabidopsis thaliana OX=3702 GN=SCP2 PE=2 SV=1
862	6025	Q8LPJ7	121.44	51	51	2.47E7	7	2	14	Y	14841	40S ribosomal protein S26-2 OS=Arabidopsis thaliana OX=3702 GN=RPS26B PE=2 SV=2
862	6026	A0A178VTX1	121.44	51	51	2.47E7	7	2	14	Y	14841	40S ribosomal protein S26 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g37620 PE=3 SV=1
1007	3194	A0A178UIJ4	121.44	18	18	3.1E7	9	9	9	Y	74157	PDAT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g13060 PE=4 SV=1
1007	3195	Q9FNA9	121.44	18	18	3.1E7	9	9	9	Y	74157	Phospholipid:diacylglycerol acyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=PDAT1 PE=2 SV=1
1492	5765	O23299	121.39	44	44	6.94E7	7	7	9	Y	25773	Enoyl-CoA delta isomerase 2, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=ECI2 PE=1 SV=1
1492	5766	A0A178UV55	121.39	44	44	6.94E7	7	7	9	Y	25773	PEC12 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g16650 PE=4 SV=1
734	3296	A0A384KT69	121.37	49	49	3.63E8	9	9	20	Y	17545	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g23910 PE=3 SV=1
734	3297	P34788	121.37	49	49	3.63E8	9	9	20	Y	17545	40S ribosomal protein S18 OS=Arabidopsis thaliana OX=3702 GN=RPS18A PE=1 SV=1
734	3298	Q5PNZ9	121.37	49	49	3.63E8	9	9	20	Y	17545	At1g22780 OS=Arabidopsis thaliana OX=3702 GN=PFL PE=2 SV=1
1089	3551	A0A1P8B1L4	121.31	47	47	9.12E7	9	9	13	Y	34494	Annexin 4 OS=Arabidopsis thaliana OX=3702 GN=ANNAT4 PE=4 SV=1
1089	3552	A0A178VQU4	121.31	45	45	9.12E7	9	9	13	Y	36221	ANNAT4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g35630 PE=4 SV=1
1089	3553	Q9ZVJ6	121.31	45	45	9.12E7	9	9	13	Y	36221	Annexin D4 OS=Arabidopsis thaliana OX=3702 GN=ANN4 PE=1 SV=1
1019	1548	Q8S4Y1	121.30	37	37	3.59E7	10	10	14	Y	41412	Acetyl-CoA acetyltransferase, cytosolic 1 OS=Arabidopsis thaliana OX=3702 GN=AAT1 PE=1 SV=1
1019	1549	B9DGQ1	121.30	37	37	3.59E7	10	10	14	Y	41412	AT5G48230 protein OS=Arabidopsis thaliana OX=3702 GN=At5g48230 PE=2 SV=1
1019	1550	A0A384LBS2	121.30	37	37	3.59E7	10	10	14	Y	41412	EMB1276 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g46760 PE=3 SV=1
967	1162	Q9FXT6	121.30	32	32	5.79E7	10	10	14	N	55595	Peroxisomal membrane protein PEX14 OS=Arabidopsis thaliana OX=3702 GN=PEX14 PE=1 SV=2
967	1210	A0A178UTA0	121.30	32	32	5.79E7	10	10	14	N	55495	PEX14 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g62350 PE=4 SV=1
662	1427	Q8S9L5	121.14	29	29	7.5E7	14	14	16	Y	61734	Trigger factor-like protein TIG, Chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIG PE=1 SV=1
1380	59315	Q9FGM9	121.12	40	40	6.06E7	7	7	8	N	23468	23.5 kDa heat shock protein, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HSP23.5 PE=2 SV=1
751	4953	A0A178WPH9	120.85	40	40	4.04E8	8	8	17	Y	18653	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g09530 PE=4 SV=1
751	4954	Q43291	120.85	40	40	4.04E8	8	8	17	Y	18653	60S ribosomal protein L21-1 OS=Arabidopsis thaliana OX=3702 GN=RPL21A PE=2 SV=2
751	4955	Q0WSS0	120.85	40	40	4.04E8	8	8	17	Y	18709	Uncharacterized protein At1g57860 OS=Arabidopsis thaliana OX=3702 GN=At1g57860 PE=2 SV=1
751	4956	Q9FDZ9	120.85	40	40	4.04E8	8	8	17	Y	18709	60S ribosomal protein L21-2 OS=Arabidopsis thaliana OX=3702 GN=RPL21E PE=2 SV=1
751	4957	A0A384L8G9	120.85	40	40	4.04E8	8	8	17	Y	18709	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g51890 PE=4 SV=1
751	5483	A0A178WMH8	120.85	40	40	4.04E8	8	8	17	Y	18747	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g51700 PE=4 SV=1
1079	3901	A0A178V593	120.81	11	11	1.15E7	9	9	11	N	135266	PGP2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g29950 PE=4 SV=1
1079	3904	Q8LPK2	120.81	11	11	1.15E7	9	9	11	N	139909	ABC transporter B family member 2 OS=Arabidopsis thaliana OX=3702 GN=ABCB2 PE=1 SV=3
981	2277	O22886	120.79	32	32	4.6E7	8	8	13	Y	43580	Uroporphyrinogen decarboxylase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HEME2 PE=2 SV=1
981	2278	A0A178VZD6	120.79	32	32	4.6E7	8	8	13	Y	43580	Uroporphyrinogen decarboxylase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g37600 PE=3 SV=1
908	2301	A0A178VQL0	120.79	37	37	9.44E7	9	9	13	Y	30471	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g31000 PE=4 SV=1
908	2302	Q8H124	120.79	37	37	9.44E7	9	9	13	Y	30471	Uncharacterized protein At2g34460, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g34460 PE=1 SV=1
1153	1828	Q941L0	120.72	11	11	3.03E7	8	8	9	Y	119682	Cellulose synthase A catalytic subunit 3 [UDP-forming] OS=Arabidopsis thaliana OX=3702 GN=CESA3 PE=1 SV=2
1153	1829	W8Q6G0	120.72	11	11	3.03E7	8	8	9	Y	119682	Cellulose synthase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT5G05170 PE=2 SV=1
1153	1830	A0A384K963	120.72	11	11	3.03E7	8	8	9	Y	119682	Cellulose synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g04640 PE=3 SV=1
920	1967	A0A178VI68	120.72	47	47	2.97E7	9	3	16	Y	27986	GAMMA CAL2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g42820 PE=4 SV=1
920	1968	Q9SMN1	120.72	47	47	2.97E7	9	3	16	Y	27956	Gamma carbonic anhydrase-like 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GAMMACAL2 PE=1 SV=1
823	4648	Q8LAA6	120.69	32	32	4.61E7	8	2	15	Y	30647	Probable aquaporin PIP1-5 OS=Arabidopsis thaliana OX=3702 GN=PIP1-5 PE=1 SV=2
823	4649	A0A178V129	120.69	32	32	4.61E7	8	2	15	Y	30647	PIP1D OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g27100 PE=3 SV=1
795	4993	Q94BY3	120.68	53	53	4.37E8	8	8	17	N	21105	Translocon-associated protein subunit beta OS=Arabidopsis thaliana OX=3702 GN=MUA22.2 PE=2 SV=1
795	4994	A0A178UED6	120.68	53	53	4.37E8	8	8	17	N	21105	Translocon-associated protein subunit beta OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g13480 PE=3 SV=1
946	1678	Q00218	120.68	35	35	3.76E7	11	9	11	Y	56149	Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DHS2 PE=2 SV=2
946	1679	A0A178US70	120.68	35	35	3.76E7	11	9	11	Y	56149	Phospho-2-dehydro-3-deoxyheptonate aldolase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g38330 PE=3 SV=1
946	1680	Q8LAR5	120.68	35	35	3.76E7	11	9	11	Y	56090	Phospho-2-dehydro-3-deoxyheptonate aldolase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1585	4229	A0A178WFT4	120.60	54	54	2.52E7	6	6	7	N	17830	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g23820 PE=4 SV=1
1585	4233	F4I2Z0	120.60	39	39	2.52E7	6	6	7	N	23812	Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g22700 PE=4 SV=1
1585	4234	A0A178WFE2	120.60	28	28	2.52E7	6	6	7	N	33066	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g23820 PE=4 SV=1
1585	4235	B9DHG0	120.60	28	28	2.52E7	6	6	7	N	33662	Tetratricopeptide repeat domain-containing protein PYG7, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PYG7 PE=1 SV=1
847	5266	Q9SMW7	120.53	42	42	1.18E8	6	5	17	N	17946	Basic transcription factor 3 OS=Arabidopsis thaliana OX=3702 GN=BTF3 PE=1 SV=1
847	5265	A0A178W6R8	120.53	44	44	1.18E8	6	5	17	N	16945	Nascent polypeptide-associated complex subunit beta OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g18780 PE=3 SV=1
847	5267	A0A178W5W3	120.53	42	42	1.18E8	6	5	17	N	17976	Nascent polypeptide-associated complex subunit beta OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g18780 PE=3 SV=1
610	1675	P56786	120.49	9	9	2.99E7	14	14	14	Y	269564	Protein Ycf2 OS=Arabidopsis thaliana OX=3702 GN=ycf2-A PE=3 SV=1
610	1676	A0A1B1W513	120.49	9	9	2.99E7	14	14	14	Y	269564	Protein Ycf2 OS=Arabidopsis thaliana OX=3702 GN=ycf2 PE=3 SV=1
836	5061	P94072	120.45	42	42	2.77E8	6	6	17	Y	21836	Germin-like protein subfamily 3 member 3 OS=Arabidopsis thaliana OX=3702 GN=GER3 PE=1 SV=1
836	5060	A0A178UHR1	120.45	42	42	2.77E8	6	6	17	Y	21863	GLP3B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g20590 PE=3 SV=1
1250	1972	O24653	120.43	35	35	1.94E7	9	4	11	Y	49539	Guanosine nucleotide diphosphate dissociation inhibitor 2 OS=Arabidopsis thaliana OX=3702 GN=GDI2 PE=2 SV=1
1250	1973	A0A178VFJ4	120.43	35	35	1.94E7	9	4	11	Y	49539	Guanosine nucleotide diphosphate dissociation inhibitor OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g54320 PE=3 SV=1
1049	3321	A0A178UFS6	120.41	22	22	2.47E7	10	5	12	Y	70992	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g16570 PE=4 SV=1
1049	3322	Q8RXI0	120.41	22	22	2.47E7	10	5	12	Y	70992	AAA-type ATPase family protein OS=Arabidopsis thaliana OX=3702 GN=At5g16930 PE=2 SV=1
1073	2358	P55229	120.26	30	30	3.59E7	11	9	11	Y	57674	Glucose-1-phosphate adenylyltransferase large subunit 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ADG2 PE=1 SV=3
1073	2359	A0A178UL90	120.26	30	30	3.59E7	11	9	11	Y	57689	Glucose-1-phosphate adenylyltransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g19100 PE=3 SV=1
1295	3140	Q9LTV6	120.25	33	33	1.13E8	6	6	8	Y	31796	Peroxisomal 2,4-dienoyl-CoA reductase OS=Arabidopsis thaliana OX=3702 GN=At3g12800 PE=2 SV=1
1295	3141	Q0WMN4	120.25	33	33	1.13E8	6	6	8	Y	31796	Uncharacterized protein At3g12790 OS=Arabidopsis thaliana OX=3702 GN=At3g12790 PE=2 SV=1
787	1552	A0A178UKV3	120.24	35	35	2.4E7	10	10	11	Y	51629	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g27380 PE=4 SV=1
787	1553	Q39230	120.24	35	35	2.4E7	10	10	11	Y	51629	Serine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At5g27470 PE=1 SV=1
806	1614	Q9C4Z6	120.24	46	46	1.6E6	12	2	14	Y	35801	Receptor for activated C kinase 1B OS=Arabidopsis thaliana OX=3702 GN=RACK1B PE=1 SV=1
806	1615	A0A178W908	120.24	46	46	1.6E6	12	2	14	Y	35801	RACK1B_AT OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g42750 PE=4 SV=1
535	2989	A0A384L4E5	120.23	27	27	1.92E8	11	11	24	Y	52068	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g29620 PE=3 SV=1
535	2990	O80774	120.23	27	27	1.92E8	11	11	24	Y	52097	AT2G34250 protein OS=Arabidopsis thaliana OX=3702 GN=At2g34250 PE=2 SV=1
535	2991	Q8LB07	120.23	27	27	1.92E8	11	11	24	Y	52231	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
535	2992	Q9LP58	120.23	27	27	1.92E8	11	11	24	Y	52171	Uncharacterized protein F28N24.2 OS=Arabidopsis thaliana OX=3702 GN=F28N24.2 PE=3 SV=1
535	2993	A0A384LBY8	120.23	27	27	1.92E8	11	11	24	Y	52097	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g30740 PE=3 SV=1
535	2994	Q8RWJ5	120.23	27	27	1.92E8	11	11	24	Y	52068	SecY protein transport family protein OS=Arabidopsis thaliana OX=3702 GN=At1g29310 PE=2 SV=1
1046	4771	Q9FE58	120.22	52	52	7.6E7	9	2	14	Y	14047	60S ribosomal protein L22-3 OS=Arabidopsis thaliana OX=3702 GN=RPL22C PE=2 SV=1
1046	4772	A0A384KYC5	120.22	52	52	7.6E7	9	2	14	Y	14047	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g27750 PE=4 SV=1
1046	4773	Q0WRH6	120.22	52	52	7.6E7	9	2	14	Y	14047	60S ribosomal protein L22-like OS=Arabidopsis thaliana OX=3702 GN=At5g27770 PE=2 SV=1
890	1056	Q9SYM5	120.17	20	20	1.09E7	9	5	10	N	75372	Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 OS=Arabidopsis thaliana OX=3702 GN=RHM1 PE=1 SV=1
890	1057	A0A178W4U5	120.17	20	20	1.09E7	9	5	10	N	75372	ROL1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g73220 PE=4 SV=1
1121	4769	A0A178VBH7	119.99	52	52	1.04E8	9	2	13	Y	14018	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g05130 PE=4 SV=1
1121	4770	Q9M9W1	119.99	52	52	1.04E8	9	2	13	Y	14018	60S ribosomal protein L22-2 OS=Arabidopsis thaliana OX=3702 GN=RPL22B PE=2 SV=1
1280	3649	A0A178UMN9	119.97	63	63	8.95E6	7	2	11	N	14812	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g13280 PE=4 SV=1
1280	3650	Q6ICZ8	119.97	43	43	8.95E6	7	2	11	N	22057	Nascent polypeptide-associated complex subunit alpha-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=At5g13850 PE=1 SV=1
1537	4002	Q94KI8	119.95	17	17	9.34E7	7	7	8	Y	84873	Two pore calcium channel protein 1 OS=Arabidopsis thaliana OX=3702 GN=TPC1 PE=1 SV=1
1537	4003	B9DFD5	119.95	17	17	9.34E7	7	7	8	Y	84873	AT4G03560 protein OS=Arabidopsis thaliana OX=3702 GN=At4g03560 PE=2 SV=1
1217	4601	A0A178VB37	119.91	41	41	7.63E7	6	3	11	N	15828	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g01250 PE=4 SV=1
1217	4602	Q9SGA6	119.91	41	41	7.63E7	6	3	11	N	15828	40S ribosomal protein S19-1 OS=Arabidopsis thaliana OX=3702 GN=RPS19A PE=2 SV=1
1062	2047	A0A384LKD1	119.82	18	18	1.62E7	10	7	11	Y	70406	RLK902 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g18890 PE=4 SV=1
1062	2048	Q9LVI6	119.82	18	18	1.62E7	10	7	11	Y	70406	Probable inactive receptor kinase RLK902 OS=Arabidopsis thaliana OX=3702 GN=RLK902 PE=1 SV=1
1062	2049	C0LGN3	119.82	18	18	1.62E7	10	7	11	Y	70406	Leucine-rich repeat receptor-like protein kinase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=LRR-RLK PE=2 SV=1
1240	5607	O64471	119.80	25	25	6.5E7	6	6	10	Y	35854	Mitochondrial outer membrane import complex protein METAXIN OS=Arabidopsis thaliana OX=3702 GN=MTX1 PE=1 SV=1
1240	5608	A0A178VY14	119.80	25	25	6.5E7	6	6	10	Y	35854	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g14450 PE=4 SV=1
1320	2568	Q8VZF1	119.77	19	19	4.95E8	6	6	9	Y	62956	Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=AAE7 PE=1 SV=1
944	1302	Q9XES1	119.76	11	11	9.85E6	9	2	11	N	116180	Calcium-transporting ATPase 4, endoplasmic reticulum-type OS=Arabidopsis thaliana OX=3702 GN=ECA4 PE=2 SV=2
944	1400	A0A178WA53	119.76	11	11	9.85E6	9	2	11	N	116217	ECA4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g07320 PE=3 SV=1
944	1303	A0A076	119.76	11	11	9.85E6	9	2	11	N	116241	Endomembrane Ca2+ ATPase 4 OS=Arabidopsis thaliana OX=3702 GN=ECA4 PE=2 SV=1
1329	1153	A0A178VF09	119.72	22	22	3.71E7	8	8	9	N	64212	PDIL1-3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g49500 PE=4 SV=1
1329	1154	Q8VX13	119.72	22	22	3.71E7	8	8	9	N	64212	Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana OX=3702 GN=PDIL1-3 PE=2 SV=1
840	3262	P93014	119.64	39	39	2.27E8	9	9	14	Y	32645	30S ribosomal protein S5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rps5 PE=2 SV=1
840	3263	A0A178VN84	119.64	39	39	2.27E8	9	9	14	Y	32655	EMB3113 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g30320 PE=3 SV=1
1345	2005	A0A178UWR2	119.61	20	20	2.32E7	8	8	10	Y	76766	NADPH--cytochrome P450 reductase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g28410 PE=3 SV=1
1345	2006	Q9SB48	119.61	20	20	2.32E7	8	8	10	Y	76766	NADPH--cytochrome P450 reductase 1 OS=Arabidopsis thaliana OX=3702 GN=ATR1 PE=1 SV=1
997	5026	Q84W12	119.57	85	85	2.36E8	6	6	14	Y	11345	At4g16450 OS=Arabidopsis thaliana OX=3702 GN=At4g16450 PE=1 SV=1
1076	1820	A0A178VVH6	119.56	44	44	6.54E7	11	11	13	Y	42794	STL2P OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g00450 PE=4 SV=1
1076	1821	Q39221	119.56	44	44	6.54E7	11	11	13	Y	42794	SEC12-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=STL2P PE=1 SV=4
1516	4196	A0A178UXR8	119.55	54	54	7.14E7	8	8	9	Y	23260	Peptidylprolyl isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g45090 PE=4 SV=1
1516	4197	Q9SCY3	119.55	54	54	7.14E7	8	8	9	Y	23260	Photosynthetic NDH subunit of lumenal location 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PNSL4 PE=1 SV=1
1017	1459	Q9S7B5	119.51	30	30	8.9E7	11	11	13	Y	57777	Threonine synthase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TS1 PE=1 SV=1
771	2427	A0A178UAG6	119.41	33	33	3.32E7	13	12	15	Y	63466	OVA3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g63640 PE=3 SV=1
771	2428	Q9FEA2	119.41	33	33	3.32E7	13	12	15	Y	63466	Glutamate--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA3 PE=1 SV=1
1136	2450	A0A178VHQ7	119.41	12	12	2.75E7	8	8	11	N	119803	EDD1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g42130 PE=3 SV=1
1136	2451	Q8L785	119.41	12	12	2.75E7	8	8	11	N	119773	Glycine--tRNA ligase, chloroplastic/mitochondrial 2 OS=Arabidopsis thaliana OX=3702 GN=EDD1 PE=1 SV=1
1136	2452	A0A178VJS7	119.41	12	12	2.75E7	8	8	11	N	123154	EDD1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g42130 PE=3 SV=1
1113	2386	O23264	119.39	27	27	5.88E7	7	6	12	N	54057	Selenium-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=SBP1 PE=1 SV=1
866	3443	Q9SIE7	119.39	48	48	1.91E8	6	5	16	Y	20130	PLAT domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=PLAT2 PE=2 SV=1
1464	2041	Q70DU8	119.34	25	25	3.93E7	8	8	9	Y	53159	Aldehyde dehydrogenase family 3 member H1 OS=Arabidopsis thaliana OX=3702 GN=ALDH3H1 PE=1 SV=2
1464	2042	A0A178W2A3	119.34	25	25	3.93E7	8	8	9	Y	53159	Aldehyde dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g40220 PE=3 SV=1
1268	1857	P46309	119.34	32	32	9.72E7	10	10	11	Y	58562	Glutamate--cysteine ligase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GSH1 PE=1 SV=2
1268	1855	A0A178UZL7	119.34	32	32	9.72E7	10	10	11	Y	58543	RML1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g26780 PE=4 SV=1
1632	2641	Q9FLP0	119.29	18	18	1.01E7	7	5	7	Y	65785	65-kDa microtubule-associated protein 1 OS=Arabidopsis thaliana OX=3702 GN=MAP65-1 PE=1 SV=1
1632	2642	A0A178UKF6	119.29	18	18	1.01E7	7	5	7	Y	65785	MAP65-1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g54360 PE=4 SV=1
872	2312	O80448	119.19	39	39	6.92E7	10	6	16	Y	32862	Pyridoxal 5'-phosphate synthase subunit PDX1.1 OS=Arabidopsis thaliana OX=3702 GN=PDX11 PE=1 SV=1
872	2313	A0A178VZ00	119.19	39	39	6.92E7	10	6	16	Y	32862	PDX1.1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g35080 PE=3 SV=1
1296	1554	Q8H0W0	119.14	37	37	2.27E7	9	9	10	Y	40029	Protein LOW PSII ACCUMULATION 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LPA3 PE=1 SV=1
1296	1555	A0A178W661	119.14	37	37	2.27E7	9	9	10	Y	40029	LPA3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g67250 PE=4 SV=1
695	4948	Q9ZRW8	119.08	51	51	2.09E8	13	11	19	N	25651	Glutathione S-transferase U19 OS=Arabidopsis thaliana OX=3702 GN=GSTU19 PE=1 SV=1
695	4949	A0A178W4K6	119.08	51	51	2.09E8	13	11	19	N	25651	GSTU19 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g73020 PE=4 SV=1
1271	3107	Q9FM77	118.95	35	35	1.32E8	8	8	9	Y	36056	Isopentenyl-diphosphate delta-isomerase OS=Arabidopsis thaliana OX=3702 GN=MDF20.5 PE=2 SV=1
1629	5622	O64767	118.78	25	25	3.73E7	8	8	8	Y	59471	AICARFT/IMPCHase bienzyme family protein OS=Arabidopsis thaliana OX=3702 GN=At2g35040 PE=3 SV=1
1629	5623	Q8RWT5	118.78	23	23	3.73E7	8	8	8	Y	64907	AICARFT/IMPCHase bienzyme family protein OS=Arabidopsis thaliana OX=3702 GN=At2g35040 PE=1 SV=1
1629	5624	A0A178VXL4	118.78	23	23	3.73E7	8	8	8	Y	64934	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g31620 PE=3 SV=1
942	6999	Q8LD46	118.76	42	42	3.5E8	10	10	14	N	17441	60S ribosomal protein L23a-1 OS=Arabidopsis thaliana OX=3702 GN=RPL23AA PE=2 SV=2
942	7000	A0A178VSK4	118.76	42	42	3.5E8	10	10	14	N	17441	RPL23AA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g36400 PE=3 SV=1
942	6998	A8MS83	118.76	43	43	3.5E8	10	10	14	N	16744	Ribosomal protein L23AB OS=Arabidopsis thaliana OX=3702 GN=RPL23AB PE=3 SV=1
942	7001	Q9M3C3	118.76	42	42	3.5E8	10	10	14	N	17396	60S ribosomal protein L23a-2 OS=Arabidopsis thaliana OX=3702 GN=RPL23AB PE=2 SV=1
942	7002	A0A178VJM6	118.76	42	42	3.5E8	10	10	14	N	17428	RPL23AB OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g49870 PE=3 SV=1
1005	1865	A0A178ULV9	118.70	32	32	1.63E8	10	10	12	Y	45110	RPS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g30380 PE=4 SV=1
1005	1866	Q93VC7	118.70	32	32	1.63E8	10	10	12	Y	45110	30S ribosomal protein S1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPS1 PE=1 SV=1
1293	2781	Q9FYQ8	118.70	16	16	1.96E7	8	4	9	Y	74579	Transmembrane 9 superfamily member 11 OS=Arabidopsis thaliana OX=3702 GN=TMN11 PE=2 SV=1
1293	2782	A0A178UDT0	118.70	16	16	1.96E7	8	4	9	Y	74579	Transmembrane 9 superfamily member OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g31320 PE=3 SV=1
1181	4093	O80845	118.69	42	42	1.69E8	7	6	11	Y	25944	Peroxisomal membrane protein 11D OS=Arabidopsis thaliana OX=3702 GN=PEX11D PE=1 SV=2
1181	4127	A0A178VS94	118.69	42	42	1.69E8	7	6	11	Y	25931	PEX11D OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g43350 PE=4 SV=1
905	2228	B9DH49	118.63	48	48	8.27E7	9	9	13	Y	28630	AT3G56650 protein OS=Arabidopsis thaliana OX=3702 GN=At3g56650 PE=2 SV=1
905	2229	A0A384KSV2	118.63	48	48	8.27E7	9	9	13	Y	28630	PPD6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g51250 PE=4 SV=1
905	2230	Q9LXX5	118.63	48	48	8.27E7	9	9	13	Y	28630	PsbP domain-containing protein 6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPD6 PE=1 SV=1
764	1782	Q9SHJ6	118.53	49	49	1.13E8	11	11	17	Y	36119	Peroxisomal and mitochondrial division factor 2 OS=Arabidopsis thaliana OX=3702 GN=PMD2 PE=1 SV=1
1458	1595	Q9SHI1	118.46	15	15	2.02E7	8	8	9	Y	109747	Translation initiation factor IF-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g17220 PE=2 SV=2
1312	2595	Q8LPF1	118.39	18	18	2.84E7	8	8	8	N	75298	Pentatricopeptide repeat-containing protein At5g15980, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g15980 PE=2 SV=1
1288	5184	A0A178WMJ1	118.33	55	55	6.28E7	7	6	11	N	18004	Nascent polypeptide-associated complex subunit beta OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g67460 PE=3 SV=1
1288	5185	Q9CAT7	118.33	55	55	6.28E7	7	6	11	N	18004	Nascent polypeptide-associated complex subunit beta OS=Arabidopsis thaliana OX=3702 GN=At1g73230 PE=2 SV=1
846	5591	Q9ZV07	118.09	34	34	1.17E8	8	6	15	Y	31050	Probable aquaporin PIP2-6 OS=Arabidopsis thaliana OX=3702 GN=PIP2-6 PE=1 SV=1
846	5592	A0A178VZ30	118.09	34	34	1.17E8	8	6	15	Y	31050	PIP2E OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g35930 PE=3 SV=1
1071	2260	P0C896	117.99	24	24	4.56E7	11	11	12	Y	63838	Pentatricopeptide repeat-containing protein At3g02650, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g02650 PE=2 SV=1
1071	2518	A0A178V6E5	117.99	24	24	4.56E7	11	11	12	Y	63848	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g01910 PE=4 SV=1
1081	3426	A0A178U6Z5	117.89	38	38	3.13E7	9	4	12	Y	38134	AT-AER OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g16610 PE=4 SV=1
1081	3427	Q39172	117.89	38	38	3.13E7	9	4	12	Y	38134	NADPH-dependent oxidoreductase 2-alkenal reductase OS=Arabidopsis thaliana OX=3702 GN=AER PE=1 SV=1
854	1772	Q9LV77	117.86	33	33	4.41E7	10	10	13	Y	65030	Asparagine synthetase [glutamine-hydrolyzing] 2 OS=Arabidopsis thaliana OX=3702 GN=ASN2 PE=2 SV=1
854	1773	A0A178U7S3	117.86	33	33	4.41E7	10	10	13	Y	65030	ASN2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g64730 PE=4 SV=1
1043	2610	Q9LS94	117.80	51	51	1.88E7	8	3	14	Y	23102	Ras-related protein RABG3f OS=Arabidopsis thaliana OX=3702 GN=RABG3F PE=1 SV=1
1043	2611	A0A178VI56	117.80	51	51	1.88E7	8	3	14	Y	23102	RABG3F OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g20010 PE=4 SV=1
1152	875	Q38950	117.62	25	25	7.42E6	10	3	12	Y	65598	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA2 PE=1 SV=2
1152	876	A0A178VIW5	117.62	25	25	7.42E6	10	3	12	Y	65598	PR 65 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g27840 PE=4 SV=1
1061	7612	Q9LYK9	117.61	51	51	6.9E6	7	3	12	Y	14628	40S ribosomal protein S26-3 OS=Arabidopsis thaliana OX=3702 GN=RPS26C PE=2 SV=1
1061	7613	A0A178VFW7	117.61	51	51	6.9E6	7	3	12	Y	14628	40S ribosomal protein S26 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g50970 PE=3 SV=1
873	4868	A0A178WB84	117.60	77	77	2.53E8	6	6	14	N	15813	SDH6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g08310 PE=4 SV=1
873	4869	Q941A6	117.60	77	77	2.53E8	6	6	14	N	15813	Succinate dehydrogenase subunit 6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SDH6 PE=1 SV=1
1195	2476	Q9ZVA4	117.46	23	23	4.33E7	8	8	11	Y	49051	EP1-like glycoprotein 3 OS=Arabidopsis thaliana OX=3702 GN=At1g78850 PE=1 SV=1
1195	2477	A0A178WJI0	117.46	23	23	4.33E7	8	8	11	Y	49051	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g73520 PE=4 SV=1
1402	3706	O49499	117.42	41	41	3.06E7	8	8	9	Y	29155	Caffeoyl-CoA O-methyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=CCOAOMT1 PE=1 SV=1
1402	3707	A0A178V7A4	117.42	41	41	3.06E7	8	8	9	Y	29155	CCoAOMT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g38960 PE=4 SV=1
1402	3714	A0A1P8B3H0	117.42	37	37	3.06E7	8	8	9	Y	32473	S-adenosyl-L-methionine-dependent methyltransferases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=CCoAOMT1 PE=1 SV=1
835	1180	A0A384K9F3	117.39	22	22	3.83E7	10	6	13	Y	67752	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g02170 PE=4 SV=1
835	1181	Q9M8T0	117.39	22	22	3.83E7	10	6	13	Y	67752	Probable inactive receptor kinase At3g02880 OS=Arabidopsis thaliana OX=3702 GN=At3g02880 PE=1 SV=1
835	1182	C0LGM6	117.39	22	22	3.83E7	10	6	13	Y	67752	Leucine-rich repeat receptor-like protein kinase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=LRR-RLK PE=2 SV=1
916	1025	A0A178WIF0	117.25	24	24	2.63E7	9	6	14	Y	65494	REGA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g26290 PE=4 SV=1
916	1026	Q38845	117.25	24	24	2.63E7	9	6	14	Y	65494	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA1 PE=1 SV=1
1279	3577	F4K0T6	117.18	22	22	5.57E7	6	6	7	N	56400	Ethylene-dependent gravitropism-deficient and yellow-green-like 2 OS=Arabidopsis thaliana OX=3702 GN=EGY2 PE=4 SV=1
1279	3580	F4K0T7	117.18	22	22	5.57E7	6	6	7	N	56802	Ethylene-dependent gravitropism-deficient and yellow-green-like 2 OS=Arabidopsis thaliana OX=3702 GN=EGY2 PE=4 SV=1
1279	3592	Q9FFK3	117.18	21	21	5.57E7	6	6	7	N	60064	Probable zinc metalloprotease EGY2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=EGY2 PE=3 SV=1
1371	2721	F4I035	117.14	22	22	2.79E6	8	3	9	Y	52407	RNA 3'-terminal phosphate cyclase/enolpyruvate transferase, alpha/beta OS=Arabidopsis thaliana OX=3702 GN=At1g48860 PE=3 SV=1
1371	2722	Q9FVP6	117.14	21	21	2.79E6	8	3	9	Y	55831	3-phosphoshikimate 1-carboxyvinyltransferase OS=Arabidopsis thaliana OX=3702 GN=F27K7.11 PE=2 SV=1
1408	5769	Q9FIC2	117.13	13	13	9.45E6	6	6	7	N	102367	Emb\|CAB71880.1 OS=Arabidopsis thaliana OX=3702 GN=MYH9.5 PE=4 SV=1
1408	5770	A0A178URI8	117.13	13	13	9.45E6	6	6	7	N	102367	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g09400 PE=4 SV=1
1133	3338	A0A178UHL8	117.13	48	48	5.82E7	6	2	10	N	21796	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g53580 PE=4 SV=1
1133	3339	Q9LSQ5	117.13	48	48	5.82E7	6	2	10	N	21796	NAD(P)H dehydrogenase (quinone) FQR1 OS=Arabidopsis thaliana OX=3702 GN=FQR1 PE=1 SV=1
709	4593	Q04613	117.10	52	52	6.27E8	10	10	17	Y	21693	ATP synthase protein MI25 OS=Arabidopsis thaliana OX=3702 GN=AtMg00640 PE=1 SV=2
709	4594	A0A2P2CLH9	117.10	52	52	6.27E8	10	10	17	Y	21708	ATPase subunit 4 OS=Arabidopsis thaliana OX=3702 GN=atp4 PE=4 SV=1
1029	4599	P49211	117.09	51	51	1.8E8	8	4	12	Y	15503	60S ribosomal protein L32-1 OS=Arabidopsis thaliana OX=3702 GN=RPL32A PE=2 SV=2
1029	4600	A0A178V453	117.09	51	51	1.8E8	8	4	12	Y	15503	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g21240 PE=4 SV=1
943	2971	A0A178UAR1	117.00	19	19	4.93E8	11	8	12	Y	89180	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g02110 PE=4 SV=1
943	2972	A0A178U917	117.00	19	19	4.93E8	11	8	12	Y	91837	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g02110 PE=4 SV=1
943	2973	Q8VZM7	117.00	19	19	4.93E8	11	8	12	Y	92138	Putative ion channel POLLUX-like 1 OS=Arabidopsis thaliana OX=3702 GN=At5g02940 PE=2 SV=1
943	2974	A0A178U957	117.00	18	18	4.93E8	11	8	12	Y	94751	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g02110 PE=4 SV=1
943	2975	A0A1P8BF77	117.00	18	18	4.93E8	11	8	12	Y	94821	Ion channel POLLUX-like protein, putative (DUF1012) OS=Arabidopsis thaliana OX=3702 GN=At5g02940 PE=4 SV=1
943	3668	Q56W42	117.00	32	32	4.93E8	11	8	12	Y	54336	Uncharacterized protein At5g02940 OS=Arabidopsis thaliana OX=3702 GN=At5g02940 PE=2 SV=1
1050	5134	Q9C8K2	116.97	22	22	3.67E7	11	10	12	Y	76451	ABC transporter G family member 12 OS=Arabidopsis thaliana OX=3702 GN=ABCG12 PE=1 SV=1
1050	5135	A0A178W3S0	116.97	22	22	3.67E7	11	10	12	Y	76451	WBC12 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g45700 PE=4 SV=1
1640	4464	A0A178VSZ4	116.97	41	41	1.17E8	6	6	7	Y	21191	TO1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g31580 PE=4 SV=1
1640	4465	O64764	116.97	41	41	1.17E8	6	6	7	Y	21191	Thioredoxin O1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g35010 PE=1 SV=1
1142	2020	Q9ZPW5	116.82	16	16	1.63E7	8	5	9	Y	71195	AAA-type ATPase family protein OS=Arabidopsis thaliana OX=3702 GN=At2g18330 PE=2 SV=2
794	4691	A0A178UKA0	116.72	25	25	1.7E8	7	7	16	Y	59992	DIT2.1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g63890 PE=4 SV=1
794	4692	Q9FMF7	116.72	25	25	1.7E8	7	7	16	Y	59992	Dicarboxylate transporter 2.1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DIT2-1 PE=1 SV=1
1123	4778	A0A178WF34	116.59	37	37	2.38E8	4	4	12	N	18835	PSB27 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g02870 PE=3 SV=1
1123	4779	Q9LR64	116.59	37	37	2.38E8	4	4	12	N	18835	Photosystem II repair protein PSB27-H1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSB27-1 PE=1 SV=1
1119	4756	A0A1B1W4Y0	116.54	54	54	1.25E8	7	7	12	N	13582	50S ribosomal protein L14, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rpl14 PE=3 SV=1
1119	4757	P56792	116.54	54	54	1.25E8	7	7	12	N	13582	50S ribosomal protein L14, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rpl14 PE=3 SV=1
1221	2930	F4K4Q2	116.53	11	11	2.68E7	7	7	7	Y	143390	tRNA synthetase class I (I, L, M and V) family protein OS=Arabidopsis thaliana OX=3702 GN=OVA2 PE=3 SV=1
982	2813	A0A178WM97	116.50	58	58	2.33E7	7	2	12	Y	21986	SAR1B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g51020 PE=3 SV=1
982	2814	Q01474	116.50	58	58	2.33E7	7	2	12	Y	21986	GTP-binding protein SAR1B OS=Arabidopsis thaliana OX=3702 GN=SAR1B PE=1 SV=1
1366	1863	A0A384KJ83	116.48	25	25	2.41E7	7	7	8	Y	46785	Eukaryotic translation initiation factor 3 subunit M OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g01390 PE=1 SV=1
1366	1864	Q8W4A0	116.48	25	25	2.41E7	7	7	8	Y	46785	Eukaryotic translation initiation factor 3 subunit M OS=Arabidopsis thaliana OX=3702 GN=F14P3.15 PE=1 SV=1
1366	2231	F4J2B4	116.48	29	29	2.41E7	7	7	8	Y	41157	Proteasome component (PCI) domain protein OS=Arabidopsis thaliana OX=3702 GN=At3g02200 PE=1 SV=1
1366	2232	Q9S7B6	116.48	26	26	2.41E7	7	7	8	Y	44409	F1C9.1 protein OS=Arabidopsis thaliana OX=3702 GN=F1C9.1 PE=4 SV=1
1344	1240	A0A178UKY5	116.35	16	16	3.49E7	8	8	9	Y	96259	KPNB1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g52430 PE=4 SV=1
1344	1241	Q9FJD4	116.35	16	16	3.49E7	8	8	9	Y	96259	Importin subunit beta-1 OS=Arabidopsis thaliana OX=3702 GN=KPNB1 PE=1 SV=1
1451	6060	Q9SLI4	116.32	41	41	8.78E7	6	6	8	Y	21875	At1g54500/F20D21_31 OS=Arabidopsis thaliana OX=3702 GN=At1g54500 PE=2 SV=1
1451	6061	A0A178W6Q7	116.32	41	41	8.78E7	6	6	8	Y	21875	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g48980 PE=4 SV=1
820	4231	A0A178USR1	116.14	75	75	2.57E8	7	7	18	Y	12005	Mitochondrial pyruvate carrier OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g25940 PE=3 SV=1
820	4232	O49636	116.14	75	75	2.57E8	7	7	18	Y	12005	Mitochondrial pyruvate carrier 4 OS=Arabidopsis thaliana OX=3702 GN=MPC4 PE=3 SV=1
927	4208	P39207	116.07	59	59	2.3E8	8	8	14	Y	16500	Nucleoside diphosphate kinase 1 OS=Arabidopsis thaliana OX=3702 GN=NDK1 PE=1 SV=1
927	4209	A0A178UXQ6	116.07	59	59	2.3E8	8	8	14	Y	16500	Nucleoside diphosphate kinase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g10580 PE=3 SV=1
926	3684	Q940G0	116.00	16	16	2.25E8	8	8	14	Y	66893	Transmembrane 9 superfamily member 1 OS=Arabidopsis thaliana OX=3702 GN=TMN1 PE=1 SV=1
1065	3544	P56762	115.95	37	37	1.22E8	8	8	14	Y	38137	DNA-directed RNA polymerase subunit alpha OS=Arabidopsis thaliana OX=3702 GN=rpoA PE=3 SV=1
1065	3545	A0A1B1W4Y1	115.95	37	37	1.22E8	8	8	14	Y	38137	DNA-directed RNA polymerase subunit alpha OS=Arabidopsis thaliana OX=3702 GN=rpoA PE=3 SV=1
1232	2599	Q9ZSA2	115.91	27	27	1.09E7	10	8	10	Y	59895	Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana OX=3702 GN=CPK21 PE=1 SV=1
1232	2600	A0A178USG2	115.91	27	27	1.09E7	10	8	10	Y	59895	CPK21 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g05580 PE=4 SV=1
845	3708	A0A384KUF3	115.87	37	37	8.29E8	7	7	17	Y	24239	Ribosomal protein L15 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g20440 PE=3 SV=1
845	3709	Q8VYF1	115.87	37	37	8.29E8	7	7	17	Y	24239	60S ribosomal protein L15-2 OS=Arabidopsis thaliana OX=3702 GN=RPL15B PE=2 SV=1
845	3710	Q0WWU9	115.87	37	37	8.29E8	7	7	17	Y	24239	Ribosomal protein L15 OS=Arabidopsis thaliana OX=3702 GN=At4g17390 PE=2 SV=1
845	3711	A0A178V5T1	115.87	37	37	8.29E8	7	7	17	Y	24239	Ribosomal protein L15 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g19680 PE=3 SV=1
845	3712	O23515	115.87	37	37	8.29E8	7	7	17	Y	24239	60S ribosomal protein L15-1 OS=Arabidopsis thaliana OX=3702 GN=RPL15A PE=2 SV=1
1169	2090	A0A384KQK4	115.83	29	29	4.7E7	9	9	12	Y	62596	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g67480 PE=1 SV=1
1169	2091	A0A1P8BEF2	115.83	29	29	4.7E7	9	9	12	Y	62596	Phototropic-responsive NPH3 family protein OS=Arabidopsis thaliana OX=3702 GN=At5g67385 PE=1 SV=1
1169	2092	A0A178URN3	115.83	27	27	4.7E7	9	9	12	Y	67559	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g67480 PE=3 SV=1
1169	2093	Q66GP0	115.83	27	27	4.7E7	9	9	12	Y	67559	BTB/POZ domain-containing protein SR1IP1 OS=Arabidopsis thaliana OX=3702 GN=SR1IP1 PE=1 SV=2
1178	4351	A0A178VVM7	115.81	48	48	7.03E7	8	8	9	N	20968	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g43420 PE=4 SV=1
1178	4352	O80837	115.81	48	48	7.03E7	8	8	9	N	20968	Remorin OS=Arabidopsis thaliana OX=3702 GN=DBP PE=1 SV=1
1110	6343	A0A384KPX2	115.80	26	26	2.38E7	10	10	12	Y	66879	Starch synthase, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g33610 PE=3 SV=1
1110	6344	Q9MAQ0	115.80	26	26	2.38E7	10	10	12	Y	66879	Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=GBSS1 PE=1 SV=1
1110	6345	W8PW06	115.80	26	26	2.38E7	10	10	12	Y	66879	Starch synthase, chloroplastic/amyloplastic (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT1G32900 PE=2 SV=1
1008	2779	O80565	115.72	38	38	6.13E7	8	8	12	Y	38835	Outer envelope pore protein 37, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OEP37 PE=2 SV=2
1008	2780	A0A178VRQ0	115.72	38	38	6.13E7	8	8	12	Y	38835	OEP37 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g41490 PE=4 SV=1
889	1687	O24457	115.62	36	36	8.71E7	12	12	14	Y	47174	Pyruvate dehydrogenase E1 component subunit alpha-3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PDH-E1 ALPHA PE=2 SV=1
889	1688	A0A178W8A7	115.62	36	36	8.71E7	12	12	14	Y	47174	Pyruvate dehydrogenase E1 component subunit alpha OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g00090 PE=4 SV=1
1568	2514	Q9SJ03	115.56	30	30	8.74E7	7	7	8	N	35806	Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g21960 PE=2 SV=2
1568	2515	Q8LBF2	115.56	30	30	8.74E7	7	7	8	N	35858	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
730	3206	A0A178UH18	115.44	12	12	1.89E6	7	2	16	Y	90580	MS3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g20940 PE=3 SV=1
730	3207	Q0WNZ5	115.44	12	12	1.89E6	7	2	16	Y	90594	5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MS3 PE=1 SV=1
1051	2171	A0A178WLI7	115.40	49	49	4.84E7	9	9	10	Y	39177	NPQ1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g08380 PE=3 SV=1
1051	2174	Q39249	115.40	36	36	4.84E7	9	9	10	Y	52017	Violaxanthin de-epoxidase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=VDE1 PE=1 SV=1
1051	2175	A0A384K8V4	115.40	36	36	4.84E7	9	9	10	Y	52017	NPQ1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g08380 PE=3 SV=1
1051	2176	B9DGR5	115.40	36	36	4.84E7	9	9	10	Y	52017	AT1G08550 protein OS=Arabidopsis thaliana OX=3702 GN=At1g08550 PE=2 SV=1
1018	2002	P42825	115.38	32	32	1.51E7	10	4	13	Y	46439	Chaperone protein dnaJ 2 OS=Arabidopsis thaliana OX=3702 GN=ATJ2 PE=1 SV=2
1018	2003	A0A384LB11	115.38	32	32	1.51E7	10	4	13	Y	46439	J2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g21400 PE=3 SV=1
1018	2004	Q0V7U1	115.38	32	32	1.51E7	10	4	13	Y	46439	At5g22060 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1304	6135	Q9C505	115.25	51	51	9.84E6	7	4	11	Y	17207	Eukaryotic translation initiation factor 5A-3 OS=Arabidopsis thaliana OX=3702 GN=ELF5A-3 PE=2 SV=1
1304	6136	A0A178WLT0	115.25	51	51	9.84E6	7	4	11	Y	17207	Eukaryotic translation initiation factor 5A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g63480 PE=3 SV=1
1294	4245	A0A178UIT0	115.20	21	21	4.54E7	8	8	11	Y	62176	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g06170 PE=4 SV=1
1294	4246	Q94AX4	115.20	21	21	4.54E7	8	8	11	Y	62176	D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DLD PE=1 SV=1
1485	3729	Q944Q6	115.05	35	35	2.57E7	7	7	9	Y	37438	Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g14835 PE=1 SV=1
1485	3730	Q8LA43	115.05	35	35	2.57E7	7	7	9	Y	37454	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1485	3731	Q93VN2	115.05	35	35	2.57E7	7	7	9	Y	37339	At2g14841/At2g14841 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1485	3732	A0A178VQB0	115.05	35	35	2.57E7	7	7	9	Y	37454	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g10030 PE=4 SV=1
1120	4163	A0A178UYS9	115.01	35	35	1.46E8	7	7	13	Y	28616	PMSR4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g29030 PE=3 SV=1
1120	4164	P54150	115.01	35	35	1.46E8	7	7	13	Y	28644	Peptide methionine sulfoxide reductase A4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MSR4 PE=1 SV=2
1346	3051	A0A1P8BFQ7	114.78	16	16	4.03E7	8	8	9	N	81861	Staurosporin and temperature sensitive 3-like A OS=Arabidopsis thaliana OX=3702 GN=STT3A PE=4 SV=1
1346	2673	W8QN88	114.78	15	15	4.03E7	8	8	9	N	86113	Glycosyltransferase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT5G19690 PE=2 SV=1
1346	2674	Q93ZY3	114.78	15	15	4.03E7	8	8	9	N	86113	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Arabidopsis thaliana OX=3702 GN=STT3A PE=2 SV=1
1346	2675	A0A384LLW3	114.78	15	15	4.03E7	8	8	9	N	86113	STT3A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g19610 PE=4 SV=1
1128	1767	A0A384LE13	114.73	30	30	3.37E7	8	6	12	N	50570	GAE6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g25720 PE=4 SV=1
1128	1768	I1VCA6	114.73	30	30	3.37E7	8	6	12	N	50570	UDP-D-glucuronate 4-epimerase 6 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=GAE6 PE=2 SV=1
1128	1769	Q9LIS3	114.73	30	30	3.37E7	8	6	12	N	50570	UDP-glucuronate 4-epimerase 6 OS=Arabidopsis thaliana OX=3702 GN=GAE6 PE=1 SV=1
880	4541	Q9LDV4	114.71	26	26	6.35E7	9	7	16	Y	59511	Alanine aminotransferase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALAAT2 PE=1 SV=1
880	4540	A0A178WAU5	114.71	26	26	6.35E7	9	7	16	Y	59513	ALAAT2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g66510 PE=4 SV=1
1230	3991	Q9FXA8	114.67	22	22	2.62E7	9	9	10	Y	70437	Alkaline/neutral invertase A, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=INVA PE=1 SV=1
1230	4016	A0A178W6U7	114.67	22	22	2.62E7	9	9	10	Y	70410	A/N-InvA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g51370 PE=4 SV=1
855	4123	A0A178UX41	114.65	17	17	3.62E7	10	10	12	N	113233	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g10050 PE=4 SV=1
855	4126	Q8VZG8	114.65	17	17	3.62E7	10	10	12	N	115423	MDIS1-interacting receptor like kinase 2 OS=Arabidopsis thaliana OX=3702 GN=MIK2 PE=1 SV=3
871	1482	F4IVL6	114.54	5	5	2.76E6	6	6	7	Y	279071	DnaJ homolog subfamily C GRV2 OS=Arabidopsis thaliana OX=3702 GN=GRV2 PE=1 SV=1
1084	2876	A0A178UWR6	114.45	19	19	2.36E7	10	9	12	Y	98179	Aminopeptidase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g37910 PE=3 SV=1
1084	2877	Q8VZH2	114.45	19	19	2.36E7	10	9	12	Y	98179	Aminopeptidase M1 OS=Arabidopsis thaliana OX=3702 GN=APM1 PE=1 SV=1
1497	4387	Q9LP45	114.44	22	22	2.72E7	8	8	9	Y	46749	26S proteasome non-ATPase regulatory subunit 11 homolog OS=Arabidopsis thaliana OX=3702 GN=RPN6 PE=1 SV=1
1497	4388	A0A178WAE7	114.44	22	22	2.72E7	8	8	9	Y	46749	RPN6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g29460 PE=4 SV=1
1145	1374	A0A178WBL6	114.43	9	9	8.38E6	8	8	10	N	156639	SOP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g10920 PE=4 SV=1
1145	1375	Q9SAC6	114.43	9	9	8.38E6	8	8	10	N	156581	Alpha-glucan water dikinase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GWD1 PE=1 SV=2
1199	2039	A0A178USK3	114.27	19	19	2.61E7	9	9	10	N	56846	SUR2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g36090 PE=3 SV=1
1199	2040	O65782	114.27	19	19	2.61E7	9	9	10	N	56846	Cytochrome P450 83B1 OS=Arabidopsis thaliana OX=3702 GN=CYP83B1 PE=1 SV=1
1141	3628	A0A178W8I8	114.26	36	36	3.79E7	9	8	10	Y	48264	JR3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g45980 PE=4 SV=1
1141	3629	O04373	114.26	36	36	3.79E7	9	8	10	Y	48264	IAA-amino acid hydrolase ILR1-like 4 OS=Arabidopsis thaliana OX=3702 GN=ILL4 PE=1 SV=2
990	2153	C0LGG9	114.21	12	12	3.32E5	9	2	12	N	114851	Probable LRR receptor-like serine/threonine-protein kinase At1g53440 OS=Arabidopsis thaliana OX=3702 GN=At1g53440 PE=2 SV=2
990	2154	A0A178WLP5	114.21	12	12	3.32E5	9	2	12	N	114851	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g47770 PE=4 SV=1
1127	2789	A0A384KS52	114.18	29	29	1.66E7	10	10	10	Y	66324	Emb1027 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g30330 PE=1 SV=1
1127	2790	Q7DLG4	114.18	29	29	1.66E7	10	10	10	Y	66324	Arginyl-tRNA synthetase OS=Arabidopsis thaliana OX=3702 GN=emb1027 PE=1 SV=1
1127	2793	A0A1P8B7W2	114.18	28	28	1.66E7	10	10	10	Y	69318	Arginyl-tRNA synthetase, class Ic OS=Arabidopsis thaliana OX=3702 GN=emb1027 PE=1 SV=1
1127	2794	A0A1P8B7W5	114.18	28	28	1.66E7	10	10	10	Y	70922	Arginyl-tRNA synthetase, class Ic OS=Arabidopsis thaliana OX=3702 GN=emb1027 PE=1 SV=1
1127	2795	O23247	114.18	27	27	1.66E7	10	10	10	Y	72387	Arginine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB1027 PE=1 SV=1
1127	2797	A0A1P8B7W8	114.18	27	27	1.66E7	10	10	10	Y	73324	Arginyl-tRNA synthetase, class Ic OS=Arabidopsis thaliana OX=3702 GN=emb1027 PE=1 SV=1
1244	2519	A0A178UB47	114.12	39	39	3.41E7	11	11	11	Y	60490	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g48380 PE=4 SV=1
1244	2520	F4K658	114.12	39	39	3.41E7	11	11	11	Y	60490	FAD/NAD(P)-binding oxidoreductase family protein OS=Arabidopsis thaliana OX=3702 GN=At5g49555 PE=4 SV=1
1118	2897	Q9LIC2	113.99	15	15	3.99E7	7	4	13	Y	74234	Transmembrane 9 superfamily member 7 OS=Arabidopsis thaliana OX=3702 GN=TMN7 PE=2 SV=1
1118	2898	A0A178V8P8	113.99	15	15	3.99E7	7	4	13	Y	74234	Transmembrane 9 superfamily member OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g14190 PE=3 SV=1
1399	4346	Q9LRN8	113.95	31	31	3.48E7	6	6	8	Y	35404	50S ribosomal protein L3-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RPL3B PE=2 SV=1
1399	4347	A0A178V7Q7	113.95	31	31	3.48E7	6	6	8	Y	35404	RPL3P OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g18430 PE=3 SV=1
1262	4091	Q9XFM6	113.94	51	51	5.56E7	7	6	10	N	24405	Membrane steroid-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=MSBP1 PE=1 SV=2
1438	3509	Q9SGH4	113.55	49	49	3.06E7	7	7	8	Y	24781	Photosynthetic NDH subunit of lumenal location 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PNSL3 PE=1 SV=1
1438	3510	A0A178V9U4	113.55	49	49	3.06E7	7	7	8	Y	24776	PQL2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g00540 PE=4 SV=1
1331	3516	P37107	113.54	26	26	4.2E7	9	9	10	Y	61232	Signal recognition particle 54 kDa protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FFC PE=1 SV=1
1331	3517	A0A178UD49	113.54	26	26	4.2E7	9	9	10	Y	61232	SRP54CP OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g03290 PE=3 SV=1
1484	3421	B6EUA5	113.51	50	50	4.24E7	7	7	9	N	21768	Pentapeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=At1g12250 PE=4 SV=1
1484	3422	Q8H1Q1	113.51	36	36	4.24E7	7	7	9	N	30065	Thylakoid lumenal protein TL20.3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TL20.3 PE=1 SV=1
1361	6947	Q9FL44	113.46	20	20	1.59E8	6	6	7	Y	24395	Protein MAINTENANCE OF PSII UNDER HIGH LIGHT 1 OS=Arabidopsis thaliana OX=3702 GN=MPH1 PE=1 SV=1
674	5011	P62090	113.25	83	83	1.85E9	7	7	20	Y	9038	Photosystem I iron-sulfur center OS=Arabidopsis thaliana OX=3702 GN=psaC PE=3 SV=2
674	5012	A0A1B1W4Y4	113.25	83	83	1.85E9	7	7	20	Y	9038	Photosystem I iron-sulfur center OS=Arabidopsis thaliana OX=3702 GN=psaC PE=3 SV=1
1087	2495	A0A178WAZ4	113.22	32	32	2.1E7	11	7	11	Y	46918	ACLA-3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g09340 PE=4 SV=1
1087	2496	O80526	113.22	32	32	2.1E7	11	7	11	Y	46946	ATP-citrate synthase alpha chain protein 3 OS=Arabidopsis thaliana OX=3702 GN=ACLA-3 PE=2 SV=1
1729	4534	A0A178UJB9	113.20	41	41	1.38E7	6	6	6	N	34353	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g23130 PE=4 SV=1
1729	4535	Q9LT08	113.20	41	41	1.38E7	6	6	6	N	34353	26S proteasome non-ATPase regulatory subunit 14 homolog OS=Arabidopsis thaliana OX=3702 GN=RPN11 PE=1 SV=1
1747	4305	A0A178WJT5	113.19	36	36	2.51E7	5	5	7	N	27651	Proteasome subunit beta OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g51160 PE=3 SV=1
1747	4306	Q7DLR9	113.19	36	36	2.51E7	5	5	7	N	27651	Proteasome subunit beta type-4 OS=Arabidopsis thaliana OX=3702 GN=PBG1 PE=1 SV=2
1373	3808	O65351	113.18	26	26	2.59E7	9	9	10	Y	79415	Subtilisin-like protease SBT1.7 OS=Arabidopsis thaliana OX=3702 GN=SBT1.7 PE=1 SV=1
782	2298	Q94FB9	113.02	12	12	1.29E7	10	9	11	Y	149576	ABC transporter D family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCD1 PE=1 SV=1
782	2299	F4JJ28	113.02	12	12	1.29E7	10	9	11	Y	149704	Peroxisomal ABC transporter 1 OS=Arabidopsis thaliana OX=3702 GN=ABCD1 PE=4 SV=1
782	2300	F4JJ27	113.02	12	12	1.29E7	10	9	11	Y	151135	Peroxisomal ABC transporter 1 OS=Arabidopsis thaliana OX=3702 GN=ABCD1 PE=4 SV=1
954	1765	P56764	113.01	10	10	1.79E7	9	9	11	Y	156365	DNA-directed RNA polymerase subunit beta'' OS=Arabidopsis thaliana OX=3702 GN=rpoC2 PE=3 SV=1
954	1766	A0A1B1W4T2	113.01	10	10	1.79E7	9	9	11	Y	156338	DNA-directed RNA polymerase subunit beta'' OS=Arabidopsis thaliana OX=3702 GN=rpoC2 PE=3 SV=1
1013	8678	A0A384LB08	112.89	16	16	1.45E9	4	4	12	N	25849	TIP2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g28790 PE=3 SV=1
1013	8679	Q41963	112.89	16	16	1.45E9	4	4	12	N	25849	Aquaporin TIP1-2 OS=Arabidopsis thaliana OX=3702 GN=TIP1-2 PE=1 SV=2
1013	8680	C0SVC9	112.89	16	16	1.45E9	4	4	12	N	25849	Uncharacterized protein At3g26520 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At3g26520 PE=2 SV=1
1053	2830	A0A178V5S8	112.71	64	64	2E7	8	3	12	Y	22030	SAR2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g02660 PE=3 SV=1
1053	2831	O04834	112.71	64	64	2E7	8	3	12	Y	22030	GTP-binding protein SAR1A OS=Arabidopsis thaliana OX=3702 GN=SAR1A PE=2 SV=1
1389	5244	Q8RXN3	112.65	17	17	6.99E7	5	4	7	Y	44224	Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPT1 PE=1 SV=1
921	2233	A0A178UER1	112.50	40	40	9.39E7	10	10	14	N	33380	PPa6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g09180 PE=4 SV=1
921	2234	Q9LXC9	112.50	40	40	9.39E7	10	10	14	N	33380	Soluble inorganic pyrophosphatase 6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPA6 PE=1 SV=1
1514	4922	A0A1P8AZS7	112.46	25	25	2.79E7	5	4	7	Y	38257	Thioredoxin reductase OS=Arabidopsis thaliana OX=3702 GN=NTRA PE=3 SV=1
1514	4074	A0A178VVD7	112.46	24	24	2.79E7	5	4	7	Y	39832	Thioredoxin reductase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g12620 PE=3 SV=1
1514	4075	Q39242	112.46	23	23	2.79E7	5	4	7	Y	40635	Thioredoxin reductase 2 OS=Arabidopsis thaliana OX=3702 GN=NTR2 PE=2 SV=2
1154	2205	B5X571	112.34	17	17	2.78E7	8	6	12	Y	71131	At1g48480 OS=Arabidopsis thaliana OX=3702 GN=LRR-RLK PE=2 SV=1
1154	2206	Q9LP77	112.34	17	17	2.78E7	8	6	12	Y	71131	Probable inactive receptor kinase At1g48480 OS=Arabidopsis thaliana OX=3702 GN=RKL1 PE=1 SV=1
1154	2207	A0A178WLI2	112.34	17	17	2.78E7	8	6	12	Y	71132	RKL1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g42580 PE=4 SV=1
1327	1691	Q9LFX8	112.32	31	31	2.39E7	9	9	10	Y	46018	Glycine-rich protein OS=Arabidopsis thaliana OX=3702 GN=At1g27090 PE=1 SV=1
1327	1692	A0A178W3A8	112.32	31	31	2.39E7	9	9	10	Y	46018	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g27520 PE=1 SV=1
1170	1485	A0A178UL10	112.31	30	30	3.16E7	9	9	12	Y	57286	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g20840 PE=3 SV=1
1170	1486	Q940P8	112.31	30	30	3.16E7	9	9	12	Y	57286	T-complex protein 1 subunit beta OS=Arabidopsis thaliana OX=3702 GN=CCT2 PE=1 SV=1
1024	3967	Q5XF75	112.28	28	28	7.07E7	8	8	10	Y	43191	Elongation factor Ts, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EFTS PE=1 SV=1
1483	3489	A0A178V3S8	112.21	41	41	1.04E8	7	7	9	Y	26777	SDRA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g06950 PE=4 SV=1
1483	3490	Q9S9W2	112.21	41	41	1.04E8	7	7	9	Y	26765	Short-chain dehydrogenase/reductase SDRA OS=Arabidopsis thaliana OX=3702 GN=SDRA PE=1 SV=1
1426	4065	Q9SCY2	112.14	46	46	4.41E7	7	7	9	Y	22039	Peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FKBP13 PE=1 SV=2
1426	4066	A0A178ULT3	112.14	46	46	4.41E7	7	7	9	Y	22005	Peptidylprolyl isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g44070 PE=4 SV=1
1365	1494	Q8H0V6	112.08	16	16	3.36E7	7	7	8	N	79644	ABC transporter F family member 3 OS=Arabidopsis thaliana OX=3702 GN=ABCF3 PE=1 SV=1
1437	5676	Q8VZT8	112.06	24	24	1.26E7	6	6	6	N	33926	Probable ribosomal protein S11, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NFD3 PE=2 SV=1
1431	2497	Q9SJZ7	111.98	22	22	2.06E7	7	6	8	Y	47761	Chaperone protein dnaJ A6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DJA6 PE=2 SV=2
1431	2498	A0A178VNU6	111.98	22	22	2.06E7	7	6	8	Y	47787	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g17930 PE=3 SV=1
906	3221	A0A178WJ16	111.95	29	29	6.67E7	10	10	12	N	45765	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g45310 PE=4 SV=1
906	3222	Q8LAP6	111.95	29	29	6.67E7	10	10	12	N	45765	Probable plastid-lipid-associated protein 12, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PAP12 PE=1 SV=1
1191	3280	Q9FK07	111.87	27	27	3.1E7	8	8	9	Y	61964	CLP protease regulatory subunit CLPX1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CLPX1 PE=2 SV=1
1191	3281	A0A178USB7	111.87	27	27	3.1E7	8	8	9	Y	61964	CLPX OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g52300 PE=4 SV=1
1520	4470	Q9MAP3	111.80	40	40	1.46E8	6	6	8	Y	23148	50S ribosomal protein L11, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPL11 PE=2 SV=1
1520	4471	A0A178WDS8	111.80	40	40	1.46E8	6	6	8	Y	23148	PRPL11 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g33710 PE=3 SV=1
1967	6407	Q38833	111.70	22	22	8.85E7	5	5	6	Y	41881	Chlorophyll synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CHLG PE=2 SV=1
1967	6408	A0A178VH65	111.70	22	22	8.85E7	5	5	6	Y	41881	PDE325 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g46190 PE=4 SV=1
1192	2636	A0A1P8B527	111.66	43	43	4.22E7	9	9	11	Y	37149	Adenylyl cyclase OS=Arabidopsis thaliana OX=3702 GN=At4g15640 PE=4 SV=1
1192	2639	A0A178V7A8	111.66	36	36	4.22E7	9	9	11	Y	43910	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g18270 PE=4 SV=1
1192	2640	Q1JPP0	111.66	36	36	4.22E7	9	9	11	Y	43910	Adenylyl cyclase OS=Arabidopsis thaliana OX=3702 GN=At4g15640 PE=2 SV=1
1470	5144	Q8H167	111.63	33	33	6.46E7	8	8	9	N	32884	Uncharacterized protein At1g08640 OS=Arabidopsis thaliana OX=3702 GN=At1g08640 PE=2 SV=1
1470	5145	Q93WG3	111.63	33	33	6.46E7	8	8	9	N	32902	Chloroplast J-like domain 1 OS=Arabidopsis thaliana OX=3702 GN=CJD1 PE=1 SV=1
1470	5098	Q9FRS1	111.63	30	30	6.46E7	8	8	9	N	36120	F22O13.12 OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
1470	5146	A0A178WCD0	111.63	33	33	6.46E7	8	8	9	N	33126	CJD1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g08470 PE=4 SV=1
1348	2266	O22993	111.58	11	11	2.41E7	7	7	8	N	105543	Probable inactive ATP-dependent zinc metalloprotease FTSHI 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FTSHI1 PE=1 SV=1
1348	2267	A0A178V628	111.58	11	11	2.41E7	7	7	8	N	105555	FtsHi1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g27730 PE=4 SV=1
1274	3264	A0A384LJ55	111.56	28	28	3.26E7	8	8	10	Y	55071	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COQ6 PE=3 SV=1
1274	3265	F4J6I5	111.56	28	28	3.26E7	8	8	10	Y	55071	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COQ6 PE=3 SV=1
1274	4001	Q682L2	111.56	28	28	3.26E7	8	8	10	Y	54991	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COQ6 PE=2 SV=1
1274	3266	F4J6I6	111.56	28	28	3.26E7	8	8	10	Y	55287	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COQ6 PE=3 SV=1
1274	3267	A0A384KH43	111.56	28	28	3.26E7	8	8	10	Y	55287	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COQ6 PE=3 SV=1
1086	1269	Q9STI0	111.48	27	27	1.02E7	10	4	11	Y	59046	At4g12310 OS=Arabidopsis thaliana OX=3702 GN=''cytochrome P450 PE=2 SV=1
1086	1270	A0A178UVW4	111.48	27	27	1.02E7	10	4	11	Y	59046	CYP706A5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g13840 PE=3 SV=1
1433	4238	Q9FUP0	111.46	30	30	2.55E7	7	7	7	Y	42691	12-oxophytodienoate reductase 3 OS=Arabidopsis thaliana OX=3702 GN=OPR3 PE=1 SV=2
1636	4274	A0A178VWY5	111.26	46	46	2.05E7	7	7	7	N	22588	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g17060 PE=4 SV=1
1636	4275	Q8GWP4	111.26	45	45	2.05E7	7	7	7	N	22676	At2g21530 OS=Arabidopsis thaliana OX=3702 GN=At2g21530 PE=1 SV=1
1273	1743	A0A178W7F4	111.20	23	23	2.94E7	9	9	10	Y	66846	LUT5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g32390 PE=3 SV=1
1273	1744	Q93VK5	111.20	23	23	2.94E7	9	9	10	Y	66846	Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CYP97A3 PE=1 SV=1
1349	3093	P42761	111.12	47	47	7.49E7	8	7	9	N	24230	Glutathione S-transferase F10 OS=Arabidopsis thaliana OX=3702 GN=GSTF10 PE=1 SV=3
1349	3094	A0A178VU78	111.12	47	47	7.49E7	8	7	9	N	24230	GSTF10 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g26990 PE=3 SV=1
1364	4148	A0A178VM60	111.10	25	25	2.8E7	8	8	9	N	61694	Zeta-carotene desaturase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g04350 PE=3 SV=1
1364	4149	Q38893	111.10	25	25	2.8E7	8	8	9	N	61634	Zeta-carotene desaturase, chloroplastic/chromoplastic OS=Arabidopsis thaliana OX=3702 GN=ZDS1 PE=1 SV=3
1298	2966	Q96520	111.05	32	32	1.2E8	7	7	10	Y	39559	Peroxidase 12 OS=Arabidopsis thaliana OX=3702 GN=PER12 PE=1 SV=1
1298	2967	A0A178WB34	111.05	32	32	1.2E8	7	7	10	Y	39559	Peroxidase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g65790 PE=3 SV=1
956	3236	A0A1B1W4U6	111.04	52	52	1.03E8	8	8	13	Y	23240	30S ribosomal protein S4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rps4 PE=3 SV=1
956	3237	P56799	111.04	52	52	1.03E8	8	8	13	Y	23240	30S ribosomal protein S4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rps4 PE=3 SV=1
1112	2680	Q5XF03	110.81	28	28	1.04E7	12	2	13	Y	55868	Probable glycerol-3-phosphate acyltransferase 8 OS=Arabidopsis thaliana OX=3702 GN=GPAT8 PE=2 SV=1
1143	3129	Q8LE47	110.70	34	34	4.87E7	11	9	12	Y	45758	Pentatricopeptide repeat-containing protein At1g61870, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PPR336 PE=2 SV=2
1143	3130	A0A178WAE3	110.70	34	34	4.87E7	11	9	12	Y	45723	PPR336 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g55130 PE=4 SV=1
1210	2925	O23275	110.70	19	19	1.29E7	8	6	8	Y	84947	Protein transport protein SEC23 OS=Arabidopsis thaliana OX=3702 GN=dl3120w PE=3 SV=1
1210	2926	Q8VXX0	110.70	19	19	1.29E7	8	6	8	Y	85278	Protein transport protein SEC23 OS=Arabidopsis thaliana OX=3702 GN=At4g14160 PE=1 SV=1
1210	2927	Q8RW92	110.70	19	19	1.29E7	8	6	8	Y	85220	Protein transport protein SEC23 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1210	2928	A0A178V0T7	110.70	19	19	1.29E7	8	6	8	Y	85278	Protein transport protein SEC23 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g16260 PE=1 SV=1
1210	2929	F4JUM1	110.70	19	19	1.29E7	8	6	8	Y	85378	Protein transport protein SEC23 OS=Arabidopsis thaliana OX=3702 GN=At4g14160 PE=1 SV=1
1290	3472	A0A178VZT5	110.65	9	9	2.13E7	7	7	8	N	132175	TOC132 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g11700 PE=4 SV=1
1290	3473	Q9SLF3	110.65	9	9	2.13E7	7	7	8	N	132277	Translocase of chloroplast 132, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC132 PE=1 SV=1
1272	2430	A0A178VEP3	110.57	35	35	2.57E7	10	9	11	Y	47010	RPT5A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g05090 PE=3 SV=1
1272	2431	Q9SEI2	110.57	35	35	2.57E7	10	9	11	Y	47480	26S proteasome regulatory subunit 6A homolog A OS=Arabidopsis thaliana OX=3702 GN=RPT5A PE=1 SV=1
1864	5332	A0A178V3D8	110.49	19	19	2.76E7	6	6	6	Y	53061	SQD1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g37850 PE=4 SV=1
1864	5333	O48917	110.49	19	19	2.76E7	6	6	6	Y	53114	UDP-sulfoquinovose synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SQD1 PE=1 SV=1
1052	3203	Q8GUI1	110.48	32	32	3.49E7	9	9	10	Y	49860	Calreticulin, putative OS=Arabidopsis thaliana OX=3702 GN=At1g08450 PE=2 SV=1
1052	3204	A0A178W681	110.48	32	32	3.49E7	9	9	10	Y	49844	PSL1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g08270 PE=3 SV=1
1052	3205	O04153	110.48	32	32	3.49E7	9	9	10	Y	49844	Calreticulin-3 OS=Arabidopsis thaliana OX=3702 GN=CRT3 PE=1 SV=2
993	7267	P11490	110.46	53	53	1.96E8	5	5	15	Y	17589	Plastocyanin minor isoform, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PETE PE=1 SV=2
993	7268	A0A178WN71	110.46	53	53	1.96E8	5	5	15	Y	17651	Plastocyanin OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g70550 PE=3 SV=1
993	7269	A0A1P8APR2	110.46	44	44	1.96E8	5	5	15	Y	21872	Plastocyanin OS=Arabidopsis thaliana OX=3702 GN=PETE1 PE=3 SV=1
1461	2770	A0A178VM31	110.42	10	10	1.66E7	7	7	7	N	121380	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g15370 PE=3 SV=1
1461	2771	Q9SL76	110.42	10	10	1.66E7	7	7	7	N	121389	Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At2g20050/At2g20040 PE=2 SV=2
1461	2769	F4IUD7	110.42	10	10	1.66E7	7	7	7	N	121088	Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At2g20050 PE=3 SV=1
1185	5241	Q9LZM6	110.32	24	24	2.26E8	6	6	12	N	29764	At5g02050 OS=Arabidopsis thaliana OX=3702 GN=At5g02050 PE=2 SV=1
1185	5235	Q8LD55	110.32	24	24	2.26E8	6	6	12	N	29814	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1185	5242	A0A178UK87	110.32	24	24	2.26E8	6	6	12	N	29771	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g01150 PE=4 SV=1
1376	3216	A0A178WCT1	110.30	27	27	3.92E7	7	7	9	N	53840	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g17660 PE=4 SV=1
1376	3217	Q8W4K2	110.30	27	27	3.92E7	7	7	9	N	53784	Mitochondrial 28S ribosomal protein S29-like protein OS=Arabidopsis thaliana OX=3702 GN=F6I1.13 PE=2 SV=1
1517	4068	B5X0P0	110.15	35	35	1.18E8	6	6	9	Y	24736	At5g13510 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1517	4069	Q9FY50	110.15	35	35	1.18E8	6	6	9	Y	24736	50S ribosomal protein L10, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPL10 PE=2 SV=1
1517	4070	A0A384K907	110.15	35	35	1.18E8	6	6	9	Y	24736	EMB3136 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g12940 PE=3 SV=1
1510	6171	A0A178W567	110.12	20	20	2.19E7	8	8	8	Y	78175	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g31180 PE=4 SV=1
1510	6172	B5X582	110.12	19	19	2.19E7	8	8	8	Y	80403	Twinkle homolog protein, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g30680 PE=1 SV=1
1283	4468	A0A178WAK8	110.10	25	25	7.61E7	7	7	11	Y	38792	OST3/6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g55030 PE=4 SV=1
1283	4469	Q9SYB5	110.10	25	25	7.61E7	7	7	11	Y	38806	Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3B OS=Arabidopsis thaliana OX=3702 GN=OST3B PE=2 SV=1
891	1623	Q8L706	110.05	28	28	6.11E7	9	9	13	Y	62929	Synaptotagmin-5 OS=Arabidopsis thaliana OX=3702 GN=SYT5 PE=2 SV=1
891	1624	A0A178W1X3	110.05	27	27	6.11E7	9	9	13	Y	65821	SYTE OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g04920 PE=4 SV=1
1059	59473	Q9SUI6	110.02	57	57	4.8E6	5	2	13	N	15274	Photosystem I reaction center subunit VI-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSAH2 PE=2 SV=1
1059	59474	A0A178WML3	110.02	57	57	4.8E6	5	2	13	N	15274	PSI-H OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g46490 PE=4 SV=1
1222	6260	Q1EBV7	109.99	33	33	9.92E7	6	6	11	Y	43608	Sodium/pyruvate cotransporter BASS2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=BASS2 PE=1 SV=1
1222	6261	A0A178VXV9	109.99	33	33	9.92E7	6	6	11	Y	43608	BASS2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g22790 PE=4 SV=1
1270	1918	Q93VB0	109.96	38	38	2.25E7	10	10	10	Y	42088	Nucleic acid-binding, OB-fold-like protein OS=Arabidopsis thaliana OX=3702 GN=At2g40660 PE=2 SV=1
830	2366	Q9SH90	109.93	53	53	2.18E8	9	9	14	N	23715	Uncharacterized protein At2g37970; T8P21.12 OS=Arabidopsis thaliana OX=3702 GN=T8P21.12 PE=2 SV=1
830	2367	F4IRX7	109.93	47	47	2.18E8	9	9	14	N	27352	SOUL heme-binding family protein OS=Arabidopsis thaliana OX=3702 GN=SOUL-1 PE=1 SV=2
772	2707	P51427	109.93	46	46	4.95E8	7	7	16	Y	22921	40S ribosomal protein S5-2 OS=Arabidopsis thaliana OX=3702 GN=RPS5B PE=1 SV=2
772	2708	A0A178VED6	109.93	46	46	4.95E8	7	7	16	Y	22921	RPS5A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g11890 PE=3 SV=1
772	2709	A0A178VNW7	109.93	46	46	4.95E8	7	7	16	Y	22991	RPS5B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g34070 PE=3 SV=1
772	2710	Q9ZUT9	109.93	46	46	4.95E8	7	7	16	Y	22991	40S ribosomal protein S5-1 OS=Arabidopsis thaliana OX=3702 GN=RPS5A PE=1 SV=1
1398	2774	A0A178VHM4	109.93	20	20	1.82E7	10	8	10	Y	97911	FER OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g45890 PE=4 SV=1
1398	2775	Q9SCZ4	109.93	20	20	1.82E7	10	8	10	Y	98150	Receptor-like protein kinase FERONIA OS=Arabidopsis thaliana OX=3702 GN=FER PE=1 SV=1
1822	4976	Q8H0W1	109.78	22	22	2.36E7	5	5	7	Y	32554	Chloroplast processing peptidase OS=Arabidopsis thaliana OX=3702 GN=PLSP1 PE=2 SV=2
1822	5031	A0A178VD22	109.78	22	22	2.36E7	5	5	7	Y	32897	PLSP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g26610 PE=4 SV=1
1822	4969	A0A1I9LMR3	109.78	21	21	2.36E7	5	5	7	Y	34873	Plastidic type i signal peptidase 1 OS=Arabidopsis thaliana OX=3702 GN=PLSP1 PE=4 SV=1
1594	1907	A0A178VYU0	109.71	33	33	1.88E7	7	7	7	N	43638	AXS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g23840 PE=4 SV=1
1594	1908	Q9ZUY6	109.71	33	33	1.88E7	7	7	7	N	43638	UDP-D-apiose/UDP-D-xylose synthase 1 OS=Arabidopsis thaliana OX=3702 GN=AXS1 PE=1 SV=1
1220	3986	F4KCR8	109.68	11	11	1.16E7	7	7	7	Y	114984	Vps51/Vps67 family (Components of vesicular transport) protein OS=Arabidopsis thaliana OX=3702 GN=MQK4.2 PE=4 SV=1
1220	3990	Q9FFF3	109.68	10	10	1.16E7	7	7	7	Y	118802	Low density lipoprotein B-like protein OS=Arabidopsis thaliana OX=3702 GN=MQK4.2 PE=4 SV=1
1301	4810	A0A178V0K1	109.64	28	28	3.03E7	7	6	9	N	38921	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g20580 PE=4 SV=1
1301	4811	O23593	109.64	28	28	3.03E7	7	6	9	N	38905	RGG repeats nuclear RNA binding protein B OS=Arabidopsis thaliana OX=3702 GN=RGGB PE=1 SV=1
1223	3374	Q6NKS4	109.62	41	41	4.76E7	8	6	11	N	28601	Light-harvesting complex-like protein 3 isotype 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LIL3.2 PE=1 SV=1
1987	7070	A0A178ULL0	109.53	21	21	1.12E7	6	6	6	Y	52426	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g59620 PE=3 SV=1
1987	7071	Q9LST0	109.53	21	21	1.12E7	6	6	6	Y	52426	AT5g60160/f15l12_20 OS=Arabidopsis thaliana OX=3702 GN=At5g60160 PE=2 SV=1
1987	7072	Q8LF32	109.53	21	21	1.12E7	6	6	6	Y	52501	Aspartyl aminopeptidase-like protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1606	4241	A0A178U7C6	109.49	25	25	2.98E7	6	6	7	Y	47544	ELM1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g21670 PE=4 SV=1
1606	3529	Q93YN4	109.49	25	25	2.98E7	6	6	7	Y	47605	Mitochondrial fission protein ELM1 OS=Arabidopsis thaliana OX=3702 GN=ELM1 PE=1 SV=1
1245	1163	A0A178VHS3	109.36	30	30	9.21E7	9	6	10	Y	58645	Importin subunit alpha OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g06590 PE=3 SV=1
1245	1164	Q96321	109.36	30	30	9.21E7	9	6	10	Y	58645	Importin subunit alpha-1 OS=Arabidopsis thaliana OX=3702 GN=IMPA1 PE=1 SV=2
1490	2612	Q8RU07	109.29	22	22	3.05E7	5	5	6	Y	41523	EMBRYO DEFECTIVE 3147 OS=Arabidopsis thaliana OX=3702 GN=EMB3147 PE=2 SV=1
1749	7222	A0A178V7F4	109.29	29	29	4.65E7	6	6	6	Y	36595	NAGK OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g52130 PE=3 SV=1
1749	7223	Q9SCL7	109.29	29	29	4.65E7	6	6	6	Y	36595	Acetylglutamate kinase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NAGK PE=1 SV=1
1386	5180	Q9FLT9	109.21	34	34	1.25E8	8	7	10	Y	27772	Chloroplastic import inner membrane translocase subunit HP30-2 OS=Arabidopsis thaliana OX=3702 GN=HP30-2 PE=1 SV=1
1386	5181	A0A178UF81	109.21	34	34	1.25E8	8	7	10	Y	27772	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g24500 PE=4 SV=1
1303	6565	A0A178UYA3	109.17	35	35	6.22E7	7	7	11	N	27915	ER membrane protein complex subunit 3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g14210 PE=3 SV=1
1303	6566	Q9SU27	109.17	35	35	6.22E7	7	7	11	N	27915	ER membrane protein complex subunit 3 OS=Arabidopsis thaliana OX=3702 GN=At4g12590 PE=2 SV=1
1132	3226	Q9LHI0	109.14	68	68	8.99E7	7	6	10	N	15082	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Arabidopsis thaliana OX=3702 GN=At3g12260 PE=2 SV=1
1132	3227	A0A178VFH3	109.14	68	68	8.99E7	7	6	10	N	15082	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g12290 PE=4 SV=1
1745	6392	O48702	109.10	33	33	2.83E7	6	6	7	N	25340	Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g26340 PE=2 SV=2
1745	6393	A0A178VTP7	109.10	33	33	2.83E7	6	6	7	N	25340	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g22160 PE=4 SV=1
1745	6398	F4IUJ0	109.10	30	30	2.83E7	6	6	7	N	27824	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=At2g26340 PE=4 SV=1
1512	2130	A0A1P8BCR9	109.08	20	20	1.19E7	8	8	9	N	78062	Chaperone DnaJ-domain superfamily protein OS=Arabidopsis thaliana OX=3702 GN=ARC6 PE=4 SV=1
1512	2131	Q9FIG9	109.08	18	18	1.19E7	8	8	9	N	88260	Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ARC6 PE=1 SV=1
1512	2132	A0A178U7X4	109.08	18	18	1.19E7	8	8	9	N	88320	ARC6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g40340 PE=4 SV=1
1481	2478	Q8VXY9	109.03	27	27	2.34E7	8	8	9	Y	51487	Ureidoglycolate hydrolase OS=Arabidopsis thaliana OX=3702 GN=UAH PE=1 SV=1
1472	5280	Q9SAU2	108.96	34	34	6.92E7	5	5	9	Y	30009	D-ribulose-5-phosphate-3-epimerase OS=Arabidopsis thaliana OX=3702 GN=RPE PE=2 SV=1
1472	5281	A0A178UPG9	108.96	34	34	6.92E7	5	5	9	Y	30009	RPE OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g60890 PE=4 SV=1
1337	3894	Q8LDL0	108.93	32	32	6.72E7	5	5	6	N	26081	Protein HHL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HHL1 PE=1 SV=1
937	4268	Q9FF52	108.91	52	52	1.12E6	7	2	16	Y	17843	60S ribosomal protein L12-3 OS=Arabidopsis thaliana OX=3702 GN=RPL12C PE=2 SV=1
937	4269	A0A178UAV0	108.91	52	52	1.12E6	7	2	16	Y	17843	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g60130 PE=3 SV=1
1249	1325	O64948	108.86	16	16	1.06E7	8	8	10	N	97862	Lon protease homolog 2, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=LON2 PE=2 SV=1
1249	1326	A0A178UN51	108.86	16	16	1.06E7	8	8	10	N	97862	Lon protease homolog 2, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g45520 PE=3 SV=1
980	2066	Q9C9Q8	108.76	23	23	3.65E7	11	11	13	Y	77897	Probable pectin methyltransferase QUA2 OS=Arabidopsis thaliana OX=3702 GN=QUA2 PE=1 SV=2
1465	2753	A0A178UAH2	108.71	29	29	8.04E6	6	5	8	N	45751	RPT3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g57630 PE=3 SV=1
1465	2754	Q9SEI4	108.71	29	29	8.04E6	6	5	8	N	45751	26S proteasome regulatory subunit 6B homolog OS=Arabidopsis thaliana OX=3702 GN=RPT3 PE=1 SV=1
1040	1877	Q8VZV7	108.67	17	17	2.57E7	9	6	12	Y	69864	Probable methyltransferase PMT9 OS=Arabidopsis thaliana OX=3702 GN=At5g14430 PE=2 SV=1
1040	1878	A0A178UH64	108.67	17	17	2.57E7	9	6	12	Y	69864	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g13920 PE=4 SV=1
1040	1879	F4K6T0	108.67	17	17	2.57E7	9	6	12	Y	69890	S-adenosyl-L-methionine-dependent methyltransferases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g14430 PE=4 SV=1
773	4983	P51414	108.66	38	38	4.14E8	7	7	15	N	16945	60S ribosomal protein L26-1 OS=Arabidopsis thaliana OX=3702 GN=RPL26A PE=2 SV=2
773	4984	A0A178VF24	108.66	38	38	4.14E8	7	7	15	N	16945	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g44090 PE=4 SV=1
644	3185	A0A178VH97	108.63	49	49	1.56E8	9	4	14	Y	17957	EMB1080 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g43080 PE=3 SV=1
644	3186	P16181	108.63	49	49	1.56E8	9	4	14	Y	17957	40S ribosomal protein S11-1 OS=Arabidopsis thaliana OX=3702 GN=RPS11A PE=2 SV=1
1353	4194	A0A1B1W4U5	108.49	30	30	8.29E7	5	5	7	Y	25366	NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhK PE=3 SV=1
1353	4195	P56756	108.49	30	30	8.29E7	5	5	7	Y	25366	NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhK PE=3 SV=1
1176	3590	Q93Y07	108.46	18	18	4.37E7	9	9	10	Y	70779	Galactolipid galactosyltransferase SFR2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SFR2 PE=1 SV=1
1176	3591	A0A178VES5	108.46	18	18	4.37E7	9	9	10	Y	70779	SFR2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g06300 PE=3 SV=1
1196	2784	A0A178UH02	108.40	31	31	2.28E7	9	6	9	Y	54411	Pyruvate kinase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g55530 PE=3 SV=1
1196	2785	Q9FM97	108.40	31	31	2.28E7	9	6	9	Y	54411	Pyruvate kinase OS=Arabidopsis thaliana OX=3702 GN=MCD7.8 PE=2 SV=1
1728	3653	A0A178UQZ2	108.40	19	19	4.99E7	7	7	7	Y	54092	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g11600 PE=3 SV=1
1728	3654	Q94A94	108.40	19	19	4.99E7	7	7	7	Y	54164	Diaminopimelate decarboxylase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LYSA2 PE=1 SV=1
1385	2694	A0A178W3Y0	108.38	12	12	3.76E7	7	7	10	Y	82346	CSLE1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g50480 PE=3 SV=1
1385	2691	W8PVZ2	108.38	12	12	3.76E7	7	7	10	Y	82347	Glycosyltransferase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT1G55850 PE=2 SV=1
1385	2692	Q8VZK9	108.38	12	12	3.76E7	7	7	10	Y	82347	Cellulose synthase-like protein E1 OS=Arabidopsis thaliana OX=3702 GN=CSLE1 PE=2 SV=1
1237	4019	A0A178US54	108.35	28	28	1.02E8	4	4	8	N	32114	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g28630 PE=4 SV=1
1237	4020	Q0WWT7	108.35	28	28	1.02E8	4	4	8	N	32114	Rhodanese-like domain-containing protein 11, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=STR11 PE=2 SV=1
1793	3412	A0A384KJL6	108.33	14	14	2.87E7	5	5	6	Y	71752	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g22610 PE=4 SV=1
1793	3413	C0LGL2	108.33	14	14	2.87E7	5	5	6	Y	71752	Leucine-rich repeat receptor-like protein kinase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=LRR-RLK PE=2 SV=1
1793	3414	O48788	108.33	14	14	2.87E7	5	5	6	Y	71752	Probable inactive receptor kinase At2g26730 OS=Arabidopsis thaliana OX=3702 GN=At2g26730 PE=1 SV=1
1504	5024	A0A178VKE4	108.30	29	29	2.88E7	5	4	9	Y	27635	AOC2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g27810 PE=4 SV=1
1504	5025	Q9LS02	108.30	29	29	2.88E7	5	4	9	Y	27635	Allene oxide cyclase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AOC2 PE=1 SV=1
1045	2315	Q9M2D8	108.27	51	51	9.33E7	7	7	13	N	23144	Uncharacterized protein At3g61260 OS=Arabidopsis thaliana OX=3702 GN=At3g61260 PE=1 SV=1
1583	3811	Q93YR3	108.24	21	21	1.98E7	6	6	8	N	46621	FAM10 family protein At4g22670 OS=Arabidopsis thaliana OX=3702 GN=At4g22670 PE=1 SV=1
1252	2630	A0A178UBQ9	108.24	36	36	1.07E8	9	9	10	N	43526	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g37020 PE=4 SV=1
1252	2631	Q9FKA5	108.24	36	36	1.07E8	9	9	10	N	43526	Uncharacterized protein At5g39570 OS=Arabidopsis thaliana OX=3702 GN=At5g39570 PE=1 SV=1
1247	1707	Q9SJD4	108.24	22	22	1.96E7	11	9	11	Y	78343	Long chain acyl-CoA synthetase 8 OS=Arabidopsis thaliana OX=3702 GN=LACS8 PE=1 SV=1
1247	1708	A0A178VSW7	108.24	22	22	1.96E7	11	9	11	Y	78373	LACS8 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g03450 PE=4 SV=1
1607	6120	A0A178VMV4	108.13	36	36	1.71E7	6	6	8	N	31580	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g44620 PE=4 SV=1
1607	6121	Q8W4F1	108.13	36	36	1.71E7	6	6	8	N	31580	Probable plastid-lipid-associated protein 10, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PAP10 PE=1 SV=1
1313	3655	A0A178UCZ3	108.08	13	13	1.63E7	9	9	9	N	108867	CLPB3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g14960 PE=3 SV=1
1313	3656	Q9LF37	108.08	13	13	1.63E7	9	9	9	N	108943	Chaperone protein ClpB3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPB3 PE=1 SV=1
1054	3329	A0A384KNY4	108.07	33	33	5.03E7	8	7	9	Y	34707	Translocase of chloroplast OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g04460 PE=3 SV=1
1054	3330	B5RID3	108.07	33	33	5.03E7	8	7	9	Y	34707	Translocase of chloroplast OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1054	3331	Q38906	108.07	33	33	5.03E7	8	7	9	Y	34707	Translocase of chloroplast 34, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC34 PE=1 SV=2
857	3456	Q9SYX1	107.97	39	39	6.17E7	9	7	16	N	29403	Light-harvesting complex-like protein 3 isotype 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LIL3.1 PE=1 SV=1
857	3457	A0A178V5W4	107.97	39	39	6.17E7	9	7	16	N	29417	LIL3:1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g20680 PE=4 SV=1
1443	4670	A0A178VTJ1	107.95	27	27	3.37E7	6	6	8	N	36701	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g35410 PE=4 SV=1
1443	4671	Q9ZVH7	107.95	27	27	3.37E7	6	6	8	N	36701	Protein FATTY ACID EXPORT 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FAX3 PE=2 SV=2
1554	2098	A0A178WI60	107.94	17	17	8.35E6	6	6	6	Y	73042	Signal recognition particle subunit SRP72 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g61640 PE=3 SV=1
1554	2099	Q9FXD4	107.94	17	17	8.35E6	6	6	6	Y	73070	Signal recognition particle subunit SRP72 OS=Arabidopsis thaliana OX=3702 GN=At1g67680 PE=1 SV=1
1235	1899	A0A178WAS8	107.86	29	29	3.39E7	7	5	9	Y	58354	Phospho-2-dehydro-3-deoxyheptonate aldolase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g23540 PE=3 SV=1
1235	1900	Q9SK84	107.86	29	29	3.39E7	7	5	9	Y	58327	Phospho-2-dehydro-3-deoxyheptonate aldolase OS=Arabidopsis thaliana OX=3702 GN=At1g22410 PE=3 SV=1
1891	2279	F4IYF8	107.84	7	7	8.72E6	4	4	4	Y	97537	Histidine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At3g02760 PE=2 SV=1
1526	4965	A0A178W630	107.80	32	32	5.52E7	7	7	8	Y	31979	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g32960 PE=4 SV=1
1526	4966	Q9FVR6	107.80	32	32	5.52E7	7	7	8	Y	31979	Uncharacterized protein At1g32220, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g32220 PE=1 SV=1
1369	2589	Q8LAP2	107.77	37	37	4.21E7	7	7	9	N	34387	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1369	2590	A0A178WF98	107.77	37	37	4.21E7	7	7	9	N	34327	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g20090 PE=4 SV=1
1369	2591	Q9LMB2	107.77	37	37	4.21E7	7	7	9	N	34341	T29M8.1 protein OS=Arabidopsis thaliana OX=3702 GN=T29M8.1 PE=4 SV=1
1369	2592	F4IE14	107.77	37	37	4.21E7	7	7	9	N	34412	Ubiquinone biosynthesis COQ9-like protein OS=Arabidopsis thaliana OX=3702 GN=At1g19140 PE=4 SV=1
1377	3039	A0A178W8K1	107.72	28	28	5.07E7	6	6	9	Y	47215	Chorismate synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g42970 PE=3 SV=1
1377	3040	P57720	107.72	28	28	5.07E7	6	6	9	Y	47318	Chorismate synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=EMB1144 PE=2 SV=2
1377	3041	Q0WUP7	107.72	28	28	5.07E7	6	6	9	Y	47318	Chorismate synthase OS=Arabidopsis thaliana OX=3702 GN=At1g48850 PE=2 SV=1
1692	4011	Q84TI2	107.43	18	18	1.21E7	6	6	7	N	69752	Phosphoribosylaminoimidazole carboxylase like protein OS=Arabidopsis thaliana OX=3702 GN=At2g37690 PE=2 SV=1
1692	4012	A0A178VY57	107.43	18	18	1.21E7	6	6	7	N	69738	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g34510 PE=3 SV=1
1794	2448	Q9LVI9	107.37	25	25	2.4E7	6	6	7	Y	46847	Dihydropyrimidine dehydrogenase (NADP(+)), chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PYD1 PE=1 SV=1
1794	2449	A0A178VD08	107.37	25	25	2.4E7	6	6	7	Y	46847	PYD1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g18860 PE=4 SV=1
1884	59247	A0A1P8BDF7	107.32	38	38	2.61E7	5	5	5	Y	30476	Glucose-6-phosphate 1-epimerase OS=Arabidopsis thaliana OX=3702 GN=At5g66530 PE=3 SV=1
1884	59249	Q9FJY6	107.32	35	35	2.61E7	5	5	5	Y	33692	Glucose-6-phosphate 1-epimerase OS=Arabidopsis thaliana OX=3702 GN=At5g66530 PE=2 SV=1
1281	3613	F4J447	107.22	32	32	3.19E7	5	5	10	N	25563	Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g23600 PE=4 SV=1
1281	3614	Q9LUG8	107.22	32	32	3.19E7	5	5	10	N	25862	AT3g23600/MDB19_9 OS=Arabidopsis thaliana OX=3702 GN=At3g23600 PE=2 SV=1
1491	3843	B3H4I6	107.13	26	26	2.88E7	6	5	7	Y	39647	UDP-glucuronic acid decarboxylase 1 OS=Arabidopsis thaliana OX=3702 GN=UXS1 PE=1 SV=1
1491	3881	A0A178V9J6	107.13	21	21	2.88E7	6	5	7	Y	48631	UXS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g47910 PE=4 SV=1
1491	3882	Q8VZC0	107.13	21	21	2.88E7	6	5	7	Y	48631	UDP-glucuronic acid decarboxylase 1 OS=Arabidopsis thaliana OX=3702 GN=UXS1 PE=1 SV=1
1491	3896	F4JAG3	107.13	20	20	2.88E7	6	5	7	Y	51392	UDP-glucuronic acid decarboxylase 1 OS=Arabidopsis thaliana OX=3702 GN=UXS1 PE=1 SV=1
1374	1255	F4JLQ2	107.10	17	17	2.36E7	7	7	7	N	92369	Transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=At4g16180 PE=4 SV=1
1172	5651	A0A1P8BG38	107.05	28	28	3.29E7	9	9	11	N	58109	Glucose-6-phosphate isomerase OS=Arabidopsis thaliana OX=3702 GN=MJB21.12 PE=3 SV=1
1172	5653	A0A178UPP5	107.05	27	27	3.29E7	9	9	11	N	61718	Glucose-6-phosphate isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g40630 PE=3 SV=1
1172	5654	P34795	107.05	27	27	3.29E7	9	9	11	N	61718	Glucose-6-phosphate isomerase, cytosolic OS=Arabidopsis thaliana OX=3702 GN=PGIC PE=1 SV=1
1862	5058	Q9SMN0	107.01	31	31	3.47E7	5	5	6	Y	35567	Probable carboxylesterase 12 OS=Arabidopsis thaliana OX=3702 GN=CXE12 PE=1 SV=1
1552	4323	Q9FME4	106.99	20	20	5.46E7	8	8	8	Y	59144	Pentatricopeptide repeat-containing protein PNM1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PNM1 PE=1 SV=1
1552	4324	A0A178U8V9	106.99	20	20	5.46E7	8	8	8	Y	59144	PNM1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g60430 PE=4 SV=1
1010	3992	P49693	106.97	30	30	4.08E7	5	2	9	N	24202	60S ribosomal protein L19-3 OS=Arabidopsis thaliana OX=3702 GN=RPL19C PE=2 SV=3
1010	3993	A0A178UUL5	106.97	30	30	4.08E7	5	2	9	N	24202	Ribosomal protein L19 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g02830 PE=3 SV=1
1026	2321	A0A178WN30	106.89	32	32	4.3E7	7	7	11	Y	41497	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g06330 PE=4 SV=1
1026	2322	Q94A68	106.89	32	32	4.3E7	7	7	11	Y	41497	Uncharacterized oxidoreductase At1g06690, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g06690 PE=1 SV=1
1026	2323	A0A178WQ36	106.89	32	32	4.3E7	7	7	11	Y	41988	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g06330 PE=4 SV=1
1066	3387	A0A178VCI5	106.87	38	38	6.82E7	7	2	14	Y	23466	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g07020 PE=3 SV=1
1066	3388	Q9SFU1	106.87	38	38	6.82E7	7	2	14	Y	23466	60S ribosomal protein L13a-1 OS=Arabidopsis thaliana OX=3702 GN=RPL13AA PE=2 SV=1
1066	3384	F4JD96	106.87	38	38	6.82E7	7	2	14	Y	23594	Ribosomal protein L13 family protein OS=Arabidopsis thaliana OX=3702 GN=At3g07110 PE=3 SV=1
1064	3890	A0A178UEH3	106.86	43	43	2.31E8	8	8	13	Y	26486	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g19880 PE=4 SV=1
1064	3891	Q941D3	106.86	43	43	2.31E8	8	8	13	Y	26482	Probable plastid-lipid-associated protein 8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PAP8 PE=1 SV=1
1586	8034	A0A178UML5	106.83	15	15	3.43E7	5	5	7	N	56926	PGLCT OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g15720 PE=3 SV=1
1586	8039	Q56ZZ7	106.83	15	15	3.43E7	5	5	7	N	56970	Plastidic glucose transporter 4 OS=Arabidopsis thaliana OX=3702 GN=At5g16150 PE=1 SV=2
1586	8040	B9DGP1	106.83	15	15	3.43E7	5	5	7	N	56998	AT5G16150 protein OS=Arabidopsis thaliana OX=3702 GN=At5g16150 PE=2 SV=1
690	7627	P56779	106.83	51	51	1.94E9	8	8	20	Y	9387	Cytochrome b559 subunit alpha OS=Arabidopsis thaliana OX=3702 GN=psbE PE=1 SV=4
1771	6322	Q38954	106.80	16	16	2.78E7	4	4	7	Y	61419	Inorganic phosphate transporter 2-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PHT2-1 PE=1 SV=1
1771	6323	A0A178VMT8	106.80	16	16	2.78E7	4	4	7	Y	61419	Phosphate transporter OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g28850 PE=3 SV=1
957	2698	Q9LT39	106.77	32	32	1.92E7	7	7	9	Y	39862	Leucine-rich repeat (LRR) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g20820 PE=2 SV=1
957	2699	A0A384KGL0	106.77	32	32	1.92E7	7	7	9	Y	39862	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g22210 PE=4 SV=1
1571	4401	A0A178U932	106.49	20	20	8.53E6	6	6	6	Y	57527	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g10580 PE=3 SV=1
1571	4402	Q9LEU8	106.49	20	20	8.53E6	6	6	6	Y	57513	Argininosuccinate lyase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g10920 PE=2 SV=1
1067	4640	A0A178V4S8	106.42	46	46	1.71E8	9	8	14	N	17474	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g27440 PE=4 SV=1
1067	4641	Q9SUQ9	106.42	46	46	1.71E8	9	8	14	N	17474	AT4g23680/F9D16_150 OS=Arabidopsis thaliana OX=3702 GN=At4g23680 PE=2 SV=1
1553	4450	Q9FNF2	106.40	18	18	9.06E6	7	7	7	Y	72099	Starch synthase 1, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=SS1 PE=2 SV=1
1553	4451	W8QN76	106.40	18	18	9.06E6	7	7	7	Y	72099	Starch synthase, chloroplastic/amyloplastic (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT5G24300 PE=2 SV=1
1553	5133	A0A178UNQ3	106.40	18	18	9.06E6	7	7	7	Y	72070	Starch synthase, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g24080 PE=3 SV=1
1785	3827	Q9ZUX0	106.39	36	36	1.82E7	7	7	7	Y	43154	At2g27680/F15K20.22 OS=Arabidopsis thaliana OX=3702 GN=At2g27680 PE=2 SV=1
1785	3828	A0A178VNX8	106.39	36	36	1.82E7	7	7	7	Y	43154	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g23660 PE=4 SV=1
1557	3560	A0A178UEN7	106.38	17	17	1.59E7	6	6	8	N	57737	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g13720 PE=4 SV=1
1557	5188	A0A1P8BDE0	106.38	21	21	1.59E7	6	6	8	N	48142	Rubisco methyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=At5g14260 PE=1 SV=1
1557	3559	Q8VZB5	106.38	17	17	1.59E7	6	6	8	N	57585	Rubisco methyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=At5g14260 PE=1 SV=1
1557	4308	Q9LYA3	106.38	17	17	1.59E7	6	6	8	N	60128	Uncharacterized protein F18O22_50 OS=Arabidopsis thaliana OX=3702 GN=F18O22_50 PE=4 SV=1
1882	4833	O82384	106.38	23	23	1.04E6	6	4	6	Y	46885	FAD/NAD(P)-binding oxidoreductase family protein OS=Arabidopsis thaliana OX=3702 GN=CTF2B PE=2 SV=2
1882	4834	Q8LBA5	106.38	23	23	1.04E6	6	4	6	Y	46837	Putative monooxygenase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1234	3507	Q9LVM3	106.38	45	45	1.94E8	7	7	11	N	24104	YCF54 OS=Arabidopsis thaliana OX=3702 GN=EMB3143 PE=4 SV=1
1234	3508	A0A178UBD8	106.38	45	45	1.94E8	7	7	11	N	24104	EMB3143 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g57590 PE=4 SV=1
969	5336	Q8VYJ7	106.32	16	16	1.21E7	10	9	12	Y	108662	Chaperone protein ClpB4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CLPB4 PE=2 SV=1
1589	6320	Q5M727	106.28	36	36	2E8	5	5	8	Y	28167	At2g21160 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1589	6321	P45434	106.28	36	36	2E8	5	5	8	Y	28167	Translocon-associated protein subunit alpha OS=Arabidopsis thaliana OX=3702 GN=At2g21160 PE=2 SV=3
1392	3450	Q9LVT8	106.20	19	19	3.82E7	7	5	9	N	37999	RGG repeats nuclear RNA binding protein C OS=Arabidopsis thaliana OX=3702 GN=RGGC PE=1 SV=1
1392	3451	A0A178UQN5	106.20	19	19	3.82E7	7	5	9	N	37999	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g45700 PE=1 SV=1
1122	5166	Q9FVQ4	106.13	18	18	1.09E8	5	5	12	N	54017	Plastidal glycolate/glycerate translocator 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PLGG1 PE=1 SV=1
1122	5167	A0A178WQL6	106.13	18	18	1.09E8	5	5	12	N	54017	LrgB OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g32780 PE=4 SV=1
1446	3249	A0A178WCX5	105.96	36	36	1.19E7	6	2	7	Y	25378	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g17460 PE=3 SV=1
1446	3250	Q9FX83	105.96	36	36	1.19E7	6	2	7	Y	25378	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-B, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g16700 PE=1 SV=1
1205	4605	A0A384LA38	105.94	30	30	1.42E8	5	5	11	N	17602	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g07450 PE=4 SV=1
1205	4606	Q9SRR8	105.94	30	30	1.42E8	5	5	11	N	17602	2Fe-2S ferredoxin-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F21O3.19 PE=2 SV=1
1080	2647	Q8LAP5	105.92	28	28	7.6E7	9	9	11	Y	50926	Putative translation initiation factor eIF-2, gamma subunit OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1080	2648	O64490	105.92	28	28	7.6E7	9	9	11	Y	50853	Eukaryotic translation initiation factor 2 gamma subunit OS=Arabidopsis thaliana OX=3702 GN=EIF2 GAMMA PE=2 SV=1
1080	2649	A0A384KBB6	105.92	28	28	7.6E7	9	9	11	Y	50853	eIF2 GAMMA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g03460 PE=4 SV=1
1536	2240	Q0WVZ7	105.81	13	13	1.54E7	7	7	7	Y	100094	24 kDa vacuolar protein-like OS=Arabidopsis thaliana OX=3702 GN=At5g20655 PE=2 SV=1
1536	2241	A0A178U9I1	105.81	13	13	1.54E7	7	7	7	Y	100092	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g20640 PE=4 SV=1
1436	5328	Q9SZ46	105.80	17	17	1.14E7	5	5	6	Y	58919	Xanthotoxin 5-hydroxylase CYP82C4 OS=Arabidopsis thaliana OX=3702 GN=CYP82C4 PE=1 SV=1
1436	5329	A0A178V6C0	105.80	17	17	1.14E7	5	5	6	Y	58919	CYP82C4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g36590 PE=3 SV=1
1992	59303	Q8L7R2	105.78	33	33	1.86E7	5	5	6	Y	38529	Homoserine kinase OS=Arabidopsis thaliana OX=3702 GN=HSK PE=1 SV=1
894	2250	A0A178VEB0	105.74	14	14	1.64E7	11	11	13	Y	130918	TPLATE OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g00910 PE=4 SV=1
894	2251	F4J8D3	105.74	14	14	1.64E7	11	11	13	Y	130908	Protein TPLATE OS=Arabidopsis thaliana OX=3702 GN=TPLATE PE=1 SV=1
1734	4669	O65538	105.71	17	17	7.73E6	7	7	7	N	61561	Uncharacterized protein AT4g32610 OS=Arabidopsis thaliana OX=3702 GN=F4D11.190 PE=4 SV=1
1263	5441	Q9SK22	105.69	34	34	2.41E7	5	2	10	Y	16631	40S ribosomal protein S16-1 OS=Arabidopsis thaliana OX=3702 GN=RPS16A PE=2 SV=1
1263	5442	A0A178W2C4	105.69	34	34	2.41E7	5	2	10	Y	16631	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g06350 PE=3 SV=1
1791	2562	Q9FGT4	105.53	8	8	1.46E7	5	5	5	Y	106377	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
1791	2561	F4KDI6	105.53	8	8	1.46E7	5	5	5	Y	107676	Transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=At5g58100 PE=4 SV=1
1791	3037	A0A178UTU7	105.53	8	8	1.46E7	5	5	5	Y	107673	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g57430 PE=4 SV=1
1630	4088	Q9LMB7	105.49	17	17	1.5E7	7	7	7	Y	81119	F14D16.26 OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
1630	4085	A0A178WG19	105.49	17	17	1.5E7	7	7	7	Y	83018	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g20050 PE=4 SV=1
1630	4086	Q8L798	105.49	17	17	1.5E7	7	7	7	Y	83018	Inter-alpha-trypsin inhibitor heavy chain-like protein OS=Arabidopsis thaliana OX=3702 GN=At1g19110 PE=2 SV=1
1047	6075	O82204	105.42	39	39	3.8E8	5	5	13	Y	15895	60S ribosomal protein L28-1 OS=Arabidopsis thaliana OX=3702 GN=RPL28A PE=1 SV=1
1047	6076	A0A178VXA5	105.42	39	39	3.8E8	5	5	13	Y	15895	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g15070 PE=4 SV=1
1486	5671	A0A178U9Z1	105.22	28	28	3.98E7	6	6	8	Y	44361	Mfl1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g39940 PE=3 SV=1
1486	5672	Q9FHX2	105.22	28	28	3.98E7	6	6	8	Y	44361	Protein MITOFERRINLIKE 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MFL1 PE=2 SV=1
1448	3631	A0A178UVJ8	105.17	15	15	2.9E7	6	6	7	Y	53981	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g28200 PE=4 SV=1
1448	3632	Q8L642	105.17	15	15	2.9E7	6	6	7	Y	53975	Uncharacterized protein At4g24330 OS=Arabidopsis thaliana OX=3702 GN=At4g24330 PE=2 SV=1
1448	3633	Q9STW1	105.17	15	15	2.9E7	6	6	7	Y	53947	At4g24330 OS=Arabidopsis thaliana OX=3702 GN=At4g24330 PE=2 SV=1
1448	3634	Q8L978	105.17	15	15	2.9E7	6	6	7	Y	53848	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1463	3468	Q9LIA8	105.10	20	20	1.23E6	7	2	8	Y	53173	UDP-glucose 6-dehydrogenase 2 OS=Arabidopsis thaliana OX=3702 GN=UGD2 PE=1 SV=1
1463	3469	A0A178VPC3	105.10	20	20	1.23E6	7	2	8	Y	53174	UDP-glucose 6-dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g32260 PE=3 SV=1
1628	2177	Q8LPJ4	105.06	20	20	4.05E7	8	8	8	Y	68390	ABC transporter E family member 2 OS=Arabidopsis thaliana OX=3702 GN=ABCE2 PE=2 SV=1
1628	2178	A0A178UZT9	105.06	20	20	4.05E7	8	8	8	Y	68390	RLI2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g22710 PE=4 SV=1
1324	3537	A0A1P8B252	105.04	57	57	1E8	7	7	10	Y	17632	Peptidylprolyl isomerase OS=Arabidopsis thaliana OX=3702 GN=At2g43560 PE=4 SV=1
1324	3540	O22870	105.04	43	43	1E8	7	7	10	Y	23564	Peptidyl-prolyl cis-trans isomerase FKBP16-3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FKBP16-3 PE=1 SV=2
1324	3541	A0A178VVY6	105.04	43	43	1E8	7	7	10	Y	23564	Peptidylprolyl isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g41080 PE=4 SV=1
1411	3491	P46422	105.02	52	52	2.87E7	7	6	9	N	24129	Glutathione S-transferase F2 OS=Arabidopsis thaliana OX=3702 GN=GSTF2 PE=1 SV=3
1411	3492	A0A178V0A3	105.02	52	52	2.87E7	7	6	9	N	24129	GSTF2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g03160 PE=3 SV=1
1034	6092	P49201	104.98	35	35	2.03E8	5	5	13	Y	15736	40S ribosomal protein S23-2 OS=Arabidopsis thaliana OX=3702 GN=RPS23B PE=2 SV=2
1034	6093	A0A178UNB4	104.98	35	35	2.03E8	5	5	13	Y	15736	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g02130 PE=3 SV=1
1034	7321	A0A178VJU6	104.98	37	37	2.03E8	5	5	13	Y	15139	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g09320 PE=3 SV=1
1034	7322	Q9SF35	104.98	35	35	2.03E8	5	5	13	Y	15770	40S ribosomal protein S23-1 OS=Arabidopsis thaliana OX=3702 GN=RPS23A PE=2 SV=2
1034	7323	Q1H5G2	104.98	35	35	2.03E8	5	5	13	Y	15770	At3g09680 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1946	4879	B2CNE7	104.98	22	22	1.29E7	5	5	6	N	47457	Phytoene synthase OS=Arabidopsis thaliana OX=3702 GN=psy35 PE=2 SV=1
1946	4880	A0A178UPI1	104.98	22	22	1.29E7	5	5	6	N	47462	PSY OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g16870 PE=4 SV=1
1946	4881	P37271	104.98	22	22	1.29E7	5	5	6	N	47487	Phytoene synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSY1 PE=1 SV=2
1946	4882	F4KGX7	104.98	21	21	1.29E7	5	5	6	N	49223	PHYTOENE SYNTHASE OS=Arabidopsis thaliana OX=3702 GN=PSY PE=4 SV=1
1284	5157	Q9SEU6	104.96	42	42	1.08E8	6	6	10	Y	21172	Thioredoxin M4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g15360 PE=2 SV=2
1284	5158	A0A178VJ83	104.96	42	42	1.08E8	6	6	10	Y	21172	TRX-M4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g16090 PE=4 SV=1
1251	1510	A0A178W1F6	104.96	7	7	8.01E6	9	6	10	Y	251401	SFR3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g36920 PE=4 SV=1
1251	1511	Q38970	104.96	7	7	8.01E6	9	6	10	Y	251379	Acetyl-CoA carboxylase 1 OS=Arabidopsis thaliana OX=3702 GN=ACC1 PE=1 SV=1
1752	5237	A0A178UXU0	104.81	19	19	8.94E6	4	3	5	Y	39612	Thioredoxin reductase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g40490 PE=3 SV=1
1752	5238	Q39243	104.81	19	19	8.94E6	4	3	5	Y	39626	Thioredoxin reductase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NTR1 PE=1 SV=3
1218	7294	A0A1I9LMY7	104.78	37	37	1.88E8	6	3	12	N	12909	40S ribosomal protein S24 OS=Arabidopsis thaliana OX=3702 GN=At3g04920 PE=3 SV=1
1218	7298	Q9SS17	104.78	31	31	1.88E8	6	3	12	N	15372	40S ribosomal protein S24-1 OS=Arabidopsis thaliana OX=3702 GN=RPS24A PE=2 SV=1
1218	7299	A0A178VB55	104.78	31	31	1.88E8	6	3	12	N	15372	40S ribosomal protein S24 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g04400 PE=3 SV=1
1515	2236	Q94AR8	104.78	18	18	3.21E7	6	6	9	Y	55014	3-isopropylmalate dehydratase large subunit, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=IIL1 PE=1 SV=1
1515	2237	A0A178UWP5	104.78	18	18	3.21E7	6	6	9	Y	55024	IIL1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g15230 PE=4 SV=1
1381	4678	A0A178VHP8	104.67	61	61	8.42E7	6	6	8	Y	18734	GRX4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g16440 PE=4 SV=1
1381	4679	Q8LBK6	104.67	61	61	8.42E7	6	6	8	Y	18734	Monothiol glutaredoxin-S15, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GRXS15 PE=1 SV=2
1256	3124	O80501	104.62	37	37	7.4E7	7	6	11	N	23130	Ras-related protein RABH1b OS=Arabidopsis thaliana OX=3702 GN=RABH1B PE=1 SV=1
1256	3125	A0A178W0B3	104.62	37	37	7.4E7	7	6	11	N	23130	RAB6A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g42180 PE=4 SV=1
1375	59302	O65784	104.62	15	15	1.28E7	5	4	5	N	56374	Cytochrome P450 71B5 OS=Arabidopsis thaliana OX=3702 GN=CYP71B5 PE=2 SV=1
1375	5712	A0A178VGI1	104.62	8	8	1.28E7	5	4	5	N	103122	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g47680 PE=4 SV=1
1543	3994	A0A178VFK8	104.53	17	17	2.75E7	6	6	6	N	71277	Emb1796 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g43400 PE=4 SV=1
1543	3995	Q9M3A8	104.53	17	17	2.75E7	6	6	6	N	71293	Pentatricopeptide repeat-containing protein At3g49240, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB1796 PE=1 SV=1
1260	4718	P92959	104.52	33	33	1.99E8	8	8	10	Y	21977	50S ribosomal protein L24, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPL24 PE=2 SV=2
1260	4719	A0A178U954	104.52	33	33	1.99E8	8	8	10	Y	21977	SVR8 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g53700 PE=3 SV=1
1631	4506	Q0WUI8	104.40	32	32	1.16E7	7	3	8	Y	50926	Tryptophan synthase OS=Arabidopsis thaliana OX=3702 GN=At5g54810 PE=2 SV=1
1631	4507	A0A178UE41	104.40	32	32	1.16E7	7	3	8	Y	50901	Tryptophan synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g53930 PE=3 SV=1
1631	4508	P14671	104.40	32	32	1.16E7	7	3	8	Y	50926	Tryptophan synthase beta chain 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TSB1 PE=2 SV=1
1730	2371	Q93WN0	104.40	22	22	2.59E7	6	5	6	N	53937	Selenium-binding protein 2 OS=Arabidopsis thaliana OX=3702 GN=SBP2 PE=1 SV=1
1309	3599	A0A1P8AWA3	104.34	5	5	3.31E6	7	7	7	Y	223345	Phosphatidylinositol 3-and 4-kinase family protein OS=Arabidopsis thaliana OX=3702 GN=ATPI4K ALPHA PE=3 SV=1
1309	3600	A0A178WHK0	104.34	5	5	3.31E6	7	7	7	Y	224031	ATPI4K ALPHA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g43500 PE=3 SV=1
1309	3601	Q9SXA1	104.34	5	5	3.31E6	7	7	7	Y	224015	Phosphatidylinositol 4-kinase alpha 1 OS=Arabidopsis thaliana OX=3702 GN=PI4KA1 PE=1 SV=2
1861	3520	A0A178UPV3	104.29	6	6	1.05E7	6	6	6	Y	131116	Cation-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g23210 PE=3 SV=1
1861	3521	Q9LT02	104.29	6	6	1.05E7	6	6	6	Y	131115	Probable manganese-transporting ATPase PDR2 OS=Arabidopsis thaliana OX=3702 GN=PDR2 PE=1 SV=1
1418	59294	F4JGB9	104.28	22	22	1.76E7	7	7	8	N	58324	Malonyl-CoA decarboxylase family protein OS=Arabidopsis thaliana OX=3702 GN=At4g04320 PE=4 SV=1
1418	59295	Q7Y1Z8	104.28	22	22	1.76E7	7	7	8	N	58452	Malonyl-CoA decarboxylase family protein OS=Arabidopsis thaliana OX=3702 GN=At4g04320 PE=2 SV=1
1418	59296	A0A178UST6	104.28	22	22	1.76E7	7	7	8	N	58511	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g06120 PE=4 SV=1
1573	5986	A0A178UPK5	104.28	13	13	2.01E7	6	6	7	Y	57733	Coatomer subunit delta OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g04470 PE=3 SV=1
1573	4967	Q93Y22	104.28	13	13	2.01E7	6	6	7	Y	57719	Coatomer subunit delta OS=Arabidopsis thaliana OX=3702 GN=At5g05010 PE=1 SV=2
1573	4968	B9DGK9	104.28	13	13	2.01E7	6	6	7	Y	57719	Coatomer subunit delta OS=Arabidopsis thaliana OX=3702 GN=At5g05010 PE=2 SV=1
1409	4328	F4JHH5	104.28	10	10	1.36E7	5	5	5	N	88371	Exocyst complex component SEC15B OS=Arabidopsis thaliana OX=3702 GN=SEC15B PE=1 SV=1
1409	4330	A0A178V0N8	104.28	10	10	1.36E7	5	5	5	N	90292	Exocyst complex component OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g02960 PE=3 SV=1
919	1521	Q9LV21	104.25	37	37	5.06E7	11	11	14	Y	57775	T-complex protein 1 subunit delta OS=Arabidopsis thaliana OX=3702 GN=CCT4 PE=1 SV=1
919	1522	A0A178V732	104.25	37	37	5.06E7	11	11	14	Y	57775	T-complex protein 1 subunit delta OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g19270 PE=3 SV=1
1102	7008	F4IBL0	104.22	31	31	1.53E8	7	7	12	Y	22209	Microsomal glutathione s-transferase OS=Arabidopsis thaliana OX=3702 GN=At1g65820 PE=4 SV=1
1102	7106	Q9SHX5	104.22	42	42	1.53E8	7	7	12	Y	16782	F1E22.17 OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
1102	7107	Q94BY2	104.22	42	42	1.53E8	7	7	12	Y	16586	At1g65820/F1E22_4 OS=Arabidopsis thaliana OX=3702 GN=At1g65820 PE=2 SV=1
1102	7108	F4IBK9	104.22	38	38	1.53E8	7	7	12	Y	18278	Microsomal glutathione s-transferase OS=Arabidopsis thaliana OX=3702 GN=At1g65820 PE=4 SV=1
2023	7274	A0A178W370	104.19	29	29	6.05E7	4	4	6	N	19878	Mitochondrial import inner membrane translocase subunit TIM23 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g66930 PE=3 SV=1
2023	7275	Q38820	104.19	29	29	6.05E7	4	4	6	N	19878	Mitochondrial import inner membrane translocase subunit TIM23-2 OS=Arabidopsis thaliana OX=3702 GN=TIM23-2 PE=1 SV=1
1560	5215	B9DHM5	104.10	12	12	3.15E7	5	5	7	Y	95393	Pyruvate, phosphate dikinase OS=Arabidopsis thaliana OX=3702 GN=At4g15530 PE=2 SV=1
1560	5216	A0A178UZQ3	104.10	12	12	3.15E7	5	5	7	Y	95359	Pyruvate, phosphate dikinase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g18140 PE=3 SV=1
1560	5217	O23404	104.10	11	11	3.15E7	5	5	7	Y	105138	Pyruvate, phosphate dikinase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPDK PE=1 SV=2
1330	3029	Q9C6S7	104.04	21	21	8.59E6	8	4	8	Y	68797	Probable methyltransferase PMT20 OS=Arabidopsis thaliana OX=3702 GN=At1g31850 PE=2 SV=1
1070	2454	A0A178VEP1	103.93	6	6	2.32E7	8	4	10	Y	172164	MRP10 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g57000 PE=4 SV=1
1070	2455	Q9LZJ5	103.93	6	6	2.32E7	8	4	10	Y	172136	ABC transporter C family member 14 OS=Arabidopsis thaliana OX=3702 GN=ABCC14 PE=1 SV=1
1265	6064	O80517	103.91	24	24	1.17E8	3	3	7	Y	20354	Uclacyanin-2 OS=Arabidopsis thaliana OX=3702 GN=At2g44790 PE=2 SV=1
983	2490	Q9C920	103.88	42	42	6.82E7	9	9	14	Y	32245	3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=KDSB PE=1 SV=1
983	2491	A0A1P8AVI3	103.88	39	39	6.82E7	9	9	14	Y	34922	Nucleotide-diphospho-sugar transferases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=CKS PE=3 SV=1
983	2894	A0A178W2K9	103.88	42	42	6.82E7	9	9	14	Y	32245	KDSB OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g47290 PE=3 SV=1
1382	2567	Q9LV48	103.84	11	11	3.9E7	5	5	8	Y	69272	Proline-rich receptor-like protein kinase PERK1 OS=Arabidopsis thaliana OX=3702 GN=PERK1 PE=1 SV=1
1175	1274	A0A178WDC7	103.81	23	23	1.27E7	9	9	10	Y	68676	MAML-4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g19420 PE=3 SV=1
1175	1275	Q9LPR4	103.81	23	23	1.27E7	9	9	10	Y	68676	2-isopropylmalate synthase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=IPMS1 PE=1 SV=2
1410	1875	Q9SSD2	103.72	4	4	8.91E6	6	6	6	N	275425	Pre-mRNA-processing-splicing factor 8A OS=Arabidopsis thaliana OX=3702 GN=PRP8A PE=1 SV=1
1410	1876	A0A178W7J7	103.72	4	4	8.91E6	6	6	6	N	275425	SUS2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g74920 PE=4 SV=1
1635	3458	A0A178ULQ2	103.66	23	23	3.08E7	7	7	8	N	51093	MRS2-11 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g22300 PE=4 SV=1
1635	3459	Q058N4	103.66	23	23	3.08E7	7	7	8	N	51093	Magnesium transporter MRS2-11, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MRS2-11 PE=1 SV=1
1400	3593	A0A178W1J2	103.54	33	33	2.12E7	7	7	10	Y	40819	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g75240 PE=4 SV=1
1400	3594	A0A1P8AMB3	103.54	31	31	2.12E7	7	7	10	Y	44067	p-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g80380 PE=4 SV=1
1400	3595	F4HS63	103.54	26	26	2.12E7	7	7	10	Y	50260	p-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g80380 PE=4 SV=1
1400	3596	A0A178W0T4	103.54	26	26	2.12E7	7	7	10	Y	51018	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g75240 PE=4 SV=1
1400	3597	Q944I4	103.54	26	26	2.12E7	7	7	10	Y	51018	D-glycerate 3-kinase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GLYK PE=1 SV=2
1328	1817	Q9ZVS4	103.50	33	33	1.21E7	8	6	9	Y	45717	Eukaryotic aspartyl protease family protein OS=Arabidopsis thaliana OX=3702 GN=F15K9.17 PE=2 SV=1
1328	1818	Q8LF70	103.50	33	33	1.21E7	8	6	9	Y	45822	EDGP OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1328	1819	A0A178W8S3	103.50	33	33	1.21E7	8	6	9	Y	45717	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g02460 PE=3 SV=1
1806	3197	A0A178WLU9	103.22	16	16	1.33E7	5	5	6	Y	54018	PMEAMT OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g42710 PE=4 SV=1
1806	3198	A0A178WLJ9	103.22	15	15	1.33E7	5	5	6	Y	56046	PMEAMT OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g42710 PE=4 SV=1
1806	3199	Q944H0	103.22	15	15	1.33E7	5	5	6	Y	56046	Phosphomethylethanolamine N-methyltransferase OS=Arabidopsis thaliana OX=3702 GN=NMT2 PE=1 SV=2
1806	3200	A0A178WLK2	103.22	14	14	1.33E7	5	5	6	Y	59245	PMEAMT OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g42710 PE=4 SV=1
1742	6848	Q9FUZ2	103.18	32	32	3.32E7	5	5	7	Y	30610	Peptide deformylase 1B, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDF1B PE=1 SV=2
1742	7478	A0A178U947	103.18	32	32	3.32E7	5	5	7	Y	30541	Peptide deformylase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g14150 PE=3 SV=1
1225	1723	A0A178WIH5	103.12	26	26	7.77E7	7	7	8	Y	51066	PnsB1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g16750 PE=4 SV=1
1225	1724	Q9S9N6	103.12	26	26	7.77E7	7	7	8	Y	51022	Photosynthetic NDH subunit of subcomplex B 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PNSB1 PE=2 SV=1
1579	5271	Q94AZ5	103.12	26	26	4.05E7	5	5	6	N	30337	Alanine-tRNA ligase OS=Arabidopsis thaliana OX=3702 GN=At2g45060 PE=1 SV=1
1579	5272	A0A178VZU1	103.12	26	26	4.05E7	5	5	6	N	30337	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g42640 PE=1 SV=1
1082	6935	F4IB62	103.10	16	16	3.49E7	9	9	11	Y	95297	Leucine-rich repeat protein kinase family protein OS=Arabidopsis thaliana OX=3702 GN=At1g51805 PE=4 SV=1
1082	6587	A0A178WF19	103.10	16	16	3.49E7	9	9	11	Y	98046	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g46040 PE=4 SV=1
1082	6588	F4IB63	103.10	16	16	3.49E7	9	9	11	Y	98076	Leucine-rich repeat protein kinase family protein OS=Arabidopsis thaliana OX=3702 GN=At1g51805 PE=4 SV=1
1577	4716	Q42586	103.02	19	19	1.65E7	6	6	6	Y	51850	Uridine 5'-monophosphate synthase OS=Arabidopsis thaliana OX=3702 GN=PYRE-F PE=2 SV=2
1577	4717	A0A178V9W3	103.02	19	19	1.65E7	6	6	6	Y	51880	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g48900 PE=3 SV=1
1137	2372	Q8LPK4	103.00	12	12	2.9E7	8	8	9	Y	112299	AP-2 complex subunit alpha-2 OS=Arabidopsis thaliana OX=3702 GN=ALPHAC-AD PE=1 SV=1
1137	2334	A0A178UMB9	103.00	12	12	2.9E7	8	8	9	Y	112274	AP-2 complex subunit alpha OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g22190 PE=3 SV=1
1137	2335	Q8LPL6	103.00	12	12	2.9E7	8	8	9	Y	112150	AP-2 complex subunit alpha-1 OS=Arabidopsis thaliana OX=3702 GN=ALPHA-ADR PE=1 SV=1
1137	2375	A0A178USA0	103.00	12	12	2.9E7	8	8	9	Y	112312	AP-2 complex subunit alpha OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g22200 PE=3 SV=1
1116	4503	Q9SLK0	102.98	19	19	2.87E6	8	3	10	Y	47234	Peroxisomal isocitrate dehydrogenase [NADP] OS=Arabidopsis thaliana OX=3702 GN=ICDH PE=1 SV=1
1811	3693	A0A178WGQ2	102.97	25	25	1.59E7	5	5	7	Y	36625	GLX2-4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g05660 PE=3 SV=1
1811	3694	Q8LDW8	102.97	25	25	1.59E7	5	5	7	Y	36625	Probable hydroxyacylglutathione hydrolase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GLX2-4 PE=2 SV=1
1599	3301	F4IVT2	102.96	25	25	7.4E6	6	6	6	Y	52551	MOS4-associated complex 3B OS=Arabidopsis thaliana OX=3702 GN=MAC3B PE=4 SV=1
1599	3314	O22785	102.96	23	23	7.4E6	6	6	6	Y	56728	Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=PRP19B PE=1 SV=3
1597	1976	Q9M888	102.95	23	23	2.23E7	8	8	8	N	58950	T-complex protein 1 subunit zeta 1 OS=Arabidopsis thaliana OX=3702 GN=CCT6A PE=1 SV=1
1002	2693	Q8LPR8	102.93	17	17	7.46E7	11	11	13	Y	99954	Protein TIC 100 OS=Arabidopsis thaliana OX=3702 GN=TIC100 PE=1 SV=1
1602	1810	A0A1P8ATX7	102.86	7	7	1.37E6	6	4	7	Y	147948	Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g15290 PE=4 SV=1
1602	1815	Q9XI40	102.86	6	6	1.37E6	6	4	7	Y	177121	F9L1.23 protein OS=Arabidopsis thaliana OX=3702 GN=F9L1.23 PE=4 SV=1
1602	1816	F4HZK4	102.86	6	6	1.37E6	6	4	7	Y	177633	Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g15290 PE=4 SV=1
1522	5092	Q42403	102.73	57	57	8.72E7	7	7	8	N	13109	Thioredoxin H3 OS=Arabidopsis thaliana OX=3702 GN=TRX3 PE=1 SV=1
1522	5093	A0A178U9K5	102.73	57	57	8.72E7	7	7	8	N	13109	Thioredoxin OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g40920 PE=3 SV=1
1511	4420	A0A178UL75	102.71	36	36	2.08E7	8	8	8	Y	33025	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g19260 PE=4 SV=1
1511	4421	Q93WI0	102.71	36	36	2.08E7	8	8	8	Y	32980	Rhodanese-like/PpiC domain-containing protein 12, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g19370 PE=1 SV=1
1406	5245	P56793	102.68	48	48	1.36E8	5	5	9	N	15294	50S ribosomal protein L16, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rpl16 PE=3 SV=1
1406	5246	A0A1B1W4X4	102.68	48	48	1.36E8	5	5	9	N	15485	50S ribosomal protein L16, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rpl16 PE=3 SV=1
1604	3102	A0A178VAM7	102.58	27	27	3.43E7	7	7	8	Y	47059	VEN6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g30260 PE=3 SV=1
1604	3103	Q9LVW7	102.58	27	27	3.43E7	7	7	8	Y	47059	Carbamoyl-phosphate synthase small chain, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CARA PE=1 SV=1
1387	4427	P56801	102.57	50	50	4.65E7	6	6	8	Y	15479	30S ribosomal protein S8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rps8 PE=3 SV=1
1387	4428	A0A1B1W4X7	102.57	50	50	4.65E7	6	6	8	Y	15479	30S ribosomal protein S8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rps8 PE=3 SV=1
1665	4369	A0A178VBL2	102.57	21	21	1.24E7	6	6	7	N	67072	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g04880 PE=3 SV=1
1665	3932	Q8RY11	102.57	18	18	1.24E7	6	6	7	N	78709	Aminopeptidase P2 OS=Arabidopsis thaliana OX=3702 GN=APP2 PE=2 SV=1
1473	6089	O65660	102.52	34	34	1.8E8	6	5	9	Y	20136	PLAT domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=PLAT1 PE=1 SV=1
1473	6090	A0A178V098	102.52	34	34	1.8E8	6	5	9	Y	20136	PLAT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g45110 PE=4 SV=1
1991	5192	A0A178VPE4	102.50	42	42	5.4E6	5	3	6	Y	27337	Proteasome subunit alpha type OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g45530 PE=3 SV=1
1991	5193	P30186	102.50	42	42	5.4E6	5	3	6	Y	27337	Proteasome subunit alpha type-7-A OS=Arabidopsis thaliana OX=3702 GN=PAD1 PE=1 SV=1
1215	6148	A0A178VU31	102.46	42	42	5.12E7	6	4	11	Y	15329	40S ribosomal protein S12 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g28360 PE=3 SV=1
1215	6149	Q9SKZ3	102.46	42	42	5.12E7	6	4	11	Y	15329	40S ribosomal protein S12-2 OS=Arabidopsis thaliana OX=3702 GN=RPS12C PE=1 SV=1
1435	4361	O04922	102.45	69	69	6.22E7	8	8	8	Y	18945	Probable glutathione peroxidase 2 OS=Arabidopsis thaliana OX=3702 GN=GPX2 PE=1 SV=1
1435	4362	A0A178VYF3	102.45	69	69	6.22E7	8	8	8	Y	18945	Glutathione peroxidase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g27810 PE=3 SV=1
1513	4950	O04202	102.41	44	44	1.96E8	7	7	9	Y	31862	Eukaryotic translation initiation factor 3 subunit F OS=Arabidopsis thaliana OX=3702 GN=TIF3F1 PE=1 SV=1
2025	6227	A0A178VHH9	102.40	26	26	3.39E7	5	5	6	N	24347	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g51860 PE=4 SV=1
2025	6228	Q93V66	102.40	26	26	3.39E7	5	5	6	N	24347	Protein FATTY ACID EXPORT 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FAX1 PE=1 SV=1
1211	3859	A0A1B1W4T3	102.38	35	35	1.07E8	8	8	12	Y	26904	30S ribosomal protein S2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rps2 PE=3 SV=1
1211	3860	P56797	102.38	35	35	1.07E8	8	8	12	Y	26904	30S ribosomal protein S2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rps2 PE=3 SV=1
1092	5601	Q9FLN4	102.38	31	31	1.52E8	5	5	12	N	21737	50S ribosomal protein L27, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPL27 PE=2 SV=1
1496	3122	O04420	102.33	29	29	5.37E7	6	6	9	N	34881	Uricase OS=Arabidopsis thaliana OX=3702 GN=At2g26230 PE=1 SV=2
1496	3123	A0A178VYS6	102.33	29	29	5.37E7	6	6	9	N	34895	Uricase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g22060 PE=3 SV=1
1563	4900	Q9FFW9	102.24	29	29	1.32E8	4	4	7	Y	39570	Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MBB18.5 PE=2 SV=1
1563	4901	A0A178U860	102.24	29	29	1.32E8	4	4	7	Y	39600	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g35850 PE=4 SV=1
1563	4902	Q8LD65	102.24	29	29	1.32E8	4	4	7	Y	39618	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1563	4903	F4KBJ3	102.24	28	28	1.32E8	4	4	7	Y	40992	Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MBB18.5 PE=4 SV=1
940	6823	Q8LCA1	102.24	37	37	4.31E8	5	5	13	N	18482	Protein CURVATURE THYLAKOID 1B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CURT1B PE=1 SV=2
940	6824	A0A178VZ38	102.24	37	37	4.31E8	5	5	13	N	18482	TMP14 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g44530 PE=4 SV=1
2217	5551	O22229	102.15	13	13	5.12E6	4	4	4	Y	57950	NADPH-dependent thioredoxin reductase 3 OS=Arabidopsis thaliana OX=3702 GN=NTRC PE=1 SV=2
2217	5552	A0A178VZE7	102.15	13	13	5.12E6	4	4	4	Y	57950	Thioredoxin reductase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g38950 PE=3 SV=1
2095	4680	Q9LZK5	102.08	23	23	2.07E7	5	5	5	Y	39200	DnaJ protein ERDJ3B OS=Arabidopsis thaliana OX=3702 GN=ERDJ3B PE=1 SV=1
2095	4681	A0A178V8F1	102.08	23	23	2.07E7	5	5	5	Y	39200	ERDJ3B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g56900 PE=4 SV=1
1733	2271	A0A178VQA5	102.07	20	20	3.51E6	5	5	5	Y	48965	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g21830 PE=4 SV=1
1733	2272	O80998	102.07	20	20	3.51E6	5	5	5	Y	48979	Jacalin-related lectin 20 OS=Arabidopsis thaliana OX=3702 GN=JAL20 PE=2 SV=1
1596	3885	Q9MAK9	102.02	29	29	1.76E7	7	6	8	N	44756	26S proteasome regulatory subunit S10B homolog B OS=Arabidopsis thaliana OX=3702 GN=RPT4B PE=1 SV=1
1596	3886	A0A178W2Z6	102.02	29	29	1.76E7	7	6	8	N	44756	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g40670 PE=3 SV=1
1308	7279	Q8LC83	101.98	31	31	8.06E7	6	3	10	Y	15419	40S ribosomal protein S24-2 OS=Arabidopsis thaliana OX=3702 GN=RPS24B PE=2 SV=2
1308	7280	A0A178US36	101.98	31	31	8.06E7	6	3	10	Y	15389	40S ribosomal protein S24 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g28240 PE=3 SV=1
1462	2036	A0A178W7Y1	101.96	22	22	8.3E6	7	4	8	Y	61460	Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta OS=Arabidopsis thaliana OX=3702 GN=PFP-BETA PE=3 SV=1
1462	2037	Q8W4M5	101.96	22	22	8.3E6	7	4	8	Y	61460	Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 1 OS=Arabidopsis thaliana OX=3702 GN=PFP-BETA1 PE=1 SV=1
1489	3957	P05466	101.96	17	17	3.69E6	7	2	8	Y	55734	3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g45300 PE=2 SV=3
1865	4537	A0A097PQG1	101.93	11	11	7.68E6	5	5	6	Y	69093	ABC1-like kinase (Fragment) OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1865	4538	Q9MA15	101.93	10	10	7.68E6	5	5	6	Y	79022	Protein ACTIVITY OF BC1 COMPLEX KINASE 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABC1K3 PE=1 SV=1
1865	4539	A0A178WNJ7	101.93	10	10	7.68E6	5	5	6	Y	79022	ABC1K3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g74400 PE=4 SV=1
1129	2593	A0A178W355	101.90	16	16	4.78E7	9	9	13	Y	83284	Mg-protoporphyrin IX chelatase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g08350 PE=3 SV=1
1129	2594	Q9SJE1	101.90	16	16	4.78E7	9	9	13	Y	83284	Magnesium-chelatase subunit ChlD, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CHLD PE=1 SV=3
1023	1897	O22203	101.89	24	24	2.77E7	10	9	10	Y	57927	Cytochrome P450 98A3 OS=Arabidopsis thaliana OX=3702 GN=CYP98A3 PE=1 SV=1
1023	1898	A0A178VTT8	101.89	24	24	2.77E7	10	9	10	Y	57927	CYP98A3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g38040 PE=3 SV=1
1850	3180	Q9SVU2	101.88	23	23	1.91E7	6	6	6	Y	37228	Uncharacterized protein AT4g28740 OS=Arabidopsis thaliana OX=3702 GN=F16A16.150 PE=2 SV=1
1850	3181	F4JM22	101.88	22	22	1.91E7	6	6	6	Y	38887	LOW PSII ACCUMULATION-like protein OS=Arabidopsis thaliana OX=3702 GN=At4g28740 PE=1 SV=1
1699	5076	Q8W4E6	101.72	23	23	2.84E7	6	6	7	N	40973	Hydroxyproline O-arabinosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=HPAT1 PE=1 SV=1
1699	5077	A0A178UGC6	101.72	23	23	2.84E7	6	6	7	N	40973	Hydroxyproline O-arabinosylatransferase 1 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT5G25265.1 PE=2 SV=1
1699	5078	A0A384KAX2	101.72	23	23	2.84E7	6	6	7	N	40973	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g25130 PE=4 SV=1
1836	1186	F4KHD5	101.68	4	4	5.42E6	6	6	6	N	323006	A-kinase anchor-like protein OS=Arabidopsis thaliana OX=3702 GN=MPO12.160 PE=1 SV=1
1836	1205	A0A178UEK3	101.68	4	4	5.42E6	6	6	6	N	323063	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g38180 PE=4 SV=1
1836	1187	Q9FND5	101.68	4	4	5.42E6	6	6	6	N	325355	Similarity to heat shock protein OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
1709	3757	F4JAF3	101.63	22	22	7.93E7	5	5	6	N	38403	Chloroplast RNA-binding protein 29 OS=Arabidopsis thaliana OX=3702 GN=CP29 PE=4 SV=1
1709	3083	Q43349	101.63	24	24	7.93E7	5	5	6	N	36007	29 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP29A PE=2 SV=2
1709	3084	A0A178VFP8	101.63	24	24	7.93E7	5	5	6	N	36021	CP29 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g47850 PE=4 SV=1
1276	3169	A0A178UWE7	101.61	34	34	3.11E7	7	7	10	Y	30105	Tic22-IV OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g38140 PE=4 SV=1
1276	3170	Q9SZB2	101.61	34	34	3.11E7	7	7	10	Y	30105	Protein TIC 22, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIC22 PE=1 SV=1
1639	1867	A0A384KGR2	101.60	26	26	1.51E7	6	3	7	Y	38847	Peroxidase OS=Arabidopsis thaliana OX=3702 GN=AXX17_ATUG02000 PE=3 SV=1
1639	1868	Q9LHB9	101.60	26	26	1.51E7	6	3	7	Y	38847	Peroxidase 32 OS=Arabidopsis thaliana OX=3702 GN=PER32 PE=1 SV=3
1639	1869	B9DHE0	101.60	26	26	1.51E7	6	3	7	Y	38847	Peroxidase OS=Arabidopsis thaliana OX=3702 GN=At3g32980 PE=2 SV=1
1203	3586	P46312	101.58	26	26	6.41E7	6	6	9	Y	51226	Omega-6 fatty acid desaturase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FAD6 PE=1 SV=2
1203	3587	A0A178V0M7	101.58	26	26	6.41E7	6	6	9	Y	51226	SFD4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g35480 PE=4 SV=1
1738	4415	O04507	101.56	20	20	2.26E7	6	6	6	Y	45685	F21M12.24 protein OS=Arabidopsis thaliana OX=3702 GN=F21M12.24 PE=3 SV=1
1738	4416	Q93XC2	101.56	19	19	2.26E7	6	6	6	Y	48142	Papain-like cysteine peptidase XBCP3 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1738	4417	Q0WVJ5	101.56	19	19	2.26E7	6	6	6	Y	48073	At1g09850 OS=Arabidopsis thaliana OX=3702 GN=XBCP3 PE=2 SV=1
1177	4212	Q9C5G5	101.47	16	16	3.08E7	7	6	9	Y	68238	Phosphoinositide phosphatase SAC7 OS=Arabidopsis thaliana OX=3702 GN=SAC7 PE=2 SV=1
1177	4213	A0A178VA55	101.47	16	16	3.08E7	7	6	9	Y	68238	RHD4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g45770 PE=4 SV=1
1056	4562	Q9SLV3	101.40	24	24	2.27E8	9	9	13	Y	45036	At1g58270/F19C14_8 OS=Arabidopsis thaliana OX=3702 GN=ZW9 PE=2 SV=1
1697	59996	A0A178VJU1	101.23	33	33	8.53E6	6	4	7	Y	39405	DIN4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g13790 PE=4 SV=1
1697	108045	Q9LDY2	101.23	33	33	8.53E6	6	4	7	Y	39419	2-oxoisovalerate dehydrogenase subunit beta 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DIN4 PE=1 SV=1
1688	2506	Q9LTL0	101.12	24	24	1.76E7	7	6	7	N	57080	Cytochrome P450 71B26 OS=Arabidopsis thaliana OX=3702 GN=CYP71B26 PE=2 SV=1
1688	2949	A0A178VFZ5	101.12	24	24	1.76E7	7	6	7	N	57103	CYP71B26 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g28500 PE=3 SV=1
1688	2508	A0A1I9LRI3	101.12	23	23	1.76E7	7	6	7	N	58589	Cytochrome P450, family 71, subfamily B, polypeptide 26 OS=Arabidopsis thaliana OX=3702 GN=CYP71B26 PE=3 SV=1
955	2644	A0A178UR93	101.11	11	11	1E7	9	9	10	Y	134638	Alpha-mannosidase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g14420 PE=3 SV=1
955	2645	Q9LFR0	101.11	11	11	1E7	9	9	10	Y	134726	Alpha-mannosidase 2 OS=Arabidopsis thaliana OX=3702 GN=GMII PE=1 SV=1
1352	5255	O48646	101.06	42	42	6.88E7	6	6	8	Y	25584	Probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GPX6 PE=2 SV=2
1352	5256	A0A178V0M2	101.06	42	42	6.88E7	6	6	8	Y	25845	Glutathione peroxidase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g13080 PE=3 SV=1
995	4923	B3H4S6	101.02	18	18	3.2E8	6	6	13	Y	59027	Dicarboxylate transporter 1 OS=Arabidopsis thaliana OX=3702 GN=DiT1 PE=4 SV=1
995	4924	Q9LXV3	101.02	18	18	3.2E8	6	6	13	Y	59213	Dicarboxylate transporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DIT1 PE=1 SV=1
995	4925	A0A178UA33	101.02	18	18	3.2E8	6	6	13	Y	59213	DiT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g12290 PE=4 SV=1
1544	3736	A0A178UDZ0	100.94	19	19	2.04E7	6	6	8	Y	51804	PDE129 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g62330 PE=3 SV=1
1544	3079	Q9XFS9	100.94	19	19	2.04E7	6	6	8	Y	51964	1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DXR PE=2 SV=2
1227	3602	Q94A65	100.92	42	42	1.22E8	7	7	11	Y	24872	Rhodanese-like domain-containing protein 14, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At4g27700 PE=2 SV=1
1227	3603	A0A178V203	100.92	42	42	1.22E8	7	7	11	Y	24872	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g31920 PE=4 SV=1
1889	3720	A0A178UCS5	100.89	20	20	1.3E7	6	6	6	Y	47381	ATMDAR2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g02950 PE=4 SV=1
1889	3721	Q93WJ8	100.89	20	20	1.3E7	6	6	6	Y	47480	Monodehydroascorbate reductase 2 OS=Arabidopsis thaliana OX=3702 GN=MDAR2 PE=1 SV=1
1074	1909	A0A1P8ARE4	100.89	18	18	2.15E7	11	11	12	N	109838	FTSH protease 12 OS=Arabidopsis thaliana OX=3702 GN=FTSH12 PE=4 SV=1
1074	1910	A0A1P8ARD2	100.89	17	17	2.15E7	11	11	12	N	113061	FTSH protease 12 OS=Arabidopsis thaliana OX=3702 GN=FTSH12 PE=4 SV=1
1074	1911	Q9SAJ3	100.89	17	17	2.15E7	11	11	12	N	115105	ATP-dependent zinc metalloprotease FTSH 12, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FTSH12 PE=2 SV=2
1074	1912	A0A384KD52	100.89	17	17	2.15E7	11	11	12	N	115105	FTSH12 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g74360 PE=4 SV=1
1074	1913	B9DHQ6	100.89	17	17	2.15E7	11	11	12	N	115105	AT1G79560 protein OS=Arabidopsis thaliana OX=3702 GN=At1g79560 PE=2 SV=1
1009	4121	F4JRX3	100.69	9	9	1.51E7	7	7	9	Y	141563	DNA topoisomerase, type IA, core OS=Arabidopsis thaliana OX=3702 GN=At4g31210 PE=3 SV=1
1009	4119	A0A1P8B5K1	100.69	9	9	1.51E7	7	7	9	Y	141098	DNA topoisomerase, type IA, core OS=Arabidopsis thaliana OX=3702 GN=At4g31210 PE=3 SV=1
1138	3046	A0A178V7X9	100.65	23	23	1.3E7	10	3	10	Y	99372	Beta-adaptin-like protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g12860 PE=3 SV=1
1138	3047	Q9SUS3	100.65	23	23	1.3E7	10	3	10	Y	99372	Beta-adaptin-like protein B OS=Arabidopsis thaliana OX=3702 GN=BETAB-AD PE=1 SV=1
1138	3077	F4JNZ8	100.65	22	22	1.3E7	10	3	10	Y	101916	Beta-adaptin-like protein OS=Arabidopsis thaliana OX=3702 GN=At4g11380 PE=1 SV=1
1259	2663	P25864	100.53	37	37	1.48E8	7	7	11	N	22134	50S ribosomal protein L9, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPL9 PE=2 SV=1
1259	2664	A0A178VBQ7	100.53	37	37	1.48E8	7	7	11	N	22134	RPL9 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g38710 PE=3 SV=1
1097	2671	F4JF21	100.51	18	18	2.09E7	9	9	11	N	78814	Protein PLASTID TRANSCRIPTIONALLY ACTIVE 10 OS=Arabidopsis thaliana OX=3702 GN=PTAC10 PE=1 SV=1
1097	2672	A0A178VIV9	100.51	18	18	2.09E7	9	9	11	N	78814	TAC10 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g42620 PE=4 SV=1
1440	3511	A0A097PSW2	100.50	10	10	1.31E7	7	7	9	Y	92172	Embryo yellow protein (Fragment) OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1440	3512	Q0WQF0	100.50	10	10	1.31E7	7	7	9	Y	92285	Uncharacterized protein At5g51430 OS=Arabidopsis thaliana OX=3702 GN=At5g51430 PE=2 SV=1
1440	3513	A0A178UMB5	100.50	10	10	1.31E7	7	7	9	Y	92259	EYE OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g50220 PE=1 SV=1
1440	3514	Q9FGN0	100.50	10	10	1.31E7	7	7	9	Y	92259	Conserved oligomeric Golgi complex component-related / COG complex component-like protein OS=Arabidopsis thaliana OX=3702 GN=EYE PE=1 SV=1
1440	3518	B1Q4S9	100.50	10	10	1.31E7	7	7	9	Y	92281	Conserved oligomeric Golgi complex component 7-related OS=Arabidopsis thaliana OX=3702 GN=EYE PE=2 SV=1
1378	3809	A0A178W7B0	100.49	25	25	1.56E8	6	5	8	N	31928	Lactoylglutathione lyase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g12200 PE=1 SV=1
1378	3810	O65398	100.49	25	25	1.56E8	6	5	8	N	31928	Lactoylglutathione lyase GLX1 OS=Arabidopsis thaliana OX=3702 GN=GLX1 PE=1 SV=1
1930	59472	A0A1P8ASG0	100.47	22	22	9.24E6	6	6	6	Y	58046	Transporter associated with antigen processing protein 1 OS=Arabidopsis thaliana OX=3702 GN=ABCB26 PE=4 SV=1
1930	59418	A0A178W3D9	100.47	16	16	9.24E6	6	6	6	Y	78039	TAP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g64780 PE=4 SV=1
1930	59419	Q8RY46	100.47	16	16	9.24E6	6	6	6	Y	78039	ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABCB26 PE=1 SV=1
1527	3615	A0A178UG39	100.45	27	27	1.89E8	7	7	9	Y	25573	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g52450 PE=4 SV=1
1527	3616	P81760	100.45	27	27	1.89E8	7	7	9	Y	25644	Thylakoid lumenal 17.4 kDa protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TL17 PE=1 SV=2
1527	3617	A0A178UI74	100.45	27	27	1.89E8	7	7	9	Y	25644	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g52450 PE=4 SV=1
1527	3618	F4JX83	100.45	25	25	1.89E8	7	7	9	Y	27225	Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MNC6.3 PE=4 SV=1
1527	3619	A0A1P8BAQ0	100.45	24	24	1.89E8	7	7	9	Y	28254	Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MNC6.3 PE=4 SV=1
1530	6154	Q8GYC7	100.44	26	26	2.88E6	5	3	6	Y	34909	PGR5-like protein 1B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGRL1B PE=1 SV=1
1530	6155	A0A178V1R6	100.44	26	26	2.88E6	5	3	6	Y	34939	PGRL1B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g13460 PE=4 SV=1
1525	5203	Q9SSQ3	100.39	24	24	2.12E7	5	5	8	Y	41855	F6D8.27 protein OS=Arabidopsis thaliana OX=3702 GN=F6D8.27 PE=4 SV=1
1525	5204	A0A178W824	100.39	24	24	2.12E7	5	5	8	Y	41839	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g46790 PE=4 SV=1
1525	5205	Q8VZ57	100.39	24	24	2.12E7	5	5	8	Y	41839	Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g52510 PE=2 SV=1
1619	4405	Q9S720	100.36	45	45	2.57E7	6	6	8	N	27490	PsbP domain-containing protein 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPD3 PE=1 SV=2
1619	4406	A0A178WJJ8	100.36	45	45	2.57E7	6	6	8	N	27490	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g70920 PE=4 SV=1
1174	2078	Q96283	100.34	65	65	1.36E7	11	5	12	N	23849	Ras-related protein RABA2c OS=Arabidopsis thaliana OX=3702 GN=RABA2C PE=2 SV=4
1174	2079	A0A178V892	100.34	65	65	1.36E7	11	5	12	N	23849	RABA2c OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g40740 PE=4 SV=1
1595	3134	Q0WSR1	100.33	35	35	2.32E7	8	8	8	N	47372	Aminoacylase like protein (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At1g44820 PE=2 SV=1
1595	3135	Q9LPE9	100.33	34	34	2.32E7	8	8	8	N	48959	At1g44820 OS=Arabidopsis thaliana OX=3702 GN=At1g44820 PE=2 SV=1
1595	3136	A0A178W446	100.33	34	34	2.32E7	8	8	8	N	48929	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g40500 PE=4 SV=1
1666	1188	A0A1P8B8I3	100.31	19	19	7.08E6	6	6	6	Y	59882	Plant intracellular ras group-related LRR 4 OS=Arabidopsis thaliana OX=3702 GN=PIRL4 PE=1 SV=1
1666	1189	Q9SVW8	100.31	19	19	7.08E6	6	6	6	Y	60995	Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana OX=3702 GN=PIRL4 PE=1 SV=1
1666	1190	A0A178UV21	100.31	19	19	7.08E6	6	6	6	Y	60995	PIRL4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g40500 PE=4 SV=1
1689	4724	Q9ZVA7	100.31	26	26	8.48E6	7	7	7	Y	50104	F9K20.7 protein OS=Arabidopsis thaliana OX=3702 GN=At1g78880 PE=1 SV=1
1689	59312	A0A178WI32	100.31	26	26	8.48E6	7	7	7	Y	50104	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g73560 PE=1 SV=1
1261	4495	Q940F6	100.28	13	13	2.43E7	4	4	6	Y	60825	Glutathione reductase OS=Arabidopsis thaliana OX=3702 GN=T5N23.2 PE=2 SV=1
1261	3799	Q5FV38	100.28	13	13	2.43E7	4	4	6	Y	60852	Glutathione reductase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1261	3801	P42770	100.28	13	13	2.43E7	4	4	6	Y	60852	Glutathione reductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=EMB2360 PE=2 SV=1
1425	2657	A0A178V7U2	100.28	3	3	1.15E7	4	4	5	Y	225782	DNA-directed RNA polymerase subunit OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g52240 PE=3 SV=1
1368	2156	Q9ZVS5	100.27	22	22	9.44E6	7	5	9	Y	46148	Eukaryotic aspartyl protease family protein OS=Arabidopsis thaliana OX=3702 GN=At1g03230 PE=2 SV=1
1712	4932	A0A178UVL1	100.13	12	12	5.63E6	4	4	5	Y	60129	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g31020 PE=3 SV=1
1712	4933	Q8H104	100.13	12	12	5.63E6	4	4	5	Y	60333	Aspartate--tRNA ligase 1, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g26870 PE=2 SV=1
1798	2597	Q9SRH6	100.02	29	29	3.14E7	5	4	6	Y	31321	Hypersensitive-induced response protein 3 OS=Arabidopsis thaliana OX=3702 GN=HIR3 PE=1 SV=1
1798	2598	A0A178V7M0	100.02	29	29	3.14E7	5	4	6	Y	31321	HIR2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g00330 PE=4 SV=1
1600	6505	Q39099	99.99	32	32	3.35E7	7	7	8	N	34291	Xyloglucan endotransglucosylase/hydrolase protein 4 OS=Arabidopsis thaliana OX=3702 GN=XTH4 PE=1 SV=1
1600	6506	A0A178VUP5	99.99	32	32	3.35E7	7	7	8	N	34291	Xyloglucan endotransglucosylase/hydrolase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g05630 PE=3 SV=1
1528	5013	A0A178W8F9	99.86	70	70	4.18E7	6	6	8	N	16164	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g14450 PE=1 SV=1
1528	5014	Q9XI93	99.86	70	70	4.18E7	6	6	8	N	16164	At1g13930/F16A14.27 OS=Arabidopsis thaliana OX=3702 GN=F7A19.2 PE=1 SV=1
1564	4749	A0A178V1W8	99.72	34	34	4.57E7	6	6	6	Y	28385	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g39100 PE=4 SV=1
1564	4750	Q93V74	99.72	34	34	4.57E7	6	6	6	Y	28385	Cyclase-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=CYCLASE1 PE=1 SV=1
1393	5521	A0A178UKD2	99.69	41	41	1.29E8	5	5	8	N	17187	FRO1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g67700 PE=4 SV=1
1393	5522	Q9FJW4	99.69	41	41	1.29E8	5	5	8	N	17134	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FRO1 PE=1 SV=1
1322	2258	Q8RX87	99.69	17	17	9.29E6	7	7	7	Y	83116	Probable galactinol--sucrose galactosyltransferase 6 OS=Arabidopsis thaliana OX=3702 GN=RFS6 PE=2 SV=2
1322	2264	F4K470	99.69	15	15	9.29E6	7	7	7	Y	94216	Raffinose synthase family protein OS=Arabidopsis thaliana OX=3702 GN=DIN10 PE=4 SV=1
1561	3430	A0A178VM04	99.65	14	14	5.94E7	5	5	7	Y	67602	Lysine--tRNA ligase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g13830 PE=3 SV=1
1561	3431	Q9LJE2	99.65	14	14	5.94E7	5	5	7	Y	67588	Lysine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA5 PE=2 SV=1
1350	6275	A0A178V4H4	99.65	37	37	4.43E7	7	7	10	Y	29018	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g27380 PE=4 SV=1
1350	6276	Q9SUR4	99.65	37	37	4.43E7	7	7	10	Y	29018	Ribosomal protein L25/Gln-tRNA synthetase, anti-codon-binding domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At4g23620 PE=2 SV=1
1444	4317	Q94F09	99.58	21	21	3.61E7	6	6	7	N	49851	Protein disulfide-isomerase 5-2 OS=Arabidopsis thaliana OX=3702 GN=PDIL5-2 PE=1 SV=1
1507	7248	Q8GSJ6	99.53	40	40	4.19E7	5	5	8	Y	16334	Protein disulfide-isomerase LQY1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LQY1 PE=1 SV=1
1507	7249	A0A178W9N8	99.53	40	40	4.19E7	5	5	8	Y	16334	LQY1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g70140 PE=4 SV=1
1236	4158	P42733	99.43	38	38	6.07E7	7	2	10	Y	17749	40S ribosomal protein S11-3 OS=Arabidopsis thaliana OX=3702 GN=RPS11C PE=2 SV=2
1236	4159	A0A178UPD3	99.43	38	38	6.07E7	7	2	10	Y	17749	RPS11-BETA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g23310 PE=3 SV=1
1575	1894	Q9SGT3	99.38	19	19	3.2E7	6	6	8	N	45401	Obg-like ATPase 1 OS=Arabidopsis thaliana OX=3702 GN=T6H22.14 PE=3 SV=1
1575	1895	F4I3J0	99.38	19	19	3.2E7	6	6	8	N	45628	Obg-like ATPase 1 OS=Arabidopsis thaliana OX=3702 GN=At1g56050 PE=3 SV=1
1575	1896	A0A178W9E9	99.38	19	19	3.2E7	6	6	8	N	45628	Obg-like ATPase 1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g50720 PE=3 SV=1
1682	5566	Q9M2Z4	99.35	30	30	3.78E7	4	3	6	N	25382	Membrane steroid-binding protein 2 OS=Arabidopsis thaliana OX=3702 GN=MSBP2 PE=1 SV=1
1417	9169	Q9LKU8	99.24	15	15	1.75E7	8	8	9	Y	86966	Pentatricopeptide repeat-containing protein At5g28460 OS=Arabidopsis thaliana OX=3702 GN=At5g28460 PE=2 SV=1
1532	5187	P56773	99.19	26	26	6.64E8	5	5	9	N	24153	Cytochrome b6 OS=Arabidopsis thaliana OX=3702 GN=petB PE=1 SV=1
1539	3009	A0A178US02	99.19	17	17	5.01E7	6	6	8	Y	51205	RD21B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g40980 PE=3 SV=1
1539	3010	Q9FMH8	99.19	17	17	5.01E7	6	6	8	Y	51204	Probable cysteine protease RD21B OS=Arabidopsis thaliana OX=3702 GN=RD21B PE=1 SV=1
1641	5363	A0A178UD45	99.15	7	7	7.65E6	5	5	5	Y	140892	PIR2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g02490 PE=4 SV=1
1641	5364	Q9S814	99.15	7	7	7.65E6	5	5	5	Y	140956	Ethylene-insensitive protein 2 OS=Arabidopsis thaliana OX=3702 GN=EIN2 PE=1 SV=1
1646	5260	Q9M885	99.15	40	40	1.21E7	6	4	7	Y	22196	40S ribosomal protein S7-2 OS=Arabidopsis thaliana OX=3702 GN=RPS7B PE=2 SV=1
1646	5261	A0A178VB48	99.15	40	40	1.21E7	6	4	7	Y	22196	40S ribosomal protein S7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g01800 PE=3 SV=1
1228	3024	Q42599	99.13	36	36	2.62E7	7	3	8	Y	25503	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-A, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g79010 PE=1 SV=1
1555	6815	A0A178W2P4	99.08	9	9	1.49E7	7	7	7	Y	102093	GRP23 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g10340 PE=4 SV=1
1555	6816	Q9SY69	99.08	9	9	1.49E7	7	7	7	Y	102093	Pentatricopeptide repeat-containing protein At1g10270 OS=Arabidopsis thaliana OX=3702 GN=GRP23 PE=1 SV=1
1372	2214	Q93YZ7	99.02	19	19	2.96E7	8	8	8	Y	53873	Acetolactate synthase small subunit 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g31810 PE=1 SV=1
1372	2215	A0A178VQ69	99.02	19	19	2.96E7	8	8	8	Y	53873	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g28020 PE=4 SV=1
1556	4530	A0A178W1Q7	99.00	22	22	4.97E7	6	6	7	N	40785	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g04680 PE=4 SV=1
1556	4531	Q8GXY6	99.00	22	22	4.97E7	6	6	7	N	40742	At1g05270 OS=Arabidopsis thaliana OX=3702 GN=YUP8H12.12 PE=2 SV=1
1866	2447	F4IBH5	98.93	10	10	2.86E7	5	5	6	N	83561	LETM1-like protein OS=Arabidopsis thaliana OX=3702 GN=LETM2 PE=4 SV=1
1333	3573	F4J7Z8	98.91	15	15	1.74E7	8	8	8	Y	87372	E3 UFM1-protein ligase-like protein OS=Arabidopsis thaliana OX=3702 GN=At3g46220 PE=1 SV=1
1333	3578	Q9LX73	98.91	15	15	1.74E7	8	8	8	Y	89073	E3 UFM1-protein ligase 1 homolog OS=Arabidopsis thaliana OX=3702 GN=At3g46220 PE=1 SV=1
1333	3579	A0A178V6K0	98.91	15	15	1.74E7	8	8	8	Y	89103	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g40110 PE=4 SV=1
1405	6070	A0A384KJY5	98.90	47	47	1.03E8	5	5	10	Y	17776	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g17890 PE=4 SV=1
1405	6071	Q9LSP5	98.90	47	47	1.03E8	5	5	10	Y	17776	AT3g17020/K14A17_14 OS=Arabidopsis thaliana OX=3702 GN=At3g17020 PE=2 SV=1
1388	5852	Q9ZWT2	98.82	54	54	1.27E8	6	6	9	Y	15097	Cytochrome B5 isoform D OS=Arabidopsis thaliana OX=3702 GN=CYTB5-D PE=1 SV=1
1388	5853	A0A178UMW9	98.82	54	54	1.27E8	6	6	9	Y	15097	CYTB5-B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g47490 PE=3 SV=1
1797	4520	Q9M0V6	98.77	28	28	2.52E7	5	5	6	Y	42396	Ferredoxin--NADP reductase, root isozyme 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RFNR1 PE=2 SV=2
1797	4521	A0A178USX5	98.77	28	28	2.52E7	5	5	6	Y	42380	Ferredoxin--NADP reductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g04730 PE=3 SV=1
1466	3582	Q94B60	98.76	30	30	3.77E7	6	6	8	N	31498	ATP-dependent Clp protease proteolytic subunit 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPP4 PE=1 SV=1
1466	3583	A0A178UBN3	98.76	30	30	3.77E7	6	6	8	N	31488	ATP-dependent Clp protease proteolytic subunit OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g43680 PE=3 SV=1
1310	4792	Q0WLC6	98.74	11	11	3.47E7	7	7	7	Y	119771	Pentatricopeptide repeat-containing protein MRL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MRL1 PE=1 SV=2
1310	4793	A0A178V2I9	98.74	11	11	3.47E7	7	7	7	Y	119771	PDE346 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g39810 PE=4 SV=1
1155	4257	A0A178VY43	98.72	6	6	7.14E6	7	3	9	Y	169032	MRP4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g45570 PE=4 SV=1
1155	4258	Q7DM58	98.72	6	6	7.14E6	7	3	9	Y	169079	ABC transporter C family member 4 OS=Arabidopsis thaliana OX=3702 GN=ABCC4 PE=1 SV=2
1238	4353	A0A178UA59	98.67	31	31	2.83E7	6	4	8	N	27764	Peptidylprolyl isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g12830 PE=4 SV=1
1238	4354	Q9LYR5	98.67	31	31	2.83E7	6	4	8	N	27778	Peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FKBP19 PE=1 SV=1
1933	4087	O22714	98.64	15	15	2E7	5	5	5	N	55905	Pentatricopeptide repeat-containing protein At1g60770 OS=Arabidopsis thaliana OX=3702 GN=At1g60770 PE=2 SV=1
1826	6475	F4IWB6	98.61	16	16	1.38E7	5	5	6	N	41816	Translocation protein-like protein OS=Arabidopsis thaliana OX=3702 GN=At3g20920 PE=4 SV=1
1826	6476	Q9LIH2	98.61	16	16	1.38E7	5	5	6	N	41944	Translocation protein-like protein OS=Arabidopsis thaliana OX=3702 GN=At3g20920 PE=2 SV=1
1826	6477	Q8L9Y8	98.61	16	16	1.38E7	5	5	6	N	42043	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1826	6478	A0A178VMS2	98.61	16	16	1.38E7	5	5	6	N	41958	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g22320 PE=4 SV=1
1383	4794	Q9SP02	98.60	54	54	1.42E8	8	6	9	N	21961	Peptidyl-prolyl cis-trans isomerase CYP20-1 OS=Arabidopsis thaliana OX=3702 GN=CYP20-1 PE=1 SV=1
1383	4795	A0A178UBF4	98.60	54	54	1.42E8	8	6	9	N	21961	Peptidyl-prolyl cis-trans isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g58100 PE=3 SV=1
1609	59313	Q9FFW8	98.54	20	20	3.83E7	6	6	7	N	55742	Tryptophan synthase beta chain OS=Arabidopsis thaliana OX=3702 GN=TSBtype2 PE=2 SV=1
1609	59314	A0A178UFQ0	98.54	20	20	3.83E7	6	6	7	N	55756	TSBtype2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g35860 PE=3 SV=1
1842	5389	Q9LQ04	98.54	28	28	3.1E6	5	3	5	Y	33597	Bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose reductase OS=Arabidopsis thaliana OX=3702 GN=NRS/ER PE=1 SV=1
1134	7168	P93303	98.49	32	32	3.96E8	8	8	13	Y	18211	ATP synthase protein YMF19 OS=Arabidopsis thaliana OX=3702 GN=YMF19 PE=1 SV=1
1134	7169	G1C2R4	98.49	32	32	3.96E8	8	8	13	Y	18211	ATPase subunit 8 OS=Arabidopsis thaliana OX=3702 GN=atp8 PE=4 SV=1
2326	7244	P94014	98.43	47	47	4.05E7	4	4	4	Y	22868	Germin-like protein subfamily 2 member 1 OS=Arabidopsis thaliana OX=3702 GN=GLP4 PE=2 SV=2
1101	3609	P42763	98.41	51	51	1.42E8	8	8	13	N	20786	Dehydrin ERD14 OS=Arabidopsis thaliana OX=3702 GN=ERD14 PE=1 SV=1
1101	3610	A0A178WC69	98.41	51	51	1.42E8	8	8	13	N	20786	ERD14 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g70630 PE=3 SV=1
1445	3685	A0A178W4V2	98.13	23	23	1.75E7	7	3	9	Y	46679	ACLA-1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g10810 PE=4 SV=1
1445	3686	Q9SGY2	98.13	23	23	1.75E7	7	3	9	Y	46679	ATP-citrate synthase alpha chain protein 1 OS=Arabidopsis thaliana OX=3702 GN=ACLA-1 PE=1 SV=1
1445	4454	F4I5V8	98.13	22	22	1.75E7	7	3	9	Y	49049	ATP-citrate lyase A-1 OS=Arabidopsis thaliana OX=3702 GN=ACLA-1 PE=4 SV=1
1413	59370	Q5HZ00	98.05	27	27	1.23E7	6	6	7	N	46401	Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SPS3 PE=1 SV=1
1413	59371	A0A178VT82	98.05	27	27	1.23E7	6	6	7	N	46401	GPS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g31180 PE=3 SV=1
1420	5745	A0A1P8AX55	97.97	21	21	3.07E7	6	6	6	Y	39332	Proteasome endopeptidase complex OS=Arabidopsis thaliana OX=3702 GN=PAG1 PE=1 SV=1
2010	4270	A0A178URX8	97.93	55	55	7.99E7	4	4	6	Y	15065	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g07830 PE=4 SV=1
2010	4271	Q9SD78	97.93	55	55	7.99E7	4	4	6	Y	15038	Furry OS=Arabidopsis thaliana OX=3702 GN=F13G24.260 PE=2 SV=1
2010	4272	Q8LCY6	97.93	55	55	7.99E7	4	4	6	Y	14996	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1311	4945	F4KBF3	97.79	9	9	9.41E6	5	5	5	N	79181	Probable acyl-activating enzyme 17, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=AAE17 PE=2 SV=1
1501	3723	Q6NL24	97.78	31	31	4.1E7	6	6	8	Y	28818	Probable enoyl-CoA hydratase 1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=ECHIA PE=1 SV=1
1501	3724	A0A178UTI7	97.78	31	31	4.1E7	6	6	8	Y	28790	ECHIA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g19030 PE=4 SV=1
1447	5465	Q8L770	97.76	21	21	7.94E7	6	6	8	N	36307	ATP-dependent Clp protease proteolytic subunit-related protein 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPR3 PE=1 SV=1
1447	5466	A0A178W952	97.76	21	21	7.94E7	6	6	8	N	36307	ATP-dependent Clp protease proteolytic subunit OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g08930 PE=3 SV=1
1447	5467	F4HZE0	97.76	19	19	7.94E7	6	6	8	N	40919	ATP-dependent Clp protease proteolytic subunit OS=Arabidopsis thaliana OX=3702 GN=At1g09130 PE=1 SV=1
1790	4062	Q9LIG6	97.68	45	45	2.49E7	6	4	7	Y	30504	NifU-like protein 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NIFU4 PE=2 SV=1
1255	3831	Q8L6Z4	97.68	23	23	4.29E7	8	8	10	N	47988	30S ribosomal protein S9, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RPS9M PE=1 SV=1
1255	3832	A0A178VJM9	97.68	23	23	4.29E7	8	8	10	N	47988	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g43230 PE=3 SV=1
1814	4844	A0A178W7G5	97.56	16	16	8.52E6	4	4	5	Y	57182	SRS OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g12230 PE=4 SV=1
1814	4845	A0A178W4R8	97.56	16	16	8.52E6	4	4	5	Y	57253	SRS OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g12230 PE=4 SV=1
1814	4846	Q8RWT8	97.56	16	16	8.52E6	4	4	5	Y	57352	Serine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA7 PE=2 SV=1
1814	4847	A0A178W5N3	97.56	16	16	8.52E6	4	4	5	Y	57352	SRS OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g12230 PE=4 SV=1
1624	5301	Q8LDV3	97.55	34	34	7.02E7	5	5	8	N	20430	Uncharacterized protein At4g13200, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At4g13200 PE=1 SV=2
1624	5302	A0A178UWJ4	97.55	34	34	7.02E7	5	5	8	N	20454	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g14890 PE=4 SV=1
1416	6216	O81016	97.55	3	3	3.17E6	4	2	6	Y	161264	ABC transporter G family member 32 OS=Arabidopsis thaliana OX=3702 GN=ABCG32 PE=1 SV=1
1416	6217	A0A178VNA5	97.55	3	3	3.17E6	4	2	6	Y	161264	PEC1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g22800 PE=3 SV=1
1746	5611	F4IGK5	97.48	29	29	7.77E6	5	3	5	Y	26457	NAD(P)-linked oxidoreductase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g21250 PE=4 SV=1
1746	5612	Q8LBG6	97.48	22	22	7.77E6	5	3	5	Y	34962	Putative NADPH dependent mannose 6-phosphate reductase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1746	5605	Q9SJV2	97.48	22	22	7.77E6	5	3	5	Y	35010	NAD(P)-linked oxidoreductase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g21250 PE=2 SV=1
1746	5606	A0A178W1B1	97.48	22	22	7.77E6	5	3	5	Y	35010	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g16730 PE=4 SV=1
1157	1556	A0A178UBV9	97.45	22	22	1.08E8	7	7	9	Y	57663	Biotin carboxylase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g32460 PE=4 SV=1
1157	1559	A0A178U9M2	97.45	21	21	1.08E8	7	7	9	Y	58387	Biotin carboxylase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g32460 PE=4 SV=1
1157	1560	O04983	97.45	21	21	1.08E8	7	7	9	Y	58387	Biotin carboxylase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CAC2 PE=1 SV=1
1157	1561	F4JYE0	97.45	21	21	1.08E8	7	7	9	Y	60771	Biotin carboxylase OS=Arabidopsis thaliana OX=3702 GN=CAC2 PE=1 SV=1
1318	59359	A0A178VGJ4	97.43	9	9	1.31E7	9	9	9	N	152284	Emb2458 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g03760 PE=4 SV=1
1318	59360	F4J3N2	97.43	9	9	1.31E7	9	9	9	N	152257	Probable inactive ATP-dependent zinc metalloprotease FTSHI 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FTSHI5 PE=2 SV=1
1736	3928	Q94AI6	97.38	12	12	1.53E7	6	6	7	Y	85674	Exocyst complex component SEC6 OS=Arabidopsis thaliana OX=3702 GN=SEC6 PE=1 SV=1
1736	3929	A0A178WN94	97.38	11	11	1.53E7	6	6	7	Y	88430	SEC6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g65940 PE=4 SV=1
1434	3944	O49339	97.29	36	36	4.16E6	7	3	9	Y	40500	PTI1-like tyrosine-protein kinase 2 OS=Arabidopsis thaliana OX=3702 GN=PTI12 PE=1 SV=1
1434	4236	A0A178VPH7	97.29	36	36	4.16E6	7	3	9	Y	40514	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g26860 PE=3 SV=1
2070	6017	Q9ZWT1	97.25	16	16	2.32E7	4	4	5	Y	41344	Lipoyl synthase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LIP1 PE=1 SV=1
2070	5991	A0A178VME8	97.25	16	16	2.32E7	4	4	5	Y	41403	Lipoyl synthase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LIP1 PE=3 SV=1
1125	8140	A0A178WBD4	97.24	26	26	3.46E7	4	4	10	N	16946	CURT1C OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g46480 PE=4 SV=1
1125	8141	Q9M812	97.24	26	26	3.46E7	4	4	10	N	16946	Protein CURVATURE THYLAKOID 1C, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CURT1C PE=1 SV=1
1592	108184	Q9SUB2	97.15	13	13	2.52E7	4	4	8	N	29422	Late embryogenesis abundant protein (LEA) family protein OS=Arabidopsis thaliana OX=3702 GN=At4g21020 PE=2 SV=1
1592	108185	A0A178V4K0	97.15	13	13	2.52E7	4	4	8	N	29373	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g24340 PE=4 SV=1
1488	3167	Q9S7Q2	97.12	13	13	1.28E7	7	7	7	Y	96326	Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PTAC2 PE=2 SV=1
1488	3168	A0A178WNJ2	97.12	13	13	1.28E7	7	7	7	Y	96326	PTAC2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g69230 PE=4 SV=1
1275	3065	Q9LZ82	97.11	42	42	6.42E7	9	9	10	N	33821	Protein BTR1 OS=Arabidopsis thaliana OX=3702 GN=BTR1 PE=1 SV=1
2228	5337	O49292	96.96	20	20	2.55E7	4	4	5	N	28501	PsbP domain-containing protein 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPD4 PE=1 SV=2
2228	5338	A0A178WHC8	96.96	20	20	2.55E7	4	4	5	N	28529	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g71600 PE=4 SV=1
1282	6591	Q9LKA5	96.94	21	21	1.33E8	7	7	10	Y	42870	Multiple organellar RNA editing factor 8, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MORF8 PE=1 SV=1
1282	6592	A0A178VHP9	96.94	21	21	1.33E8	7	7	10	Y	42860	RIP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g15640 PE=4 SV=1
1576	3546	O48737	96.78	51	51	4.59E7	6	6	7	Y	19665	Thioredoxin M1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g03680 PE=2 SV=1
1576	3547	A0A178W6J8	96.78	51	51	4.59E7	6	6	7	Y	19665	TRX-M1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g02940 PE=4 SV=1
1789	6183	A0A178V1M8	96.74	33	33	1.35E7	6	6	6	Y	35372	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g33460 PE=4 SV=1
1789	6184	Q9SZE1	96.74	33	33	1.35E7	6	6	6	Y	35372	Probable 3-hydroxyisobutyrate dehydrogenase-like 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g29120 PE=1 SV=1
1055	2666	A0A178VCA4	96.65	15	15	2.83E7	6	6	6	Y	73026	AtACBP4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g04960 PE=4 SV=1
1055	2667	Q9MA55	96.65	15	15	2.83E7	6	6	6	Y	73075	Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=ACBP4 PE=1 SV=1
1055	2668	A0A178VCG9	96.65	15	15	2.83E7	6	6	6	Y	73154	AtACBP4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g04960 PE=4 SV=1
1028	4637	Q93Y08	96.64	10	10	1.96E7	5	4	8	N	86023	Protein ACTIVITY OF BC1 COMPLEX KINASE 8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABC1K8 PE=2 SV=1
1028	4638	A0A178UDV1	96.64	10	10	1.96E7	5	4	8	N	86023	OSA1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g64650 PE=4 SV=1
1335	4067	O81816	96.61	21	21	2.35E7	6	6	7	N	45505	Monooxygenase 2 OS=Arabidopsis thaliana OX=3702 GN=MO2 PE=2 SV=1
1620	6043	A0A178VQZ7	96.59	28	28	3.91E7	5	5	8	Y	31656	S-formylglutathione hydrolase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g38800 PE=3 SV=1
1620	6044	Q8LAS8	96.59	28	28	3.91E7	5	5	8	Y	31656	S-formylglutathione hydrolase OS=Arabidopsis thaliana OX=3702 GN=SFGH PE=1 SV=2
1993	4357	O23717	96.55	31	31	1.89E7	5	5	6	Y	29668	Proteasome subunit beta type-5-A OS=Arabidopsis thaliana OX=3702 GN=PBE1 PE=1 SV=1
1993	4358	A0A178WCQ3	96.55	31	31	1.89E7	5	5	6	Y	29668	Proteasome subunit beta OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g13480 PE=3 SV=1
1533	6907	A0A384KXG3	96.53	50	50	5.29E7	5	5	7	N	16125	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g46660 PE=1 SV=1
1533	6908	Q9SUY2	96.53	50	50	5.29E7	5	5	7	N	16125	AT3g52230/F4F15_340 OS=Arabidopsis thaliana OX=3702 GN=F4F15.340 PE=1 SV=1
1429	7078	Q9SUI5	96.45	53	53	1.43E8	5	5	8	Y	13206	Photosystem I reaction center subunit psaK, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSAK PE=2 SV=2
1429	7079	A0A178WI16	96.45	53	53	1.43E8	5	5	8	Y	13206	PSAK OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g30810 PE=4 SV=1
1598	5330	Q9LZR5	96.43	34	34	3.38E7	7	7	8	N	31830	Histone deacetylase HDT3 OS=Arabidopsis thaliana OX=3702 GN=HDT3 PE=1 SV=2
1598	5331	A0A178UP12	96.43	34	34	3.38E7	7	7	8	N	31830	HDT3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g03060 PE=4 SV=1
1949	4321	Q93Y35	96.39	20	20	1.46E7	5	5	6	N	44282	26S proteasome non-ATPase regulatory subunit 6 homolog OS=Arabidopsis thaliana OX=3702 GN=RPN7 PE=1 SV=1
1949	4322	A0A178UUL4	96.39	20	20	1.46E7	5	5	6	N	44282	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g28720 PE=4 SV=1
1243	3137	Q8LD03	96.26	20	20	1.94E7	4	2	8	Y	22061	40S ribosomal protein S7-3 OS=Arabidopsis thaliana OX=3702 GN=RPS7C PE=1 SV=2
1243	3138	A0A178UHM5	96.26	20	20	1.94E7	4	2	8	Y	22061	40S ribosomal protein S7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g15700 PE=3 SV=1
1637	3470	Q8L5Y0	96.25	9	9	1.06E7	6	6	6	Y	110639	Vacuolar sorting protein 39 OS=Arabidopsis thaliana OX=3702 GN=VPS39 PE=1 SV=1
1637	3471	A0A178UXB5	96.25	9	9	1.06E7	6	6	6	Y	110639	EMB2754 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g41710 PE=4 SV=1
1567	4740	F4JCC9	96.22	16	16	1.08E7	8	7	8	Y	111362	P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g19740 PE=4 SV=1
1567	4741	A0A178V6H9	96.22	16	16	1.08E7	8	7	8	Y	111349	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g21010 PE=4 SV=1
1567	4823	Q9LJM2	96.22	57	57	1.08E7	8	7	8	Y	30027	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=3 SV=1
1535	4076	Q84R15	96.21	7	7	4.11E7	6	6	7	Y	130078	SH3 domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At2g07360 PE=1 SV=1
1535	4077	A0A178VS05	96.21	7	7	4.11E7	6	6	7	Y	130060	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g06100 PE=4 SV=1
1535	4078	F4IL68	96.21	7	7	4.11E7	6	6	7	Y	130344	SH3 domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At2g07360 PE=1 SV=1
2001	3056	A0A178W4A1	96.16	21	21	5.91E6	4	2	5	N	43847	3-isopropylmalate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g31810 PE=3 SV=1
2001	3057	Q9SA14	96.16	21	21	5.91E6	4	2	5	N	43847	3-isopropylmalate dehydrogenase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=IMDH3 PE=1 SV=2
2001	3058	A0A1P8AUM8	96.16	21	21	5.91E6	4	2	5	N	45771	3-isopropylmalate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=IMD3 PE=3 SV=1
1807	5074	A0A178VM28	96.13	33	33	2.59E7	5	4	7	N	23712	NACA2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g43600 PE=4 SV=1
1807	5075	Q94JX9	96.13	33	33	2.59E7	5	4	7	N	23712	Nascent polypeptide-associated complex subunit alpha-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At3g49470 PE=2 SV=2
2524	5136	A0A1P8B070	96.11	18	18	2.05E7	4	4	4	N	41392	Aldolase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g26800 PE=4 SV=1
2524	6209	A0A178VX90	96.11	15	15	2.05E7	4	4	4	N	47396	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g22690 PE=4 SV=1
2524	5137	O81027	96.11	15	15	2.05E7	4	4	4	N	50577	Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HMGCL PE=1 SV=2
2524	6210	A0A178VYN7	96.11	14	14	2.05E7	4	4	4	N	51588	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g22690 PE=4 SV=1
1419	2552	A0A178UW31	96.10	4	4	4.24E6	6	5	7	N	206927	PMR4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g04490 PE=4 SV=1
1419	2553	Q9ZT82	96.10	4	4	4.24E6	6	5	7	N	206911	Callose synthase 12 OS=Arabidopsis thaliana OX=3702 GN=CALS12 PE=2 SV=1
1419	2554	W8PV73	96.10	4	4	4.24E6	6	5	7	N	206911	Glycosyltransferase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT4G03550 PE=2 SV=1
1741	4333	Q9LSX7	96.02	36	36	1.95E7	5	5	6	N	31399	Peroxisome biogenesis protein 22 OS=Arabidopsis thaliana OX=3702 GN=PEX22 PE=1 SV=1
1741	4334	A0A178VH76	96.02	36	36	1.95E7	5	5	6	N	31399	PEX22 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g23460 PE=4 SV=1
1761	5378	Q8LFQ6	95.98	44	44	6.31E7	4	4	6	N	14827	Glutaredoxin-C4 OS=Arabidopsis thaliana OX=3702 GN=GRXC4 PE=2 SV=2
1928	4688	A0A178V2Q3	95.95	30	30	1.74E7	6	6	6	Y	33681	Xyloglucan endotransglucosylase/hydrolase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g43070 PE=3 SV=1
1928	4689	Q8LER3	95.95	30	30	1.74E7	6	6	6	Y	33681	Probable xyloglucan endotransglucosylase/hydrolase protein 7 OS=Arabidopsis thaliana OX=3702 GN=XTH7 PE=2 SV=2
1414	4170	A0A178VEY8	95.95	23	23	3.72E7	6	5	8	Y	28473	VAP27-1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g54990 PE=4 SV=1
1414	4171	Q8VZ95	95.95	23	23	3.72E7	6	5	8	Y	28473	Vesicle-associated protein 1-1 OS=Arabidopsis thaliana OX=3702 GN=PVA11 PE=1 SV=1
2093	3555	Q8VZG1	95.85	17	17	2.05E7	4	4	4	Y	53881	Diacylglycerol kinase 3 OS=Arabidopsis thaliana OX=3702 GN=DGK3 PE=2 SV=1
2093	3556	A0A178VZY0	95.85	17	17	2.05E7	4	4	4	Y	53881	diacylglycerol kinase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g14070 PE=3 SV=1
1316	5089	A0A178W0Z4	95.84	34	34	9.83E6	7	4	8	Y	28915	GRF10 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g23390 PE=3 SV=1
1316	5090	B9DFR1	95.84	34	34	9.83E6	7	4	8	Y	28900	AT1G22300 protein OS=Arabidopsis thaliana OX=3702 GN=At1g22300 PE=2 SV=1
1558	6748	A0A178VSL5	95.83	21	21	1.16E7	7	4	8	Y	41737	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g37940 PE=1 SV=1
1558	6749	Q9SHB0	95.83	21	21	1.16E7	7	4	8	Y	41737	Import inner membrane translocase subunit OS=Arabidopsis thaliana OX=3702 GN=At2g40800 PE=1 SV=1
1601	6791	Q9SSG3	95.79	12	12	4.57E7	7	6	8	Y	75225	HIPL1 protein OS=Arabidopsis thaliana OX=3702 GN=HIPL1 PE=3 SV=2
1601	6792	A0A178WMH4	95.79	12	12	4.57E7	7	6	8	Y	75236	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g69170 PE=4 SV=1
1719	2543	A0A1P8B7C0	95.68	14	14	2.36E7	5	5	6	Y	58497	Aldehyde dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=ALDH3I1 PE=3 SV=1
1719	2544	A0A178UV01	95.68	14	14	2.36E7	5	5	6	Y	60173	Aldehyde dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g39170 PE=3 SV=1
1719	2545	Q8W033	95.68	14	14	2.36E7	5	5	6	Y	60173	Aldehyde dehydrogenase family 3 member I1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ALDH3I1 PE=1 SV=2
1937	4904	Q9FPJ8	95.65	27	27	1.14E7	6	6	6	Y	42324	Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana OX=3702 GN=RBP45A PE=2 SV=1
1937	4905	A0A178UGM5	95.65	27	27	1.14E7	6	6	6	Y	42315	RBP45A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g54030 PE=4 SV=1
1334	1834	P29976	95.53	17	17	1.61E7	7	4	7	Y	57979	Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DHS1 PE=2 SV=2
1334	1902	A0A178UXE4	95.53	17	17	1.61E7	7	4	7	Y	57946	Phospho-2-dehydro-3-deoxyheptonate aldolase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g45420 PE=3 SV=1
1936	8421	A0A2H1ZE95	95.48	11	11	1.09E7	5	5	5	Y	72536	Phototropic-responsive NPH3 family protein OS=Arabidopsis thaliana OX=3702 GN=NPH3 PE=1 SV=1
1936	8405	Q9FMF5	95.48	10	10	1.09E7	5	5	5	Y	81873	Root phototropism protein 3 OS=Arabidopsis thaliana OX=3702 GN=RPT3 PE=1 SV=2
1936	8406	A0A178UIP8	95.48	10	10	1.09E7	5	5	5	Y	81873	RPT3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g63930 PE=3 SV=1
1909	5115	B3H658	95.48	18	18	2.04E7	4	4	6	Y	44731	Branched-chain-amino-acid aminotransferase OS=Arabidopsis thaliana OX=3702 GN=BCAT3 PE=3 SV=1
1909	5116	A0A178VH13	95.48	18	18	2.04E7	4	4	6	Y	44969	Branched-chain-amino-acid aminotransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g43830 PE=3 SV=1
1909	5117	Q9M401	95.48	18	18	2.04E7	4	4	6	Y	44973	Branched-chain-amino-acid aminotransferase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=BCAT3 PE=1 SV=1
1751	60172	F4KCL7	95.47	16	16	1.36E7	5	5	7	Y	65912	Outer envelope protein 64, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OM64 PE=1 SV=1
1751	60173	A0A178UC85	95.47	16	16	1.36E7	5	5	7	Y	65912	TOC64-V OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g08950 PE=4 SV=1
2034	7429	Q9FPH2	95.44	23	23	8.13E7	4	4	6	Y	13378	AT5g02160 OS=Arabidopsis thaliana OX=3702 GN=At5g02160 PE=2 SV=1
2034	7430	A0A178UB22	95.44	23	23	8.13E7	4	4	6	Y	13378	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g01270 PE=4 SV=1
1401	2874	A0A178WCA1	95.43	21	21	1.56E7	8	5	10	Y	55264	ALDH2B7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g24970 PE=3 SV=1
1401	2875	Q8S528	95.43	20	20	1.56E7	8	5	10	Y	58153	Aldehyde dehydrogenase family 2 member B7, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALDH2B7 PE=1 SV=2
1521	3785	P56755	95.40	37	37	5.14E7	5	5	8	Y	20086	NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhI PE=3 SV=1
1521	3786	A0A1B1W503	95.40	37	37	5.14E7	5	5	8	Y	20086	NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhI PE=3 SV=1
2328	4155	Q949P3	95.38	19	19	7.07E6	4	4	4	N	40858	Uncharacterized protein At2g17340 OS=Arabidopsis thaliana OX=3702 GN=At2g17340 PE=1 SV=1
1499	4835	A0A097PL68	95.35	26	26	1.83E7	5	5	8	Y	33049	Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase family protein (Fragment) OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1499	4836	Q8RUF8	95.35	22	22	1.83E7	5	5	8	Y	40330	Omega-amidase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NLP3 PE=1 SV=1
1499	4837	A0A178U770	95.35	22	22	1.83E7	5	5	8	Y	40330	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g11770 PE=4 SV=1
1362	6739	O82179	95.30	51	51	1.83E8	4	4	9	N	17100	Glycine cleavage system H protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GDH2 PE=2 SV=1
1424	6378	Q9SX53	95.28	10	10	6.56E6	4	4	6	Y	80939	At1g50380/F14I3_27 OS=Arabidopsis thaliana OX=3702 GN=At1g50380 PE=2 SV=1
1424	6402	A0A178WF37	95.28	9	9	6.56E6	4	4	6	Y	88205	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g44580 PE=4 SV=1
1424	6403	A0A1P8ATN7	95.28	9	9	6.56E6	4	4	6	Y	88201	Prolyl oligopeptidase family protein OS=Arabidopsis thaliana OX=3702 GN=At1g50380 PE=4 SV=1
1424	6417	Q94AE5	95.28	16	16	6.56E6	4	4	6	Y	53568	At1g50380/F14I3_27 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1815	5341	Q9SJU9	95.26	21	21	2.86E7	5	5	6	Y	37746	Epimerase family protein SDR39U1 homolog, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GC1 PE=2 SV=2
1815	5342	A0A178VWI5	95.26	21	21	2.86E7	5	5	6	Y	37746	SULA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g16760 PE=4 SV=1
1815	5343	A0A1P8B167	95.26	20	20	2.86E7	5	5	6	Y	39447	NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=SULA PE=4 SV=1
1487	2772	A0A178VII1	95.25	22	22	2.14E7	7	7	8	Y	60742	PAO OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g38700 PE=4 SV=1
1487	2773	Q9FYC2	95.25	22	22	2.14E7	7	7	8	Y	60756	Pheophorbide a oxygenase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PAO PE=1 SV=1
1390	5812	A0A178UD72	95.22	41	41	9.26E7	5	5	8	N	17879	ML3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g23420 PE=4 SV=1
1390	5813	Q9FF98	95.22	41	41	9.26E7	5	5	8	N	17908	MD-2-related lipid-recognition protein 3 OS=Arabidopsis thaliana OX=3702 GN=ML3 PE=1 SV=1
1809	4172	A0A178WAC3	95.19	35	35	4.55E7	5	5	7	N	26789	Emb1473 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g73280 PE=3 SV=1
1809	4173	Q9SYL9	95.19	35	35	4.55E7	5	5	7	N	26789	50S ribosomal protein L13, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPL13 PE=2 SV=1
1674	5449	A0A178URR7	95.12	32	32	1.83E7	6	5	7	N	27234	BPA1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g16480 PE=4 SV=1
1674	5450	Q9LFD5	95.12	32	32	1.83E7	6	5	7	N	27234	Binding partner of ACD11 1 OS=Arabidopsis thaliana OX=3702 GN=BPA1 PE=1 SV=1
1674	5451	Q8LB67	95.12	32	32	1.83E7	6	5	7	N	27248	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1720	4866	A0A178UQM0	95.11	36	36	4.4E7	4	4	7	Y	25224	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g01890 PE=4 SV=1
1720	4867	A0JQ00	95.11	36	36	4.4E7	4	4	7	Y	25224	At5g02740 OS=Arabidopsis thaliana OX=3702 GN=At5g02740 PE=2 SV=1
1990	3352	B9DGW5	95.02	24	24	1.12E7	5	5	6	Y	41834	AT4G36530 protein OS=Arabidopsis thaliana OX=3702 GN=At4g36530 PE=2 SV=1
1990	3353	O23227	95.02	24	24	1.12E7	5	5	6	Y	41906	Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=C7A10.830 PE=2 SV=2
1990	3354	A0A178V1E7	95.02	24	24	1.12E7	5	5	6	Y	41906	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g41620 PE=4 SV=1
867	4496	A0A178VLB6	94.95	29	29	4.49E6	7	2	14	Y	21309	60S ribosomal protein L18a OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g15240 PE=3 SV=1
867	4497	Q9LUD4	94.95	29	29	4.49E6	7	2	14	Y	21309	60S ribosomal protein L18a-3 OS=Arabidopsis thaliana OX=3702 GN=RPL18AC PE=2 SV=1
1467	4526	A0A178VKZ0	94.91	32	32	2.48E7	7	7	9	Y	39116	CHL OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g41860 PE=3 SV=1
1467	4527	Q9STS7	94.91	32	32	2.48E7	7	7	9	Y	39116	Chloroplastic lipocalin OS=Arabidopsis thaliana OX=3702 GN=CHL PE=1 SV=1
1452	4298	A0A178W3A3	94.84	15	15	2.78E7	6	6	7	N	42609	ATP-dependent Clp protease proteolytic subunit OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g44210 PE=3 SV=1
1452	4299	Q9XJ35	94.84	15	15	2.78E7	6	6	7	N	42628	ATP-dependent Clp protease proteolytic subunit-related protein 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPR1 PE=1 SV=1
1642	3410	Q42545	94.77	25	25	2.07E7	7	7	8	N	45565	Cell division protein FtsZ homolog 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FTSZ1 PE=1 SV=2
1642	3411	A0A178U8G2	94.77	25	25	2.07E7	7	7	8	N	45565	FTSZ1-1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g54420 PE=3 SV=1
1239	4653	A0A178W5N5	94.76	40	40	4E8	6	6	11	N	14804	AT1G07770 protein OS=Arabidopsis thaliana OX=3702 GN=At1g07770 PE=2 SV=1
1239	4654	P42798	94.76	40	40	4E8	6	6	11	N	14804	40S ribosomal protein S15a-1 OS=Arabidopsis thaliana OX=3702 GN=RPS15AA PE=2 SV=2
1239	4655	A0A384KNV6	94.76	40	40	4E8	6	6	11	N	14804	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g07460 PE=3 SV=1
1574	4959	Q0WPN7	94.72	31	31	9.25E6	6	4	7	Y	28296	Probable pectin methylesterase CGR3 OS=Arabidopsis thaliana OX=3702 GN=CGR3 PE=2 SV=1
1574	4958	A0A178UES6	94.72	31	31	9.25E6	6	4	7	Y	28311	CGR3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g65700 PE=4 SV=1
1160	4590	Q94F41	94.70	23	23	5.65E7	9	9	9	Y	53848	At1g80030/F18B13_37 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1160	4591	Q0WN54	94.70	23	23	5.65E7	9	9	9	Y	53820	Molecular chaperone Hsp40/DnaJ family protein OS=Arabidopsis thaliana OX=3702 GN=DJA7 PE=2 SV=1
1615	6503	Q9FMV3	94.70	18	18	5.52E6	5	3	6	N	59435	CBS domain-containing protein CBSCBSPB1 OS=Arabidopsis thaliana OX=3702 GN=CBSCBSPB1 PE=1 SV=1
1615	6504	A0A178UEI5	94.70	18	18	5.52E6	5	3	6	N	59435	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g63040 PE=4 SV=1
1722	7405	A0A178WH59	94.66	40	40	2.18E7	5	5	5	Y	26173	MORF9 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g11720 PE=4 SV=1
1722	7406	Q9LPZ1	94.66	40	40	2.18E7	5	5	5	Y	26201	Multiple organellar RNA editing factor 9, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MORF9 PE=1 SV=1
1661	4705	A0A178UAH5	94.60	19	19	8.52E6	5	5	5	Y	48064	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g66050 PE=3 SV=1
1661	4706	Q8VYV7	94.60	19	19	8.52E6	5	5	5	Y	48064	3-dehydroquinate synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DHQS PE=1 SV=1
896	3815	P42794	94.56	41	41	6.28E8	8	8	13	Y	20861	60S ribosomal protein L11-2 OS=Arabidopsis thaliana OX=3702 GN=RPL11B PE=2 SV=2
896	3816	A0A384KRK7	94.56	41	41	6.28E8	8	8	13	Y	20831	RPL16A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g40140 PE=3 SV=1
896	3817	Q0WQZ1	94.56	41	41	6.28E8	8	8	13	Y	20831	60S ribosomal protein L11B OS=Arabidopsis thaliana OX=3702 GN=At2g42740 PE=2 SV=1
896	3818	A0A178UAV2	94.56	41	41	6.28E8	8	8	13	Y	20861	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g53250 PE=3 SV=1
896	3819	P42795	94.56	41	41	6.28E8	8	8	13	Y	20831	60S ribosomal protein L11-1 OS=Arabidopsis thaliana OX=3702 GN=RPL11A PE=2 SV=2
1610	2850	A0A178UXV4	94.49	23	23	2E7	5	5	6	Y	36290	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g44030 PE=4 SV=1
1610	2851	Q9SZP6	94.49	23	23	2E7	5	5	6	Y	36290	AT4g38690/F20M13_250 OS=Arabidopsis thaliana OX=3702 GN=F20M13.250 PE=2 SV=1
1421	5293	A0A1I9LPN7	94.41	8	8	4.91E6	7	2	8	N	105461	Calcium-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=ACA11 PE=3 SV=1
1421	5296	Q9M2L4	94.41	8	8	4.91E6	7	2	8	N	111945	Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=ACA11 PE=1 SV=1
1421	5297	A0A178VG68	94.41	8	8	4.91E6	7	2	8	N	111945	Calcium-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g51910 PE=3 SV=1
1314	3127	Q9C8F1	94.37	20	20	2.55E7	8	8	9	Y	48622	Probable eukaryotic translation initiation factor 5-1 OS=Arabidopsis thaliana OX=3702 GN=At1g36730 PE=2 SV=1
1314	3128	A0A178W594	94.37	20	20	2.55E7	8	8	9	Y	48592	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g37380 PE=4 SV=1
1887	6383	Q38932	94.31	16	16	8.51E6	6	6	6	Y	58491	Lycopene epsilon cyclase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LUT2 PE=1 SV=2
1887	6382	A0A178ULD5	94.31	16	16	8.51E6	6	6	6	Y	58518	LUT2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g56250 PE=4 SV=1
1407	6409	A0A384L8F9	94.27	28	28	5.33E7	4	3	8	N	18956	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g14380 PE=4 SV=1
1407	6410	Q93VK7	94.27	28	28	5.33E7	4	3	8	N	18956	AT5g14910/F2G14_30 OS=Arabidopsis thaliana OX=3702 GN=At5g14910 PE=2 SV=1
1357	5359	Q0WUG9	94.26	32	32	6.41E7	8	8	8	Y	25550	Nucleoside diphosphate kinase OS=Arabidopsis thaliana OX=3702 GN=At5g63310 PE=2 SV=1
1357	5360	O64903	94.26	32	32	6.41E7	8	8	8	Y	25550	Nucleoside diphosphate kinase II, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NDPK2 PE=1 SV=2
1357	5361	A0A384KNJ7	94.26	32	32	6.41E7	8	8	8	Y	25550	Nucleoside diphosphate kinase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g62890 PE=3 SV=1
1929	3150	Q0WUG4	94.23	16	16	2.05E7	6	6	6	N	59211	Glutathione synthetase gsh2 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At5g27380 PE=2 SV=1
1929	3841	A0A178UD21	94.23	15	15	2.05E7	6	6	6	N	60265	Glutathione synthetase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g27280 PE=3 SV=1
1929	3152	P46416	94.23	15	15	2.05E7	6	6	6	N	60271	Glutathione synthetase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GSH2 PE=2 SV=3
1753	6354	A0A384KES6	94.20	43	43	5.62E7	4	4	5	N	20149	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g12360 PE=1 SV=1
1753	6355	Q9LHH3	94.20	43	43	5.62E7	4	4	5	N	20149	FKBP-type peptidyl-prolyl cis-trans isomerase OS=Arabidopsis thaliana OX=3702 GN=At3g12345 PE=1 SV=1
1471	6729	A0A178WDM2	94.15	13	13	5.82E6	7	4	9	Y	74752	LACS3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g57920 PE=4 SV=1
1471	6730	Q9C7W4	94.15	13	13	5.82E6	7	4	9	Y	74751	Long chain acyl-CoA synthetase 3 OS=Arabidopsis thaliana OX=3702 GN=LACS3 PE=2 SV=1
1266	6632	A0A178VQE6	94.15	27	27	2.87E8	4	4	11	Y	15482	OEP16-1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g25000 PE=4 SV=1
1266	6633	Q9ZV24	94.15	27	27	2.87E8	4	4	11	Y	15482	Outer envelope pore protein 16-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OEP161 PE=1 SV=1
1342	4303	Q9SJ36	94.14	48	48	8.36E5	5	2	7	N	15952	40S ribosomal protein S17-2 OS=Arabidopsis thaliana OX=3702 GN=RPS17B PE=2 SV=3
1342	4304	A0A178VP20	94.14	48	48	8.36E5	5	2	7	N	15952	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g04350 PE=3 SV=1
1479	6950	Q1H5F2	94.12	28	28	2.06E8	4	4	8	Y	16449	Histone H2B OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1479	6951	A0A384KCB6	94.12	28	28	2.06E8	4	4	8	Y	16449	Histone H2B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g59350 PE=3 SV=1
1479	6952	P40283	94.12	28	28	2.06E8	4	4	8	Y	16449	Histone H2B.11 OS=Arabidopsis thaliana OX=3702 GN=At5g59910 PE=1 SV=5
1479	6957	A0A178VZH7	94.12	28	28	2.06E8	4	4	8	Y	16529	Histone H2B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g24830 PE=3 SV=1
1479	6958	Q9SI96	94.12	28	28	2.06E8	4	4	8	Y	16529	Histone H2B.3 OS=Arabidopsis thaliana OX=3702 GN=At2g28720 PE=1 SV=3
1545	5755	A0A178W4X1	94.10	22	22	1.82E7	6	6	7	Y	42993	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g09180 PE=3 SV=1
1545	5758	F4HZG9	94.10	17	17	1.82E7	6	6	7	Y	54982	Intermediate cleaving peptidase 55, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ICP55 PE=1 SV=1
1011	4585	Q0WRB8	94.08	38	38	1.1E8	6	3	9	Y	15608	60S ribosomal protein L27 OS=Arabidopsis thaliana OX=3702 GN=At4g15000 PE=2 SV=1
1011	4586	P51419	94.08	38	38	1.1E8	6	3	9	Y	15608	60S ribosomal protein L27-3 OS=Arabidopsis thaliana OX=3702 GN=RPL27C PE=2 SV=2
1011	4587	A0A384KZP3	94.08	38	38	1.1E8	6	3	9	Y	15608	60S ribosomal protein L27 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g17370 PE=3 SV=1
1853	5873	Q07098	94.04	31	31	6.41E5	5	2	5	Y	34934	Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=PP2A2 PE=1 SV=1
1853	5874	A0A178W6R4	94.04	31	31	6.41E5	5	2	5	Y	34934	Serine/threonine-protein phosphatase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g10510 PE=3 SV=1
1655	7419	P56772	94.01	29	29	8.33E7	4	4	8	Y	22124	Chloroplastic ATP-dependent Clp protease proteolytic subunit 1 OS=Arabidopsis thaliana OX=3702 GN=clpP1 PE=1 SV=2
1655	7420	A0A1B1W4W5	94.01	29	29	8.33E7	4	4	8	Y	22128	ATP-dependent Clp protease proteolytic subunit OS=Arabidopsis thaliana OX=3702 GN=clpP PE=3 SV=1
1323	3100	A0A178W3T8	93.99	20	20	1.62E7	7	6	8	N	48941	ERF1-2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g13360 PE=4 SV=1
1323	3101	Q9LPV8	93.99	20	20	1.62E7	7	6	8	N	48941	Eukaryotic peptide chain release factor subunit 1-2 OS=Arabidopsis thaliana OX=3702 GN=ERF1-2 PE=1 SV=1
1702	3025	A0A178U978	93.90	14	14	5.84E6	5	3	6	N	58555	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g27060 PE=4 SV=1
1702	3026	O04658	93.90	14	14	5.84E6	5	3	6	N	58755	Probable nucleolar protein 5-1 OS=Arabidopsis thaliana OX=3702 GN=NOP5-1 PE=1 SV=2
1332	1657	A0A1P8B2B8	93.87	22	22	2.42E7	9	9	10	N	68144	AMP-dependent synthetase and ligase family protein OS=Arabidopsis thaliana OX=3702 GN=LACS1 PE=4 SV=1
1332	1658	O22898	93.87	20	20	2.42E7	9	9	10	N	74598	Long chain acyl-CoA synthetase 1 OS=Arabidopsis thaliana OX=3702 GN=LACS1 PE=2 SV=1
1332	1929	A0A178VU16	93.87	20	20	2.42E7	9	9	10	N	74480	LACS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g44990 PE=4 SV=1
1200	1727	Q9C5U3	93.81	30	30	1.49E7	8	7	10	Y	47248	26S proteasome regulatory subunit 8 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPT6A PE=1 SV=1
1200	1728	A0A178UGX7	93.81	30	30	1.49E7	8	7	10	Y	47248	RPT6A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g19940 PE=3 SV=1
1200	2345	A0A1P8BCJ5	93.81	35	35	1.49E7	8	7	10	Y	40689	Regulatory particle triple-A ATPase 6A OS=Arabidopsis thaliana OX=3702 GN=RPT6A PE=3 SV=1
1200	2360	A0A178U901	93.81	30	30	1.49E7	8	7	10	Y	47157	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g19950 PE=3 SV=1
1200	2361	Q94BQ2	93.81	30	30	1.49E7	8	7	10	Y	47157	26S proteasome regulatory subunit 8 homolog B OS=Arabidopsis thaliana OX=3702 GN=RPT6B PE=1 SV=1
1657	3271	Q0WWL8	93.71	15	15	9.9E6	5	5	6	Y	73405	Phosphoenolpyruvate carboxykinase (ATP)-like protein OS=Arabidopsis thaliana OX=3702 GN=At4g37870 PE=2 SV=1
1657	3272	Q9T074	93.71	15	15	9.9E6	5	5	6	Y	73405	Phosphoenolpyruvate carboxykinase (ATP) OS=Arabidopsis thaliana OX=3702 GN=PCKA PE=1 SV=1
1657	3273	A0A178V3Z2	93.71	15	15	9.9E6	5	5	6	Y	73417	PEPCK OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g43150 PE=3 SV=1
1813	9675	Q8GW78	93.66	37	37	3.05E7	5	5	7	N	26561	ATP-dependent Clp protease ATP-binding subunit CLPT2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPT2 PE=1 SV=1
1253	4490	A0A384KZH7	93.64	27	27	6.08E7	8	8	9	Y	45475	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g48830 PE=3 SV=1
1253	4491	Q9M2U7	93.64	27	27	6.08E7	8	8	9	Y	45475	AT3g54400/T12E18_90 OS=Arabidopsis thaliana OX=3702 GN=T12E18_90 PE=2 SV=1
1253	4492	Q8L934	93.64	27	27	6.08E7	8	8	9	Y	45490	Nucleoid DNA-binding-like protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2088	4685	A0A178UKX2	93.62	14	14	1.05E7	3	3	3	N	43090	HBP5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g20100 PE=4 SV=1
2088	4686	Q8VZ90	93.62	14	14	1.05E7	3	3	3	N	43160	SOUL heme-binding family protein OS=Arabidopsis thaliana OX=3702 GN=HBP5 PE=2 SV=1
2088	4687	F4K452	93.62	14	14	1.05E7	3	3	3	N	44880	SOUL heme-binding family protein OS=Arabidopsis thaliana OX=3702 GN=HBP5 PE=4 SV=1
1732	6295	A0A1P8AR51	93.60	8	8	4.86E6	6	4	6	Y	103847	Calcium-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=ACA1 PE=3 SV=1
1732	5142	Q37145	93.60	8	8	4.86E6	6	4	6	Y	111261	Calcium-transporting ATPase 1 OS=Arabidopsis thaliana OX=3702 GN=ACA1 PE=1 SV=3
1732	5143	A0A178WD16	93.60	8	8	4.86E6	6	4	6	Y	111261	Calcium-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g28160 PE=3 SV=1
1788	3682	A0A178W1L5	93.56	38	38	2.24E7	7	5	7	Y	36554	SPDS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g24990 PE=3 SV=1
1788	3683	Q9ZUB3	93.56	38	38	2.24E7	7	5	7	Y	36554	Spermidine synthase 1 OS=Arabidopsis thaliana OX=3702 GN=SPDSYN1 PE=1 SV=1
1455	2682	Q8VZU2	93.53	24	24	1.15E7	5	5	6	N	34225	Syntaxin-132 OS=Arabidopsis thaliana OX=3702 GN=SYP132 PE=1 SV=1
1455	2683	A0A178U9Y3	93.53	24	24	1.15E7	5	5	6	N	34225	SYP132 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g07850 PE=3 SV=1
1455	2684	F4K9K2	93.53	23	23	1.15E7	5	5	6	N	35402	Syntaxin of plants 132 OS=Arabidopsis thaliana OX=3702 GN=SYP132 PE=1 SV=1
2222	4970	Q8LEF4	93.53	20	20	6.05E5	4	2	5	N	43300	3-isopropylmalate dehydrogenase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2222	4971	P93832	93.53	20	20	6.05E5	4	2	5	N	43371	3-isopropylmalate dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=IMDH2 PE=1 SV=1
1792	4850	A0A178WJS5	93.51	21	21	1.29E7	6	6	7	Y	46427	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g03700 PE=4 SV=1
1792	4851	Q8VZ23	93.51	21	21	1.29E7	6	6	7	Y	46427	NAD(P)-linked oxidoreductase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g04420 PE=2 SV=1
1792	4852	P93818	93.51	19	19	1.29E7	6	6	7	Y	50908	F19P19.12 protein OS=Arabidopsis thaliana OX=3702 GN=F19P19.12 PE=4 SV=2
1277	1518	P48523	93.49	45	45	3.19E7	7	7	9	Y	39098	Cinnamyl alcohol dehydrogenase 4 OS=Arabidopsis thaliana OX=3702 GN=CAD4 PE=1 SV=1
1277	1519	A0A178VK12	93.49	45	45	3.19E7	7	7	9	Y	39098	CAD4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g20650 PE=3 SV=1
1851	3335	Q9M3H5	93.47	9	9	1.05E7	6	6	6	Y	88189	Probable cadmium/zinc-transporting ATPase HMA1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HMA1 PE=2 SV=2
2080	4486	A0A384L906	93.41	24	24	9.83E6	5	4	5	N	39562	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g18370 PE=3 SV=1
2080	4487	Q9LUT0	93.41	24	24	9.83E6	5	4	5	N	39562	Receptor-like cytoplasmic kinase 1 OS=Arabidopsis thaliana OX=3702 GN=CARK1 PE=1 SV=1
2139	5352	A0A178UHI0	93.35	11	11	2.57E6	5	3	5	N	67160	Glucose-6-phosphate 1-dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g12520 PE=3 SV=1
2139	5353	Q9FY99	93.35	11	11	2.57E6	5	3	5	N	67160	Glucose-6-phosphate 1-dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=G6PD2 PE=1 SV=2
1450	5631	A0A178UGP2	93.30	38	38	3.75E7	6	2	8	Y	15475	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g44900 PE=4 SV=1
1450	5632	Q9FHG2	93.30	38	38	3.75E7	6	2	8	Y	15475	60S ribosomal protein L32-2 OS=Arabidopsis thaliana OX=3702 GN=RPL32B PE=2 SV=1
1690	3030	A0A178UPY9	93.29	15	15	8.24E6	7	7	7	N	80880	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g45040 PE=4 SV=1
1690	3031	Q9LS25	93.29	15	15	8.24E6	7	7	7	N	80880	Pentatricopeptide repeat-containing protein At5g46580, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g46580 PE=2 SV=1
1786	3754	A0A178V3B3	93.23	26	26	6.29E7	6	6	6	Y	29201	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g30450 PE=4 SV=1
1786	3755	Q84K90	93.23	26	26	6.29E7	6	6	6	Y	29201	RGS1-HXK1-interacting protein 1 OS=Arabidopsis thaliana OX=3702 GN=RHIP1 PE=1 SV=1
1379	59309	Q9FV52	93.23	31	31	8.11E7	6	6	8	Y	40424	Methionine aminopeptidase 1B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MAP1B PE=2 SV=2
2164	7971	A0A178W4U8	93.13	59	59	3.46E7	4	3	5	N	10752	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g66310 PE=4 SV=1
2164	7972	Q8GWC7	93.13	59	59	3.46E7	4	3	5	N	10752	MICOS complex subunit, putative (DUF543) OS=Arabidopsis thaliana OX=3702 GN=At1g72165/T9N14_2 PE=2 SV=1
1750	4553	Q9C9Z2	92.98	18	18	4.78E7	5	5	7	Y	35253	Protein RETICULATA-RELATED 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RER3 PE=1 SV=1
1750	4554	A0A178VQC1	92.98	18	18	4.78E7	5	5	7	Y	35600	RER3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g08210 PE=4 SV=1
1603	5571	A0A178UTC5	92.91	23	23	1.78E7	6	6	7	Y	60738	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g34400 PE=4 SV=1
1603	5572	Q9SZV3	92.91	23	23	1.78E7	6	6	7	Y	60738	Folate synthesis bifunctional protein, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MitHPPK/DHPS PE=2 SV=1
1423	5405	A0A178VWT1	92.87	18	18	1.56E7	7	7	7	Y	63914	SYCO ARATH OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g27350 PE=3 SV=1
1423	5406	F4IPY2	92.87	18	18	1.56E7	7	7	7	Y	63914	Cysteine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SYCO PE=2 SV=1
1832	7310	Q38935	92.84	52	52	2.72E6	6	4	6	Y	16355	Peptidyl-prolyl cis-trans isomerase FKBP15-1 OS=Arabidopsis thaliana OX=3702 GN=FKBP15-1 PE=2 SV=2
1832	7311	A0A178VKS9	92.84	52	52	2.72E6	6	4	6	Y	16381	Peptidylprolyl isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g27230 PE=4 SV=1
1395	5258	Q93VA8	92.80	27	27	3.25E7	6	5	7	Y	37383	Alba DNA/RNA-binding protein OS=Arabidopsis thaliana OX=3702 GN=At1g76010 PE=2 SV=1
1395	5259	A0A178WMY0	92.80	27	27	3.25E7	6	5	7	Y	37364	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g70450 PE=4 SV=1
1216	5218	A0A178UU15	92.72	47	47	5.77E7	6	6	11	N	14527	Cytochrome b-c1 complex subunit 7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g37260 PE=3 SV=1
1216	5219	Q9SUU5	92.72	47	47	5.77E7	6	6	11	N	14527	Cytochrome b-c1 complex subunit 7-1 OS=Arabidopsis thaliana OX=3702 GN=QCR7-1 PE=1 SV=1
1944	10450	Q9M0B1	92.68	14	14	1.11E7	4	4	4	Y	50837	Uncharacterized protein AT4g30490 OS=Arabidopsis thaliana OX=3702 GN=At4g30490 PE=4 SV=1
1944	10451	A0A178UYG0	92.68	13	13	1.11E7	4	4	4	Y	56535	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g34950 PE=4 SV=1
1944	10452	Q8L517	92.68	13	13	1.11E7	4	4	4	Y	56535	AFG1-like ATPase family protein OS=Arabidopsis thaliana OX=3702 GN=At4g30490 PE=1 SV=1
1870	5890	O82314	92.62	23	23	2.15E7	4	4	5	N	36814	Probable transcriptional regulatory protein At2g25830 OS=Arabidopsis thaliana OX=3702 GN=At2g25830 PE=2 SV=2
1870	5891	A0A178VXB7	92.62	23	23	2.15E7	4	4	5	N	36814	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g21680 PE=3 SV=1
1659	5839	Q8VYI3	92.57	29	29	3.16E7	7	7	7	Y	34082	Enoyl-CoA hydratase 2, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=ECH2 PE=1 SV=1
1802	10946	A0A178W339	92.54	14	14	1.07E7	5	5	6	N	60353	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g01510 PE=4 SV=1
1802	10947	Q9FZ24	92.54	14	14	1.07E7	5	5	6	N	60353	Pentatricopeptide repeat-containing protein At1g02370, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g02370 PE=2 SV=1
2486	9515	Q9SP35	92.43	33	33	6.16E7	4	4	4	N	25571	Mitochondrial import inner membrane translocase subunit TIM17-2 OS=Arabidopsis thaliana OX=3702 GN=TIM17-2 PE=1 SV=2
2486	9516	Q6S710	92.43	33	33	6.16E7	4	4	4	N	25572	Mitochondrial inner membrane translocase TM17-2 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At2g37410 PE=2 SV=1
2043	4408	Q8LAT9	92.42	23	23	2.18E7	4	3	4	Y	33907	Serine/threonine-protein phosphatase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2043	2999	A0A178VCH8	92.42	22	22	2.18E7	4	3	4	Y	35767	Serine/threonine-protein phosphatase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g53040 PE=3 SV=1
2043	3001	P48578	92.42	22	22	2.18E7	4	3	4	Y	35767	Serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=PP2A4 PE=1 SV=1
2043	3000	A0A178VSM5	92.42	22	22	2.18E7	4	3	4	Y	35833	Serine/threonine-protein phosphatase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g39870 PE=3 SV=1
2043	3002	Q07100	92.42	22	22	2.18E7	4	3	4	Y	35833	Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=PP2A3 PE=1 SV=2
1953	4188	A0A178V4X8	92.40	37	37	2.54E7	5	5	6	Y	33376	AKR2A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g40480 PE=4 SV=1
1953	4189	B9DFM6	92.40	34	34	2.54E7	5	5	6	Y	36984	AT4G35450 protein OS=Arabidopsis thaliana OX=3702 GN=At4g35450 PE=2 SV=1
1953	4190	Q9SAR5	92.40	34	34	2.54E7	5	5	6	Y	36984	Ankyrin repeat domain-containing protein 2A OS=Arabidopsis thaliana OX=3702 GN=AKR2A PE=1 SV=2
1953	4191	F4JN13	92.40	33	33	2.54E7	5	5	6	Y	38057	Ankyrin repeat-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=AKR2 PE=4 SV=1
1801	4168	A0A178UDF3	92.39	34	34	4.78E7	5	5	6	Y	24337	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g00840 PE=4 SV=1
1801	4169	Q9LZX1	92.39	34	34	4.78E7	5	5	6	Y	24295	Protein LURP-one-related 15 OS=Arabidopsis thaliana OX=3702 GN=At5g01750 PE=1 SV=1
1818	5374	A0A384KDG4	92.37	15	15	1.11E7	5	4	6	N	42750	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g25580 PE=4 SV=1
1818	5375	Q9LK47	92.37	15	15	1.11E7	5	4	6	N	42750	AT3g23700/MYM9_3 OS=Arabidopsis thaliana OX=3702 GN=At3g23700 PE=2 SV=1
2109	5223	A0A178W2E1	92.32	21	21	4.7E6	4	4	4	Y	32602	Coatomer subunit epsilon OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g31130 PE=3 SV=1
2109	5224	Q9SA78	92.32	21	21	4.7E6	4	4	4	Y	32602	Coatomer subunit epsilon-1 OS=Arabidopsis thaliana OX=3702 GN=At1g30630 PE=2 SV=1
1658	5908	Q9SHC8	92.31	26	26	2.26E7	5	4	7	N	26442	Vesicle-associated protein 1-2 OS=Arabidopsis thaliana OX=3702 GN=PVA12 PE=1 SV=1
1658	5909	A0A178W0Q8	92.31	26	26	2.26E7	5	4	7	N	26442	PVA12 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g42710 PE=4 SV=1
1580	5894	A0A178V463	92.13	11	11	1.29E7	4	4	5	Y	57745	D2HGDH OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g41510 PE=4 SV=1
1580	5898	O23240	92.13	11	11	1.29E7	4	4	5	Y	61446	D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=D2HGDH PE=1 SV=3
1538	2419	Q0WL60	92.07	19	19	1.32E7	7	7	8	Y	69499	Uncharacterized protein At3g05900 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At3g05900 PE=2 SV=1
1538	2420	A0A1I9LR13	92.07	19	19	1.32E7	7	7	8	Y	70532	Neurofilament protein-like protein OS=Arabidopsis thaliana OX=3702 GN=At3g05900 PE=1 SV=1
1538	2421	Q9SFF5	92.07	18	18	1.32E7	7	7	8	Y	72130	F10A16.20 protein OS=Arabidopsis thaliana OX=3702 GN=F2O10.14 PE=4 SV=1
1538	2422	F4J9K9	92.07	18	18	1.32E7	7	7	8	Y	73454	Neurofilament protein-like protein OS=Arabidopsis thaliana OX=3702 GN=At3g05900 PE=1 SV=1
1538	2423	A0A384KUC9	92.07	18	18	1.32E7	7	7	8	Y	73454	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g05550 PE=1 SV=1
910	8365	Q41951	92.04	26	26	4.77E8	4	4	16	Y	25027	Aquaporin TIP2-1 OS=Arabidopsis thaliana OX=3702 GN=TIP2-1 PE=1 SV=2
1622	3519	A0A1P8B4I3	92.04	21	21	2.53E7	5	5	7	N	39816	Plastid transcriptionally active 5 OS=Arabidopsis thaliana OX=3702 GN=PTAC5 PE=4 SV=1
1622	3007	A0A178V1Z9	92.04	19	19	2.53E7	5	5	7	N	44063	PTAC5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g15600 PE=4 SV=1
1622	3008	A1A6M1	92.04	19	19	2.53E7	5	5	7	N	44020	Protein disulfide isomerase pTAC5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PTAC5 PE=1 SV=1
1693	3348	A0A178WDX5	92.02	27	27	3.35E6	5	2	6	N	39820	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g06340 PE=3 SV=1
1693	3349	Q8H1G6	92.02	27	27	3.35E6	5	2	6	N	39820	PTI1-like tyrosine-protein kinase 1 OS=Arabidopsis thaliana OX=3702 GN=PTI11 PE=1 SV=1
1808	3515	A0A178VF34	91.95	12	12	1.78E7	5	5	7	Y	81833	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g14580 PE=3 SV=1
1808	2977	Q9LVJ1	91.95	12	12	1.78E7	5	5	7	Y	81817	Subtilisin-like protease SBT1.4 OS=Arabidopsis thaliana OX=3702 GN=SBT1.4 PE=2 SV=1
1926	7660	Q96500	91.93	36	36	9.05E7	6	6	6	Y	15314	Light-regulated protein 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LIR1 PE=1 SV=1
1926	9728	A0A178VMR9	91.93	36	36	9.05E7	6	6	6	Y	15401	CCL OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g29060 PE=4 SV=1
1547	6789	A0A178VM82	91.92	12	12	1.57E7	6	3	7	N	66514	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g51050 PE=4 SV=1
1759	4710	Q8RXN5	91.81	13	13	9.28E6	5	5	6	Y	72080	S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Arabidopsis thaliana OX=3702 GN=TYW1 PE=2 SV=1
1759	4711	A0A178W4L9	91.81	13	13	9.28E6	5	5	6	Y	72080	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g69630 PE=4 SV=1
1759	4776	Q56XF4	91.81	19	19	9.28E6	5	5	6	Y	47675	Uncharacterized protein At1g75200 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At1g75200 PE=2 SV=1
2178	5323	P61843	91.80	37	37	1.6E7	3	3	4	Y	19536	Photosystem I assembly protein Ycf3 OS=Arabidopsis thaliana OX=3702 GN=ycf3 PE=1 SV=1
1931	6429	A0A178UQ35	91.80	16	16	1.67E7	5	3	5	Y	54625	BSK8 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g38990 PE=4 SV=1
1931	6430	Q9FHD7	91.80	16	16	1.67E7	5	3	5	Y	54625	Serine/threonine-protein kinase BSK8 OS=Arabidopsis thaliana OX=3702 GN=BSK8 PE=1 SV=1
1988	3955	A0A178VQH1	91.72	14	14	8.66E5	5	2	5	Y	50236	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g18690 PE=3 SV=1
1988	3956	O64816	91.72	14	14	8.66E5	5	2	5	Y	50236	Casein kinase II subunit alpha-4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CKA4 PE=2 SV=1
1908	4733	Q9M2P7	91.68	17	17	3.27E7	3	2	3	N	34091	Probable plastid-lipid-associated protein 9, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PAP9 PE=1 SV=1
1908	4734	A0A178V648	91.68	17	17	3.27E7	3	2	3	N	34091	PGL34 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g52570 PE=4 SV=1
1638	8281	A0A178V1H6	91.59	17	17	8.92E6	6	5	6	N	47238	VC2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g28400 PE=4 SV=1
1638	8282	Q39048	91.59	17	17	8.92E6	6	5	6	N	47238	Protein ECERIFERUM 2 OS=Arabidopsis thaliana OX=3702 GN=CER2 PE=1 SV=1
1336	4513	Q9C5C8	91.57	47	47	4.47E7	6	6	8	Y	21968	Peptide methionine sulfoxide reductase B2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MSRB2 PE=1 SV=1
1336	4514	A0A178UXD9	91.57	47	47	4.47E7	6	6	8	Y	22064	Peptide-methionine (R)-S-oxide reductase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g25330 PE=3 SV=1
1476	5847	C0Z2Y0	91.56	9	9	2.23E7	5	5	6	N	63531	AT4G35300 protein OS=Arabidopsis thaliana OX=3702 GN=At4g35300 PE=2 SV=1
1476	5865	Q8LPQ8	91.56	7	7	2.23E7	5	5	6	N	78525	Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana OX=3702 GN=MSSP2 PE=1 SV=2
1476	5868	A0A178V1T0	91.56	7	7	2.23E7	5	5	6	N	79726	TMT2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g40350 PE=3 SV=1
1731	2459	W8PUP8	91.52	16	16	2.4E7	7	6	7	Y	77373	Hexosyltransferase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT3G61130 PE=2 SV=1
1731	2460	A0A178VJI1	91.52	16	16	2.4E7	7	6	7	Y	77403	Hexosyltransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g55390 PE=3 SV=1
1731	2461	Q9LE59	91.52	16	16	2.4E7	7	6	7	Y	77373	Polygalacturonate 4-alpha-galacturonosyltransferase OS=Arabidopsis thaliana OX=3702 GN=GAUT1 PE=1 SV=1
1698	3567	Q8L7V3	91.50	10	10	9.91E6	5	3	5	Y	93049	Probable methyltransferase PMT26 OS=Arabidopsis thaliana OX=3702 GN=At5g64030 PE=2 SV=1
1698	3574	A0A178UNX4	91.50	10	10	9.91E6	5	3	5	Y	93023	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g63620 PE=4 SV=1
1989	4848	O65271	91.46	28	28	9.9E6	5	5	5	Y	38742	Bifunctional protein FolD 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FOLD4 PE=1 SV=1
1989	4849	A0A178V455	91.46	28	28	9.9E6	5	5	5	Y	38742	EMB3127 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g00780 PE=3 SV=1
1569	6640	Q0WW11	91.44	18	18	2.43E7	6	6	6	Y	54721	Sucrose export defective 1 OS=Arabidopsis thaliana OX=3702 GN=At4g32770 PE=2 SV=1
1569	6641	A0A178UWD9	91.44	18	18	2.43E7	6	6	6	Y	54707	VTE1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g37580 PE=4 SV=1
1569	6642	Q94FY7	91.44	18	18	2.43E7	6	6	6	Y	54721	Tocopherol cyclase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=VTE1 PE=1 SV=1
1582	3630	Q9LU40	91.43	19	19	4.79E6	5	3	6	Y	46799	Protein MANNAN SYNTHESIS-RELATED 1 OS=Arabidopsis thaliana OX=3702 GN=MSR1 PE=2 SV=1
2092	6735	A0A1P8B8L3	91.43	20	20	1.18E7	4	4	4	Y	40854	Squalene synthase 1 OS=Arabidopsis thaliana OX=3702 GN=SQS1 PE=4 SV=1
2092	6737	A0A178UT28	91.43	17	17	1.18E7	4	4	4	Y	47112	SQS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g39640 PE=4 SV=1
2092	6738	P53799	91.43	17	17	1.18E7	4	4	4	Y	47142	Squalene synthase 1 OS=Arabidopsis thaliana OX=3702 GN=SQS1 PE=1 SV=1
2485	3434	A0A178U844	91.29	11	11	6.56E6	4	4	4	Y	68834	Signal recognition particle subunit SRP68 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g61470 PE=3 SV=1
2485	3435	Q9FH46	91.29	11	11	6.56E6	4	4	4	Y	68833	Signal recognition particle subunit SRP68 OS=Arabidopsis thaliana OX=3702 GN=At5g61970 PE=2 SV=1
1948	6871	O49354	91.27	30	30	1.36E7	5	5	6	Y	35332	Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COQ3 PE=1 SV=2
1948	6872	A0A178VTB0	91.27	30	30	1.36E7	5	5	6	Y	35362	Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COQ3 PE=3 SV=1
1948	6873	Q8LG57	91.27	30	30	1.36E7	5	5	6	Y	35354	Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COQ3 PE=2 SV=1
1696	2305	A0A178UXD8	91.21	11	11	1.33E7	5	5	5	N	66281	KLCR1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g12180 PE=4 SV=1
1696	2306	O81629	91.21	11	11	1.33E7	5	5	5	N	66281	Protein KINESIN LIGHT CHAIN-RELATED 1 OS=Arabidopsis thaliana OX=3702 GN=KLCR1 PE=1 SV=1
1678	3554	Q9FK35	91.17	31	31	5.1E7	6	4	7	Y	27335	Adenylate kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ADK2 PE=1 SV=1
2057	4952	A0A178WCF3	91.15	21	21	4.17E6	4	4	4	Y	40629	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g58000 PE=4 SV=1
2057	4199	Q9SGW5	91.15	20	20	4.17E6	4	4	4	Y	41016	F1N19.7 OS=Arabidopsis thaliana OX=3702 GN=At1g64500 PE=1 SV=1
2057	4200	Q8VZN7	91.15	20	20	4.17E6	4	4	4	Y	40986	Putative peptide transporter protein OS=Arabidopsis thaliana OX=3702 GN=At1g64500 PE=2 SV=1
1796	8349	A0A178UII7	91.15	44	44	1.86E7	5	5	6	N	25099	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g40660 PE=4 SV=1
1796	8350	F4K329	91.15	44	44	1.86E7	5	5	6	N	25099	Plasma membrane fusion protein OS=Arabidopsis thaliana OX=3702 GN=At5g42765 PE=4 SV=1
2011	6132	A0A178WM02	91.07	37	37	3.36E7	5	5	6	N	17054	MLP423 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g25180 PE=4 SV=1
2011	6133	Q93VR4	91.07	37	37	3.36E7	5	5	6	N	17054	MLP-like protein 423 OS=Arabidopsis thaliana OX=3702 GN=MLP423 PE=2 SV=1
1469	6554	Q8VYL3	91.01	13	13	6.71E6	5	3	8	Y	55748	Aspartic proteinase A2 OS=Arabidopsis thaliana OX=3702 GN=APA2 PE=2 SV=1
1469	6555	A0A178WBC5	91.01	13	13	6.71E6	5	3	8	Y	55716	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g55540 PE=3 SV=1
1675	4915	F4I907	90.97	20	20	4.6E7	5	5	6	Y	37781	Glyoxylate/succinic semialdehyde reductase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GLYR2 PE=1 SV=1
1675	4916	A0A178WM95	90.97	20	20	4.6E7	5	5	6	Y	37781	GR2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g18560 PE=4 SV=1
1675	4914	A0A1P8AS42	90.97	23	23	4.6E7	5	5	6	Y	31282	Glyoxylate reductase 2 OS=Arabidopsis thaliana OX=3702 GN=GLYR2 PE=4 SV=1
1675	4917	Q9LNP0	90.97	18	18	4.6E7	5	5	6	Y	41485	F1L3.35 OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2165	5594	Q9M277	90.84	30	30	8.7E7	4	4	5	N	29585	AT3g61870/F21F14_40 OS=Arabidopsis thaliana OX=3702 GN=F21F14.40 PE=2 SV=1
2165	5595	A0A384L6I1	90.84	30	30	8.7E7	4	4	5	N	29585	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g56170 PE=4 SV=1
1713	5401	Q681W6	90.78	28	28	2E7	4	4	5	N	22577	Putative ribosomal protein S9 OS=Arabidopsis thaliana OX=3702 GN=At1g74980 PE=2 SV=1
1713	5402	A0A384LEA2	90.78	28	28	2E7	4	4	5	N	22577	TWN3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g69360 PE=3 SV=1
1713	5403	Q9XJ27	90.78	28	28	2E7	4	4	5	N	22577	30S ribosomal protein S9, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPS9 PE=2 SV=1
1206	7055	A0A178UK13	90.67	23	23	3.49E7	5	5	7	N	25497	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g45680 PE=4 SV=1
1206	7056	Q8RXX5	90.67	23	23	3.49E7	5	5	7	N	25469	50S ribosomal protein L19-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g47190 PE=2 SV=1
1940	7109	Q39079	90.63	16	16	1.57E7	4	4	4	Y	59232	Chaperone protein dnaJ 13 OS=Arabidopsis thaliana OX=3702 GN=ATJ13 PE=1 SV=2
1727	7418	O82357	90.59	18	18	1.63E7	3	3	7	N	36693	3-methyl-2-oxobutanoate hydroxymethyltransferase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=KPHMT1 PE=1 SV=1
1394	6499	Q9SI20	90.56	30	30	1.42E7	6	2	10	N	25266	Elongation factor 1-delta 2 OS=Arabidopsis thaliana OX=3702 GN=At2g18110 PE=1 SV=1
1888	5806	Q9FVR9	90.55	13	13	5.69E6	5	5	5	Y	61724	FAD/NAD(P)-binding oxidoreductase family protein OS=Arabidopsis thaliana OX=3702 GN=At1g57770 PE=2 SV=1
1888	5807	Q9FVS7	90.55	12	12	5.69E6	5	5	5	Y	62114	Uncharacterized protein T8L23.23 OS=Arabidopsis thaliana OX=3702 GN=T8L23.23 PE=4 SV=1
1901	5230	Q9LPS4	90.41	20	20	1.08E7	4	4	5	N	34054	F11F12.14 protein OS=Arabidopsis thaliana OX=3702 GN=F11F12.14 PE=3 SV=1
1901	5231	Q84K35	90.41	19	19	1.08E7	4	4	5	N	34800	Indigoidine synthase A family protein OS=Arabidopsis thaliana OX=3702 GN=At1g50510 PE=1 SV=1
1901	5232	A0A178WKH3	90.41	19	19	1.08E7	4	4	5	N	34800	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g44710 PE=1 SV=1
1901	5233	Q9C6Q2	90.41	18	18	1.08E7	4	4	5	N	38417	Uncharacterized protein F17J6.5 OS=Arabidopsis thaliana OX=3702 GN=F17J6.5 PE=3 SV=1
1503	6670	F4JRV2	90.38	40	40	4.47E7	5	5	7	N	21098	Superoxide dismutase OS=Arabidopsis thaliana OX=3702 GN=FSD1 PE=3 SV=1
1503	6673	P21276	90.38	35	35	4.47E7	5	5	7	N	23791	Superoxide dismutase [Fe] 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FSD1 PE=1 SV=4
1708	2864	A0A160CBM4	90.28	18	18	9.07E6	6	5	6	N	45704	Acyl-[acyl-carrier-protein] desaturase OS=Arabidopsis thaliana OX=3702 GN=SSI2 PE=2 SV=1
1708	2865	O22832	90.28	18	18	9.07E6	6	5	6	N	45693	Stearoyl-[acyl-carrier-protein] 9-desaturase 7, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FAB2 PE=1 SV=1
1708	2866	A0A178VWD8	90.28	18	18	9.07E6	6	5	6	N	45683	Acyl-[acyl-carrier-protein] desaturase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g41230 PE=3 SV=1
1708	2867	F4IS32	90.28	18	18	9.07E6	6	5	6	N	45651	Acyl-[acyl-carrier-protein] desaturase OS=Arabidopsis thaliana OX=3702 GN=SSI2 PE=1 SV=1
1839	2164	P92949	90.24	12	12	2.81E7	6	6	6	Y	81501	Ferric reduction oxidase 2 OS=Arabidopsis thaliana OX=3702 GN=FRO2 PE=1 SV=2
1839	2165	A0A178WMG4	90.24	12	12	2.81E7	6	6	6	Y	81501	FRO2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g00650 PE=4 SV=1
1839	2169	A0A1P8AVL6	90.24	11	11	2.81E7	6	6	6	Y	90447	Ferric reduction oxidase 2 OS=Arabidopsis thaliana OX=3702 GN=FRO2 PE=4 SV=1
1441	3783	Q8W593	90.23	21	21	2.49E7	6	5	8	Y	39167	Probable lactoylglutathione lyase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g67280 PE=1 SV=1
1441	3784	A0A178W619	90.23	21	21	2.49E7	6	5	8	Y	39167	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g61190 PE=4 SV=1
1341	6032	P51412	90.21	33	33	1.06E8	5	5	8	N	24038	50S ribosomal protein L21, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPL21 PE=2 SV=1
1341	6033	A0A178WJ77	90.21	33	33	1.06E8	5	5	8	N	24069	RPL21C OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g36490 PE=3 SV=1
1565	7482	Q56ZN6	90.19	8	8	5.25E7	6	6	8	Y	85133	Pyrophosphate-energized membrane proton pump 2 OS=Arabidopsis thaliana OX=3702 GN=AVPL1 PE=1 SV=2
1565	7483	A0A178WC99	90.19	8	8	5.25E7	6	6	8	Y	85133	VP2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g73620 PE=3 SV=1
1945	4081	Q9FNN0	90.08	14	14	1.01E7	3	3	3	N	45845	Calcium-binding EF hand family protein OS=Arabidopsis thaliana OX=3702 GN=MAH20.14 PE=2 SV=1
1945	4082	A0A178UHL1	90.08	14	14	1.01E7	3	3	3	N	45813	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g08500 PE=4 SV=1
941	8203	A0A178V247	90.07	13	13	1.74E8	4	4	12	N	30529	Reticulon-like protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g27390 PE=4 SV=1
941	8204	Q9SUR3	90.07	13	13	1.74E8	4	4	12	N	30529	Reticulon-like protein B1 OS=Arabidopsis thaliana OX=3702 GN=RTNLB1 PE=1 SV=1
1572	3765	Q66GQ3	89.99	19	19	2.23E7	6	6	6	Y	59571	Protein disulfide isomerase-like 1-6 OS=Arabidopsis thaliana OX=3702 GN=PDIL1-6 PE=2 SV=1
1572	3766	A0A178VNL8	89.99	19	19	2.23E7	6	6	6	Y	59571	PDIL1-6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g16910 PE=4 SV=1
1966	5198	Q9LKR8	89.97	17	17	2.94E7	4	4	6	N	48237	Rubisco accumulation factor 1.1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RAF1.1 PE=1 SV=1
1966	5199	A0A178UM58	89.97	17	17	2.94E7	4	4	6	N	48335	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g28800 PE=4 SV=1
1856	5854	A0A178W7C0	89.95	11	11	7.44E6	4	4	4	N	48155	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g00800 PE=4 SV=1
1856	5855	F4HU51	89.95	11	11	7.44E6	4	4	4	N	48155	Acyl-CoA thioesterase II OS=Arabidopsis thaliana OX=3702 GN=At1g01710 PE=4 SV=1
1287	7448	Q9ZUX4	89.94	40	40	1.76E8	4	4	9	N	11948	Uncharacterized protein At2g27730, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g27730 PE=1 SV=1
1737	4568	Q9LM25	89.93	14	14	9.9E6	5	5	5	N	75942	ERAD-associated E3 ubiquitin-protein ligase component HRD3A OS=Arabidopsis thaliana OX=3702 GN=HRD3A PE=1 SV=1
1739	4014	Q94II3	89.93	14	14	1.15E6	6	2	6	Y	68331	Probable methyltransferase PMT21 OS=Arabidopsis thaliana OX=3702 GN=ERD3 PE=2 SV=1
1739	4015	A0A178V0E9	89.93	14	14	1.15E6	6	2	6	Y	68360	ERD3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g22580 PE=4 SV=1
1800	7649	A0A2P2CLC5	89.90	10	10	6.88E7	5	5	6	Y	74526	NADH-ubiquinone oxidoreductase chain 5 OS=Arabidopsis thaliana OX=3702 GN=nad5 PE=3 SV=1
1800	7650	B5TM94	89.90	10	10	6.88E7	5	5	6	Y	74392	NADH-ubiquinone oxidoreductase chain 5 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1800	7651	P29388	89.90	10	10	6.88E7	5	5	6	Y	74316	NADH-ubiquinone oxidoreductase chain 5 OS=Arabidopsis thaliana OX=3702 GN=ND5 PE=2 SV=3
1892	6255	Q9MAH3	89.65	25	25	4.56E6	5	5	6	Y	46991	Protein DJ-1 homolog B OS=Arabidopsis thaliana OX=3702 GN=DJ1B PE=1 SV=1
1892	6254	A0A1P8AUR1	89.65	29	29	4.56E6	5	5	6	Y	40362	Class I glutamine amidotransferase-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=DJ1B PE=4 SV=1
1673	3748	A0A1P8BHA6	89.63	19	19	3.69E7	6	6	6	Y	50594	Phytochelatin synthase 1 (PCS1) OS=Arabidopsis thaliana OX=3702 GN=CAD1 PE=1 SV=1
1673	3749	A0A178UMN4	89.63	17	17	3.69E7	6	6	6	Y	54475	PCS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g42190 PE=4 SV=1
1673	3750	Q9S7Z3	89.63	17	17	3.69E7	6	6	6	Y	54475	Glutathione gamma-glutamylcysteinyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=PCS1 PE=1 SV=1
2335	4962	B9DHF9	89.57	19	19	6.78E6	4	4	4	Y	42859	AT1G62640 protein OS=Arabidopsis thaliana OX=3702 GN=At1g62640 PE=2 SV=1
2335	4963	A0A178W1P7	89.57	19	19	6.78E6	4	4	4	Y	42816	KAS III OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g55920 PE=3 SV=1
2335	4964	P49243	89.57	19	19	6.78E6	4	4	4	Y	42847	3-oxoacyl-[acyl-carrier-protein] synthase III, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g62640 PE=2 SV=2
1779	7987	Q9SJ81	89.48	20	20	1.1E8	5	5	7	N	26846	Fasciclin-like arabinogalactan protein 7 OS=Arabidopsis thaliana OX=3702 GN=FLA7 PE=2 SV=1
1779	7988	A0A178VRR8	89.48	20	20	1.1E8	5	5	7	N	26832	FLA7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g03900 PE=4 SV=1
1258	3196	Q94A52	89.37	19	19	1.69E7	6	4	9	Y	45845	Eukaryotic initiation factor 4A-III homolog OS=Arabidopsis thaliana OX=3702 GN=EIF4A3 PE=1 SV=2
1258	3336	A0A178VBY4	89.37	19	19	1.69E7	6	4	9	Y	45831	eIF4A-III OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g21020 PE=4 SV=1
1559	3259	Q6TBX7	89.36	12	12	4.52E6	4	4	5	N	60556	Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CYP97C1 PE=1 SV=1
1559	3260	A0A178VFG4	89.36	12	12	4.52E6	4	4	5	N	60718	LUT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g47530 PE=3 SV=1
1903	3934	F4JHJ0	89.34	22	22	3.85E7	5	5	5	N	25342	HSP20-like chaperones superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g02450 PE=1 SV=1
1903	3935	Q8L7U4	89.34	22	22	3.85E7	5	5	5	N	25471	Co-chaperone protein p23-1 OS=Arabidopsis thaliana OX=3702 GN=P23-1 PE=1 SV=1
1264	4566	A0A178WKN8	89.34	63	63	4.16E8	7	7	11	N	10873	CPN10 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g15670 PE=3 SV=1
1264	4567	P34893	89.34	63	63	4.16E8	7	7	11	N	10812	10 kDa chaperonin, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CPN10 PE=1 SV=1
1681	3854	A0A178UGJ8	89.32	6	6	9.87E6	4	4	4	Y	122503	Cellulose synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g64410 PE=3 SV=1
1681	3855	Q94JQ6	89.32	6	6	9.87E6	4	4	4	Y	122502	Cellulose synthase A catalytic subunit 6 [UDP-forming] OS=Arabidopsis thaliana OX=3702 GN=CESA6 PE=1 SV=2
1681	3856	A0A068FJJ5	89.32	6	6	9.87E6	4	4	4	Y	122502	Cellulose synthase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT5G64740 PE=2 SV=1
1845	2764	W8PUV4	89.31	14	14	1.24E7	4	4	5	N	69321	Glycosyltransferase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT3G07020 PE=2 SV=1
1845	2765	Q9M8Z7	89.31	14	14	1.24E7	4	4	5	N	69277	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
1845	2766	A0A178VKP8	89.31	14	14	1.24E7	4	4	5	N	69305	UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g06920 PE=4 SV=1
1845	2763	A0A1I9LNA9	89.31	16	16	1.24E7	4	4	5	N	61061	UDP-Glycosyltransferase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=SGT PE=1 SV=1
1997	6181	A0A178VQ56	89.31	47	47	3.53E7	6	6	6	Y	23921	SDF2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g20840 PE=4 SV=1
1997	6182	Q93ZE8	89.31	47	47	3.53E7	6	6	6	Y	23935	Stromal cell-derived factor 2-like protein OS=Arabidopsis thaliana OX=3702 GN=SDF2 PE=1 SV=1
1286	5577	A0A178V630	89.28	38	38	4.6E7	4	4	8	N	18317	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g02420 PE=3 SV=1
1286	5578	Q9M9M9	89.28	38	38	4.6E7	4	4	8	N	18317	Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Arabidopsis thaliana OX=3702 GN=At3g03100 PE=1 SV=1
1286	5805	F4IZR4	89.28	38	38	4.6E7	4	4	8	N	18292	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Arabidopsis thaliana OX=3702 GN=At3g03100 PE=3 SV=1
1860	4073	Q9M0Z3	89.21	8	8	9.67E6	4	4	4	N	83791	K(+) efflux antiporter 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=KEA3 PE=1 SV=2
1860	4072	A0A178V218	89.21	8	8	9.67E6	4	4	4	N	83828	KEA3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g05420 PE=4 SV=1
2396	59886	Q0IGK5	89.19	18	18	9.67E6	4	4	4	Y	43767	At3g52190 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2396	59887	A0A384KIG4	89.19	18	18	9.67E6	4	4	4	Y	43767	PHF1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g46620 PE=4 SV=1
2396	59888	Q8GYE0	89.19	18	18	9.67E6	4	4	4	Y	43767	SEC12-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=PHF1 PE=1 SV=2
1356	8062	O49627	89.18	48	48	5.26E7	6	6	7	Y	17915	Iron-sulfur cluster assembly protein 1 OS=Arabidopsis thaliana OX=3702 GN=ISU1 PE=1 SV=1
1356	8063	A0A178UZH3	89.18	48	48	5.26E7	6	6	7	Y	17915	Iron-sulfur cluster assembly protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g25820 PE=3 SV=1
1715	5597	Q9FDW8	89.14	50	50	2.71E7	4	4	6	N	15220	Cytochrome b5 isoform A OS=Arabidopsis thaliana OX=3702 GN=CB5-A PE=1 SV=1
1715	5598	A0A178WMK3	89.14	50	50	2.71E7	4	4	6	N	15220	CB5-A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g26690 PE=3 SV=1
2460	4201	Q9SL67	89.10	14	14	7.38E6	3	3	4	N	49347	26S proteasome regulatory subunit 4 homolog B OS=Arabidopsis thaliana OX=3702 GN=RPT2B PE=1 SV=1
2460	4202	A0A178V3V3	89.10	14	14	7.38E6	3	3	4	N	49370	RPT2a OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g33370 PE=3 SV=1
2460	4203	A0A178VM16	89.10	14	14	7.38E6	3	3	4	N	49347	RPT2b OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g15450 PE=3 SV=1
2460	4204	Q9SZD4	89.10	14	14	7.38E6	3	3	4	N	49370	26S proteasome regulatory subunit 4 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPT2A PE=1 SV=1
1226	4355	A0A178WD24	89.09	18	18	2.88E7	8	8	9	Y	60236	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g58480 PE=3 SV=1
1226	4356	Q6GKU7	89.09	18	18	2.88E7	8	8	9	Y	60236	At1g64880 OS=Arabidopsis thaliana OX=3702 GN=At1g64880 PE=2 SV=1
1531	2690	Q93Z11	88.92	21	21	6.16E7	6	6	9	N	33439	AT5g37360/MNJ8_150 OS=Arabidopsis thaliana OX=3702 GN=MNJ8.18 PE=2 SV=1
1505	7505	Q29PY2	88.86	28	28	1.11E7	5	3	9	N	24789	At5g12110 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1505	7506	A0A384KQ94	88.86	28	28	1.11E7	5	3	9	N	24789	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g11840 PE=3 SV=1
1505	7507	Q84WM9	88.86	28	28	1.11E7	5	3	9	N	24789	Elongation factor 1-beta 1 OS=Arabidopsis thaliana OX=3702 GN=At5g12110 PE=2 SV=2
1477	4026	P46310	88.73	15	15	3.22E7	5	5	7	N	51175	sn-2 acyl-lipid omega-3 desaturase (ferredoxin), chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FAD7 PE=1 SV=1
2223	4385	A0A178VEN3	88.64	30	30	2.89E7	4	4	4	Y	26482	Eukaryotic translation initiation factor 6 OS=Arabidopsis thaliana OX=3702 GN=EIF6 PE=3 SV=1
2223	4386	Q9M060	88.64	30	30	2.89E7	4	4	4	Y	26482	Eukaryotic translation initiation factor 6-2 OS=Arabidopsis thaliana OX=3702 GN=EIF6-2 PE=2 SV=1
1710	3642	Q9FG63	88.61	16	16	5.67E6	4	4	4	Y	49339	Gb\|AAD26879.1 OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2129	2063	Q29Q46	88.59	17	17	7.94E6	4	2	4	Y	32755	At3g56190 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2129	2064	Q9SPE6	88.59	17	17	7.94E6	4	2	4	Y	32755	Alpha-soluble NSF attachment protein 2 OS=Arabidopsis thaliana OX=3702 GN=ASNAP2 PE=1 SV=1
2129	2065	A0A384LGX0	88.59	17	17	7.94E6	4	2	4	Y	32755	ASNAP OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g50830 PE=4 SV=1
1969	6593	Q06588	88.57	23	23	7.4E6	4	3	6	Y	36677	1-aminocyclopropane-1-carboxylate oxidase 4 OS=Arabidopsis thaliana OX=3702 GN=ACO4 PE=1 SV=2
1969	6594	A0A178WHU2	88.57	23	23	7.4E6	4	3	6	Y	36677	EFE OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g04380 PE=3 SV=1
2391	5189	A0A178VNP6	88.55	27	27	1.71E7	4	4	4	N	23428	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g21080 PE=4 SV=1
2391	5190	Q84JM6	88.55	27	27	1.71E7	4	4	4	N	23428	ER membrane protein complex subunit-like protein (DUF2012) OS=Arabidopsis thaliana OX=3702 GN=At2g25310 PE=2 SV=1
1643	59368	A0A178VTC7	88.54	41	41	5.31E7	6	6	8	Y	32691	p4H5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g13020 PE=4 SV=1
1643	59369	Q24JN5	88.54	41	41	5.31E7	6	6	8	Y	32691	Prolyl 4-hydroxylase 5 OS=Arabidopsis thaliana OX=3702 GN=P4H5 PE=2 SV=1
1952	3960	A0A178WL99	88.54	13	13	1.24E7	5	5	6	N	55568	HAP15 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g21180 PE=4 SV=1
1952	3961	Q9LNU4	88.54	13	13	1.24E7	5	5	6	N	55582	26S proteasome non-ATPase regulatory subunit 3 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPN3A PE=1 SV=3
1493	4827	A0A178VNZ5	88.49	25	25	3.37E7	6	6	8	Y	40823	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g39620 PE=4 SV=1
1493	4828	Q8LCU7	88.49	25	25	3.37E7	6	6	8	Y	40823	Enoyl-[acyl-carrier-protein] reductase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g45770 PE=1 SV=1
2126	3701	F4HS76	88.36	15	15	1.34E7	5	5	5	Y	52483	Actin-like ATPase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=NHO1 PE=4 SV=1
2126	3702	A0A178WEZ9	88.36	14	14	1.34E7	5	5	5	Y	56437	NHO1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g75310 PE=4 SV=1
2126	3703	Q9M8L4	88.36	14	14	1.34E7	5	5	5	Y	56437	Glycerol kinase OS=Arabidopsis thaliana OX=3702 GN=GLPK PE=1 SV=1
1830	7688	A0A178URD1	88.33	25	25	4.05E7	3	3	6	Y	20365	PDCB1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g60590 PE=4 SV=1
1830	7689	Q9FNQ2	88.33	25	25	4.05E7	3	3	6	Y	20365	PLASMODESMATA CALLOSE-BINDING PROTEIN 1 OS=Arabidopsis thaliana OX=3702 GN=PDCB1 PE=1 SV=1
1830	7690	A0A178UP42	88.33	23	23	4.05E7	3	3	6	Y	22528	PDCB1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g60590 PE=4 SV=1
2162	8020	Q9LVC8	88.31	27	27	1.7E7	4	4	5	Y	32290	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COQ5 PE=2 SV=1
2162	8021	A0A178U865	88.31	27	27	1.7E7	4	4	5	Y	32290	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COQ5 PE=3 SV=1
1498	3775	A0A178UKF1	88.30	23	23	2.83E7	6	6	8	Y	48337	UAP56a OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g10900 PE=4 SV=1
1498	3776	Q9LFN6	88.30	23	23	2.83E7	6	6	8	Y	48337	DEAD-box ATP-dependent RNA helicase 56 OS=Arabidopsis thaliana OX=3702 GN=RH56 PE=1 SV=2
1498	3777	Q56XG6	88.30	23	23	2.83E7	6	6	8	Y	48337	DEAD-box ATP-dependent RNA helicase 15 OS=Arabidopsis thaliana OX=3702 GN=RH15 PE=1 SV=3
1498	3780	F4JWF7	88.30	21	21	2.83E7	6	6	8	Y	52860	DEAD/DEAH box RNA helicase family protein OS=Arabidopsis thaliana OX=3702 GN=UAP56b PE=4 SV=1
1498	3781	F4JWF6	88.30	21	21	2.83E7	6	6	8	Y	55465	DEAD/DEAH box RNA helicase family protein OS=Arabidopsis thaliana OX=3702 GN=UAP56b PE=4 SV=1
2081	3806	A0A178VL64	88.24	23	23	2.13E7	5	5	5	Y	72613	Acetolactate synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g42690 PE=3 SV=1
2081	3807	P17597	88.24	23	23	2.13E7	5	5	5	Y	72585	Acetolactate synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ALS PE=1 SV=1
2847	11463	A0A384KMU4	88.11	40	40	8.49E6	3	3	3	Y	17439	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g02600 PE=4 SV=1
2847	11464	Q9M9P5	88.11	40	40	8.49E6	3	3	3	Y	17439	Adenine nucleotide alpha hydrolases-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g03270 PE=4 SV=1
2847	11465	Q8LFK2	88.11	32	32	8.49E6	3	3	3	Y	22602	AT3G03270 protein OS=Arabidopsis thaliana OX=3702 GN=At3g03270 PE=2 SV=1
2231	5099	Q9SX65	88.01	42	42	1.13E7	4	4	5	Y	16713	1,4-dihydroxy-2-naphthoyl-CoA thioesterase 1 OS=Arabidopsis thaliana OX=3702 GN=DHNAT1 PE=1 SV=1
2231	5100	A0A178WIC5	88.01	42	42	1.13E7	4	4	5	Y	16713	DHNAT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g42390 PE=4 SV=1
1677	2940	A0A178V2J1	88.00	26	26	4.78E7	5	5	6	N	37206	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g23330 PE=4 SV=1
1677	2939	Q94K62	88.00	24	24	4.78E7	5	5	6	N	40107	Uncharacterized protein At4g19880 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At4g19880 PE=2 SV=2
1677	2937	Q8H121	88.00	24	24	4.78E7	5	5	6	N	40576	Glutathione S-transferase family protein OS=Arabidopsis thaliana OX=3702 GN=At4g19880 PE=1 SV=1
1677	2938	F4JU03	88.00	23	23	4.78E7	5	5	6	N	43651	Glutathione S-transferase family protein OS=Arabidopsis thaliana OX=3702 GN=At4g19880 PE=1 SV=1
1677	3581	F4JU04	88.00	27	27	4.78E7	5	5	6	N	35570	Glutathione S-transferase family protein OS=Arabidopsis thaliana OX=3702 GN=At4g19880 PE=1 SV=1
2923	7281	A0A178UCM7	87.96	21	21	9.8E6	2	2	3	Y	19538	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g17270 PE=3 SV=1
2923	7282	Q9LF68	87.96	21	21	9.8E6	2	2	3	Y	19538	Protein BOLA4, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=BOLA4 PE=1 SV=1
2116	6597	A0A178UG20	87.89	20	20	1.23E8	3	3	4	Y	32220	HDT2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g22080 PE=4 SV=1
2116	6598	Q56WH4	87.89	20	20	1.23E8	3	3	4	Y	32348	Histone deacetylase HDT2 OS=Arabidopsis thaliana OX=3702 GN=HDT2 PE=1 SV=2
2141	59432	A0A178UUI8	87.71	15	15	4.44E7	4	4	4	N	50127	COX15 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g55260 PE=3 SV=1
2141	59433	Q9FKT8	87.71	15	15	4.44E7	4	4	4	N	50127	Cytochrome c oxidase assembly protein COX15 OS=Arabidopsis thaliana OX=3702 GN=COX15 PE=2 SV=1
1668	2723	A0A178W059	87.70	11	11	9.09E6	5	5	6	N	79485	TMT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g21890 PE=3 SV=1
1668	2724	Q96290	87.70	11	11	9.09E6	5	5	6	N	79485	Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana OX=3702 GN=MSSP1 PE=1 SV=2
2138	8767	A0A178VNN5	87.64	24	24	4.16E6	5	5	5	Y	47827	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g32500 PE=4 SV=1
2138	8768	Q9SJ66	87.64	24	24	4.16E6	5	5	5	Y	47855	Probable sucrose-phosphatase 2 OS=Arabidopsis thaliana OX=3702 GN=SPP2 PE=2 SV=2
998	7431	A0A384LCI6	87.62	19	19	2.37E8	3	2	15	Y	26115	FLA9 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g03140 PE=4 SV=1
998	7432	Q9ZWA8	87.62	19	19	2.37E8	3	2	15	Y	26115	Fasciclin-like arabinogalactan protein 9 OS=Arabidopsis thaliana OX=3702 GN=FLA9 PE=2 SV=1
998	7433	B3LF88	87.62	19	19	2.37E8	3	2	15	Y	26115	At1g03870 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2227	6232	Q8GWG0	87.56	24	24	5.24E6	4	4	5	Y	43020	Glycerol-3-phosphate acyltransferase 9 OS=Arabidopsis thaliana OX=3702 GN=GPAT9 PE=1 SV=1
2227	6233	A0A178UCY8	87.56	24	24	5.24E6	4	4	5	Y	43020	GPAT9 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g60080 PE=1 SV=1
2087	108060	Q66GI4	87.56	10	10	5.25E6	4	4	4	Y	64877	Proteinaceous RNase P 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PRORP1 PE=1 SV=1
2087	108061	A0A178VZD1	87.56	10	10	5.25E6	4	4	4	Y	64877	PRORP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g28540 PE=4 SV=1
1873	4650	O80634	87.48	25	25	1.65E7	4	4	5	N	26963	Photosynthetic NDH subunit of lumenal location 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PNSL1 PE=1 SV=2
1873	4651	A0A178VT67	87.48	25	25	1.65E7	4	4	5	N	26990	PPL2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g36410 PE=4 SV=1
2229	7939	A0A178UCK1	87.37	17	17	2.54E6	5	2	5	Y	47582	CKA1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g67460 PE=3 SV=1
2229	7940	Q08467	87.37	17	17	2.54E6	5	2	5	Y	47640	Casein kinase II subunit alpha-1 OS=Arabidopsis thaliana OX=3702 GN=CKA1 PE=1 SV=3
1744	5692	Q94CF0	87.34	13	13	3.77E6	4	4	5	Y	61230	EH domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=EHD1 PE=1 SV=1
1744	5693	A0A178VAZ5	87.34	13	13	3.77E6	4	4	5	Y	61230	EHD1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g21630 PE=3 SV=1
2488	5067	Q9C8L4	87.29	24	24	1.21E7	4	4	4	Y	32332	Persulfide dioxygenase ETHE1 homolog, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GLY3 PE=1 SV=3
2488	5068	A0A178WPN7	87.29	24	24	1.21E7	4	4	4	Y	32260	GLY3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g47940 PE=4 SV=1
1883	3288	A0A178WCS3	87.27	31	31	1.05E7	6	3	6	N	24108	RAB11c OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g09570 PE=4 SV=1
1883	3289	O04486	87.27	31	31	1.05E7	6	3	6	N	24108	Ras-related protein RABA2a OS=Arabidopsis thaliana OX=3702 GN=RABA2A PE=2 SV=1
1506	5973	A0A178WAB5	87.26	35	35	2.98E7	5	5	7	N	18665	OHP2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g34800 PE=4 SV=1
1506	5974	Q9FEC1	87.26	35	35	2.98E7	5	5	7	N	18665	Light-harvesting complex-like protein OHP2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OHP2 PE=2 SV=1
1621	2632	Q8S8L9	87.23	8	8	1.63E6	4	2	5	N	90229	Uncharacterized TPR repeat-containing protein At2g32450 OS=Arabidopsis thaliana OX=3702 GN=At2g32450 PE=1 SV=1
1621	3086	A0A178VSB1	87.23	8	8	1.63E6	4	2	5	N	90211	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g28790 PE=4 SV=1
1621	2633	A0A1W6AK31	87.23	8	8	1.63E6	4	2	5	N	90229	Calcium-binding tetratricopeptide family protein (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT2G32450.1 PE=2 SV=1
1854	108051	A0A178UR78	87.20	24	24	3.68E6	5	2	5	Y	36452	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g45900 PE=4 SV=1
1854	108052	Q93YQ3	87.20	24	24	3.68E6	5	2	5	Y	36452	Formyltetrahydrofolate deformylase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PURU1 PE=1 SV=1
1384	4438	A0A178UJT2	87.14	20	20	1.82E7	6	6	8	N	43940	GCD1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g61780 PE=4 SV=1
1384	4439	F4K6F8	87.14	20	20	1.82E7	6	6	8	N	43940	Ribosomal protein L20 OS=Arabidopsis thaliana OX=3702 GN=GCD1 PE=4 SV=1
1384	4034	A0A178UHU2	87.14	18	18	1.82E7	6	6	8	N	48314	GCD1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g61780 PE=4 SV=1
1384	4035	Q9LVA9	87.14	18	18	1.82E7	6	6	8	N	48314	Gb\|AAC32909.1 OS=Arabidopsis thaliana OX=3702 GN=GCD1 PE=4 SV=1
1964	9365	C0Z3J0	87.13	40	40	6.63E6	4	4	5	N	20309	AT1G27020 protein OS=Arabidopsis thaliana OX=3702 GN=At1g27020 PE=2 SV=1
1964	9367	O04551	87.13	23	23	6.63E6	4	4	5	N	35079	Plant/protein OS=Arabidopsis thaliana OX=3702 GN=At1g27020 PE=2 SV=1
1964	9368	A0A178W3P9	87.13	23	23	6.63E6	4	4	5	N	35063	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g27430 PE=4 SV=1
1852	108048	P0DKC5	87.06	20	20	1.62E7	6	5	6	Y	39087	11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana OX=3702 GN=HSD1 PE=1 SV=1
1852	108049	P0DKC6	87.06	20	20	1.62E7	6	5	6	Y	39087	11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana OX=3702 GN=HSD1 PE=1 SV=1
1852	108050	A0A178US17	87.06	20	20	1.62E7	6	5	6	Y	39087	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g49510 PE=3 SV=1
2084	60339	A0A178VFI7	87.05	21	21	6.96E6	4	4	4	Y	52866	TGD4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g06830 PE=4 SV=1
2084	60340	Q9M903	87.05	21	21	6.96E6	4	4	4	Y	52822	Protein TRIGALACTOSYLDIACYLGLYCEROL 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TGD4 PE=1 SV=1
1754	5124	A0A178UHW9	86.94	18	18	3.92E6	5	3	5	Y	53561	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g49450 PE=4 SV=1
1754	5125	Q0WLC7	86.94	16	16	3.92E6	5	3	5	Y	59812	CBS domain-containing protein CBSCBSPB4 OS=Arabidopsis thaliana OX=3702 GN=CBSCBSPB4 PE=1 SV=2
1754	5126	A0A178UJ06	86.94	16	16	3.92E6	5	3	5	Y	59855	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g49450 PE=4 SV=1
1754	5127	P0DH79	86.94	16	16	3.92E6	5	3	5	Y	59812	CBS domain-containing protein CBSCBSPB5 OS=Arabidopsis thaliana OX=3702 GN=CBSCBSPB5 PE=1 SV=1
1529	8167	F4IAG5	86.78	22	22	2.92E7	5	5	6	N	31313	ATP-dependent Clp protease proteolytic subunit OS=Arabidopsis thaliana OX=3702 GN=CLPP6 PE=3 SV=1
2097	4989	Q9C942	86.69	25	25	4.04E7	4	4	5	Y	36975	Caffeoylshikimate esterase OS=Arabidopsis thaliana OX=3702 GN=CSE PE=1 SV=1
2405	7152	A0A178V0T8	86.67	25	25	3.26E7	3	3	3	N	18714	ATOEP16-S OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g18970 PE=4 SV=1
2405	7153	Q0WMZ5	86.67	25	25	3.26E7	3	3	3	N	18714	Outer envelope pore protein 16-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OEP162 PE=2 SV=1
1633	2660	A0A178VFR4	86.64	10	10	1.07E7	7	5	7	N	106421	VLN3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g51990 PE=4 SV=1
1633	2661	O81645	86.64	10	10	1.07E7	7	5	7	N	106349	Villin-3 OS=Arabidopsis thaliana OX=3702 GN=VLN3 PE=1 SV=2
2221	18779	A0A1I9LPN6	86.60	15	15	5.49E6	4	4	4	Y	50897	PYRIMIDINE 4 OS=Arabidopsis thaliana OX=3702 GN=PYD4 PE=3 SV=1
2221	18780	A0A178V7X5	86.60	15	15	5.49E6	4	4	4	Y	52461	PYD4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g08420 PE=3 SV=1
2221	18781	Q9SR86	86.60	15	15	5.49E6	4	4	4	Y	52461	Alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g08860 PE=2 SV=1
2221	18782	Q0WWF1	86.60	15	15	5.49E6	4	4	4	Y	52461	Aminotransferase like protein OS=Arabidopsis thaliana OX=3702 GN=At3g08860 PE=2 SV=1
2186	10965	A0A384KKH3	86.59	28	28	1.81E7	3	3	4	N	22842	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g41610 PE=4 SV=1
2186	10966	Q8LCY4	86.59	28	28	1.81E7	3	3	4	N	22914	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2186	10967	Q8VZU4	86.59	28	28	1.81E7	3	3	4	N	22842	Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g44065 PE=2 SV=1
1500	7369	Q8VYA4	86.56	13	13	1.32E7	4	4	4	Y	65468	At4g18810 OS=Arabidopsis thaliana OX=3702 GN=At4g18810 PE=2 SV=1
1500	7370	A0A178UYQ1	86.56	13	13	1.32E7	4	4	4	Y	65468	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g22110 PE=4 SV=1
1500	7411	Q9SN34	86.56	12	12	1.32E7	4	4	4	Y	68454	Uncharacterized protein AT4g18810 OS=Arabidopsis thaliana OX=3702 GN=F28A21.220 PE=4 SV=1
1500	7424	F4JRN8	86.56	12	12	1.32E7	4	4	4	Y	69138	NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g18810 PE=4 SV=1
1896	5827	A0A1P8B8F3	86.52	31	31	1.12E7	5	5	5	Y	26680	Cold shock domain protein 1 OS=Arabidopsis thaliana OX=3702 GN=CSDP1 PE=1 SV=1
1896	4815	O65639	86.52	27	27	1.12E7	5	5	5	Y	30088	Cold shock protein 1 OS=Arabidopsis thaliana OX=3702 GN=CSP1 PE=1 SV=1
1896	5828	A0A178UVZ7	86.52	27	27	1.12E7	5	5	5	Y	30106	CSP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g41170 PE=4 SV=1
1778	9286	Q39218	86.50	24	24	2.46E7	4	4	6	Y	42721	Serine acetyltransferase 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SAT3 PE=1 SV=3
1778	9287	A0A178VHI8	86.50	24	24	2.46E7	4	4	6	Y	42698	SERAT2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g13260 PE=4 SV=1
1518	4176	Q9CAD1	86.50	15	15	1.06E7	7	7	7	Y	59315	At1g63660 OS=Arabidopsis thaliana OX=3702 GN=At1g63660 PE=2 SV=1
1518	4177	Q84WB8	86.50	15	15	1.06E7	7	7	7	Y	59216	Putative GMP synthase OS=Arabidopsis thaliana OX=3702 GN=At1g63660 PE=2 SV=1
1958	6869	P42793	86.47	27	27	2.77E7	5	5	5	Y	21235	60S ribosomal protein L5, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RPL5 PE=2 SV=1
1958	6870	A0A2P2CLF8	86.47	27	27	2.77E7	5	5	5	Y	21235	Ribosomal protein L5 OS=Arabidopsis thaliana OX=3702 GN=rpl5 PE=4 SV=1
2090	5749	Q9C6Z3	86.45	16	16	3.31E7	4	4	5	Y	44245	Pyruvate dehydrogenase E1 component subunit beta-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PDH-E1 BETA PE=2 SV=1
2090	5734	A0A178WLI5	86.45	21	21	3.31E7	4	4	5	Y	33769	Pyruvate dehydrogenase E1 component subunit beta OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g30520 PE=4 SV=1
2090	5750	A0A178WIN0	86.45	16	16	3.31E7	4	4	5	Y	44259	Pyruvate dehydrogenase E1 component subunit beta OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g30520 PE=4 SV=1
1644	6625	O82251	86.44	37	37	4.95E7	5	5	7	N	22912	Protein TIC 20-II, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIC20-II PE=2 SV=1
1644	6626	A0A178VYR0	86.44	37	37	4.95E7	5	5	7	N	22912	Tic20-II OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g45610 PE=4 SV=1
1795	2309	W8Q387	86.37	17	17	3.3E6	6	4	6	Y	64118	Hexosyltransferase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT3G02350 PE=2 SV=1
1795	2310	Q9FWA4	86.37	17	17	3.3E6	6	4	6	Y	64160	Probable galacturonosyltransferase 9 OS=Arabidopsis thaliana OX=3702 GN=GAUT9 PE=2 SV=1
1795	2311	A0A178VEE3	86.37	17	17	3.3E6	6	4	6	Y	64160	Hexosyltransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g01570 PE=3 SV=1
2295	5626	A0A178VJN4	86.32	16	16	7.49E6	3	3	4	N	35631	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g19570 PE=4 SV=1
2295	5627	Q9LS48	86.32	16	16	7.49E6	3	3	4	N	35631	protein SLOW GREEN 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SG1 PE=1 SV=1
1162	6000	Q9LZ57	86.32	33	33	1.4E8	7	7	9	N	12190	60S ribosomal protein L36-3 OS=Arabidopsis thaliana OX=3702 GN=RPL36C PE=3 SV=1
1162	6001	A0A178UKY0	86.32	33	33	1.4E8	7	7	9	N	12190	60S ribosomal protein L36 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g01580 PE=3 SV=1
2007	3825	Q56WS4	86.29	14	14	1.28E7	3	3	4	N	31359	Uncharacterized protein At1g12230 OS=Arabidopsis thaliana OX=3702 GN=At1g12230 PE=2 SV=1
2007	3604	Q8LGP6	86.29	11	11	1.28E7	3	3	4	N	40725	Transaldolase-like protein (Fragment) OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2007	3605	Q8LGP5	86.29	11	11	1.28E7	3	3	4	N	40709	Transaldolase-like protein (Fragment) OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2007	3606	Q8L456	86.29	11	11	1.28E7	3	3	4	N	40699	Transaldolase-like protein (Fragment) OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2007	3607	Q8L485	86.29	11	11	1.28E7	3	3	4	N	40715	Transaldolase-like protein (Fragment) OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2007	3608	Q8L4B7	86.29	11	11	1.28E7	3	3	4	N	40671	Transaldolase-like protein (Fragment) OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2007	3201	Q9FWX0	86.29	10	10	1.28E7	3	3	4	N	43994	Aldolase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g12230 PE=2 SV=1
2007	3202	F4IC59	86.29	9	9	1.28E7	3	3	4	N	46527	Aldolase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g12230 PE=4 SV=1
1859	7887	Q8W487	86.24	19	19	2.24E7	4	3	4	N	28061	Uncharacterized protein At2g39795, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g39795 PE=1 SV=1
1859	7888	Q8LAD6	86.24	19	19	2.24E7	4	3	4	N	28031	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1859	7889	A0A178VSI4	86.24	19	19	2.24E7	4	3	4	N	28176	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g36760 PE=4 SV=1
2419	7638	Q39129	86.21	54	54	1.67E7	4	4	4	Y	12676	Thiosulfate sulfurtransferase 16, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=STR16 PE=1 SV=2
2419	7639	A0A178URU4	86.21	54	54	1.67E7	4	4	4	Y	12662	STR16 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g65960 PE=4 SV=1
1257	1956	A0A178UBW8	86.19	16	16	8.49E6	7	7	7	N	85209	EMB3144 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g64210 PE=4 SV=1
1257	1962	F4KF14	86.19	15	15	8.49E6	7	7	7	N	96854	Probable inactive ATP-dependent zinc metalloprotease FTSHI 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FTSHI4 PE=1 SV=1
1897	108057	Q0WL65	86.13	13	13	5.79E6	5	5	6	N	86050	Uncharacterized protein At2g40730 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1897	108058	A0A178VLD7	86.13	13	13	5.79E6	5	5	6	N	86046	CTEXP OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g37860 PE=1 SV=1
1897	108059	F4II29	86.13	13	13	5.79E6	5	5	6	N	86046	Kinase family with ARM repeat domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=CTEXP PE=1 SV=1
1648	4389	A0A178V898	86.08	43	43	6.05E7	4	4	8	Y	12971	CCH OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g50880 PE=1 SV=1
1648	4390	O82089	86.08	43	43	6.05E7	4	4	8	Y	12971	Copper transport protein CCH OS=Arabidopsis thaliana OX=3702 GN=CCH PE=1 SV=1
1454	4063	Q9FNM7	86.07	6	6	1.21E7	4	4	6	Y	94186	DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana OX=3702 GN=RH26 PE=1 SV=2
1454	4064	A0A178UFQ6	86.07	6	6	1.21E7	4	4	6	Y	94186	PDE340 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g08530 PE=4 SV=1
2489	4720	A0A178UQY3	86.00	23	23	1.8E7	4	4	4	Y	36113	CHY1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g65840 PE=3 SV=1
2489	4722	Q9LKJ1	86.00	20	20	1.8E7	4	4	4	Y	42074	3-hydroxyisobutyryl-CoA hydrolase 1 OS=Arabidopsis thaliana OX=3702 GN=CHY1 PE=1 SV=1
2047	5746	Q9FX21	86.00	10	10	1.74E7	5	5	5	N	82980	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Arabidopsis thaliana OX=3702 GN=STT3B PE=2 SV=1
2047	5747	W8PVA0	86.00	10	10	1.74E7	5	5	5	N	82980	Glycosyltransferase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT1G34130 PE=2 SV=1
1725	7977	A0A1I9LR92	85.99	20	20	6.82E6	5	5	6	N	25299	Translocator assembly/maintenance protein OS=Arabidopsis thaliana OX=3702 GN=At3g47630 PE=4 SV=1
1725	7978	A0A1I9LR93	85.99	17	17	6.82E6	5	5	6	N	30972	Translocator assembly/maintenance protein OS=Arabidopsis thaliana OX=3702 GN=At3g47630 PE=4 SV=1
1725	7979	F4JBM0	85.99	14	14	6.82E6	5	5	6	N	36039	Translocator assembly/maintenance protein OS=Arabidopsis thaliana OX=3702 GN=At3g47630 PE=4 SV=1
1725	7980	Q9SN75	85.99	14	14	6.82E6	5	5	6	N	37362	At3g47630 OS=Arabidopsis thaliana OX=3702 GN=F1P2.180 PE=2 SV=1
2181	7211	Q9SFB3	85.98	15	15	1.73E7	3	3	5	N	41917	Protein TAB2 homolog, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ATAB2 PE=2 SV=1
2181	7212	A0A178V658	85.98	15	15	1.73E7	3	3	5	N	41917	ATAB2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g08010 PE=4 SV=1
1735	2995	A0A178WM80	85.88	15	15	2.15E7	6	6	6	Y	78204	PES1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g49060 PE=4 SV=1
1735	2996	Q9ZVN2	85.88	15	15	2.15E7	6	6	6	Y	78204	Acyltransferase-like protein At1g54570, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g54570 PE=1 SV=1
1701	4616	A0A178UCB0	85.86	21	21	1.34E7	6	6	7	Y	40575	PLR1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g52540 PE=4 SV=1
1701	4617	Q56Y42	85.86	21	21	1.34E7	6	6	7	Y	40576	Pyridoxal reductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PLR1 PE=1 SV=1
1831	108095	A0A178V370	85.79	14	14	2.34E7	4	4	7	N	43648	MORF1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g23500 PE=4 SV=1
1242	5459	C0Z3C7	85.78	20	20	8.3E7	4	3	8	N	26947	Reticulon-like protein OS=Arabidopsis thaliana OX=3702 GN=At1g64090 PE=2 SV=1
1242	5462	Q9SH59	85.78	19	19	8.3E7	4	3	8	N	28696	Reticulon-like protein B3 OS=Arabidopsis thaliana OX=3702 GN=RTNLB3 PE=2 SV=1
1242	5463	A0A178WA77	85.78	19	19	8.3E7	4	3	8	N	28680	Reticulon-like protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g57550 PE=4 SV=1
2249	7261	P31166	85.73	20	20	1.82E7	3	2	5	Y	26396	Adenine phosphoribosyltransferase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APT1 PE=1 SV=2
2249	7262	A0A178W2J6	85.73	20	20	1.82E7	3	2	5	Y	26396	ATAPT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g27890 PE=3 SV=1
2249	7263	A0A178W2H2	85.73	19	19	1.82E7	3	2	5	Y	28070	ATAPT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g27890 PE=3 SV=1
2249	7264	F4HSX1	85.73	17	17	1.82E7	3	2	5	Y	30988	Adenine phosphoribosyl transferase 1 OS=Arabidopsis thaliana OX=3702 GN=APT1 PE=1 SV=1
1581	3361	Q8RWI0	85.66	18	18	1.72E7	4	4	6	N	42844	Myelin-associated oligodendrocyte basic protein OS=Arabidopsis thaliana OX=3702 GN=At1g54520 PE=1 SV=1
1581	3362	A0A178W7W9	85.66	18	18	1.72E7	4	4	6	N	42844	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g49010 PE=1 SV=1
1748	5833	F4JY76	85.62	10	10	1.19E7	4	4	4	Y	60183	Eukaryotic translation initiation factor 3 subunit L OS=Arabidopsis thaliana OX=3702 GN=At5g25754 PE=1 SV=1
1748	5834	Q56XB4	85.62	10	10	1.19E7	4	4	4	Y	60084	Eukaryotic translation initiation factor 3 subunit L OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1748	5835	Q8H152	85.62	10	10	1.19E7	4	4	4	Y	60152	Eukaryotic translation initiation factor 3 subunit L OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1748	5836	A0A178U9L8	85.62	10	10	1.19E7	4	4	4	Y	60183	Eukaryotic translation initiation factor 3 subunit L OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g25710 PE=1 SV=1
1825	6020	Q9SN38	85.57	15	15	1.61E7	4	4	7	Y	46071	Receptor-like protein 51 OS=Arabidopsis thaliana OX=3702 GN=RLP51 PE=1 SV=1
1825	6021	A0A178V2A6	85.57	15	15	1.61E7	4	4	7	Y	46044	SNC2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g22060 PE=4 SV=1
1605	3790	A0A178UR80	85.57	26	26	1.49E7	7	7	7	Y	50837	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g09480 PE=4 SV=1
1605	3791	F4KFD7	85.57	26	26	1.49E7	7	7	7	Y	50850	26S proteasome regulatory subunit, putative (RPN5) OS=Arabidopsis thaliana OX=3702 GN=EMB2107 PE=4 SV=1
1605	3792	Q9FIB6	85.57	26	26	1.49E7	7	7	7	Y	50837	26S proteasome non-ATPase regulatory subunit 12 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPN5A PE=1 SV=1
1570	3229	O81108	85.53	10	10	4.34E6	7	4	7	Y	110439	Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=ACA2 PE=1 SV=1
1570	3230	Q53XI0	85.53	10	10	4.34E6	7	4	7	Y	110439	Calcium-transporting ATPase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1570	3231	A0A384LFJ2	85.53	10	10	4.34E6	7	4	7	Y	110439	Calcium-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g42890 PE=3 SV=1
2143	5567	P82874	85.51	36	36	1.86E7	4	4	4	N	22565	Mitochondrial import receptor subunit TOM20-3 OS=Arabidopsis thaliana OX=3702 GN=TOM20-3 PE=1 SV=1
2143	5568	A0A178V7T0	85.51	36	36	1.86E7	4	4	4	N	22622	TOM20-3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g29520 PE=4 SV=1
1890	59336	I1VCA8	85.48	12	12	1.18E7	5	2	5	N	50826	Major facilitator protein (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At4g27720.1 PE=2 SV=1
1890	59337	Q9C5R0	85.48	12	12	1.18E7	5	2	5	N	50886	AT4g27720/T29A15_210 OS=Arabidopsis thaliana OX=3702 GN=At4g27720 PE=2 SV=1
1890	59338	A0A178UZD4	85.48	12	12	1.18E7	5	2	5	N	50856	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g31940 PE=4 SV=1
1551	7556	Q0WS09	85.48	46	46	2.16E8	4	3	8	Y	9405	40S ribosomal protein S27 OS=Arabidopsis thaliana OX=3702 GN=At2g45710 PE=2 SV=1
1551	7557	O64650	85.48	46	46	2.16E8	4	3	8	Y	9405	40S ribosomal protein S27-1 OS=Arabidopsis thaliana OX=3702 GN=RPS27A PE=3 SV=1
1551	7558	A0A384LK94	85.48	46	46	2.16E8	4	3	8	Y	9405	40S ribosomal protein S27 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g43320 PE=3 SV=1
1551	7559	A0A178VC05	85.48	45	45	2.16E8	4	3	8	Y	9600	40S ribosomal protein S27 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g55360 PE=3 SV=1
1551	7560	Q9M2F1	85.48	45	45	2.16E8	4	3	8	Y	9600	40S ribosomal protein S27-2 OS=Arabidopsis thaliana OX=3702 GN=RPS27B PE=2 SV=2
2226	5304	P52032	85.46	34	34	2.51E7	5	5	5	Y	26016	Phospholipid hydroperoxide glutathione peroxidase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GPX1 PE=2 SV=2
2226	5305	A0A178VXY6	85.46	34	34	2.51E7	5	5	5	Y	26064	Glutathione peroxidase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g20790 PE=3 SV=1
1672	3191	Q94BZ0	85.43	23	23	1.75E7	7	7	7	Y	46560	At1g50450/F11F12_20 OS=Arabidopsis thaliana OX=3702 GN=At1g50450 PE=2 SV=1
1672	3192	A0A178W6N9	85.43	23	23	1.75E7	7	7	7	Y	46560	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g44650 PE=4 SV=1
1672	3376	Q9LPS0	85.43	26	26	1.75E7	7	7	7	Y	40322	F11F12.19 protein OS=Arabidopsis thaliana OX=3702 GN=F11F12.19 PE=4 SV=1
1338	2104	O49583	85.42	23	23	4.78E7	7	7	7	N	45246	Uncharacterized protein AT4g31340 OS=Arabidopsis thaliana OX=3702 GN=At4g31340 PE=4 SV=1
1338	2107	F4JRY9	85.42	22	22	4.78E7	7	7	7	N	47740	Myosin heavy chain-like protein OS=Arabidopsis thaliana OX=3702 GN=At4g31340 PE=4 SV=1
1338	2109	Q8GUN1	85.42	21	21	4.78E7	7	7	7	N	49649	AT4G31340 protein OS=Arabidopsis thaliana OX=3702 GN=At4g31340 PE=2 SV=1
1321	1794	Q8RXD9	85.41	14	14	2.24E7	9	9	10	Y	109777	4-alpha-glucanotransferase DPE2 OS=Arabidopsis thaliana OX=3702 GN=DPE2 PE=1 SV=1
1321	1795	A0A178VUH8	85.41	14	14	2.24E7	9	9	10	Y	109748	DPE2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g38000 PE=4 SV=1
1679	4466	Q8RWB7	85.40	19	19	1.85E7	5	4	6	Y	41956	At1g29790 OS=Arabidopsis thaliana OX=3702 GN=CELLULOSE SYNTHASE LIKE C5 PE=2 SV=1
1679	4467	A0A178WBT8	85.40	19	19	1.85E7	5	4	6	Y	41956	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g30160 PE=4 SV=1
1612	4472	A0A178ULV1	85.33	37	37	2.36E7	6	6	7	N	27337	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g66900 PE=4 SV=1
1612	4473	Q9FKZ4	85.33	37	37	2.36E7	6	6	7	N	27337	Ribosomal protein L25/Gln-tRNA synthetase, anti-codon-binding domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=MUD21.12 PE=2 SV=1
1207	7371	A0A178W0L3	85.32	20	20	1.76E8	4	4	11	Y	18850	RPL24A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g33320 PE=4 SV=1
1207	7372	Q42347	85.32	20	20	1.76E8	4	4	11	Y	18850	60S ribosomal protein L24-1 OS=Arabidopsis thaliana OX=3702 GN=RPL24A PE=1 SV=2
2163	7265	Q38856	85.30	18	18	3.98E7	4	4	5	Y	36727	Fe(2+) transport protein 1 OS=Arabidopsis thaliana OX=3702 GN=IRT1 PE=1 SV=2
2163	7266	A0A178UTD9	85.30	18	18	3.98E7	4	4	5	Y	36727	IRT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g23150 PE=3 SV=1
1743	2950	Q9LTB0	85.28	13	13	7.44E6	5	5	5	Y	82748	Exocyst complex component EXO84B OS=Arabidopsis thaliana OX=3702 GN=EXO84B PE=1 SV=1
1743	2951	F4K7F4	85.28	12	12	7.44E6	5	5	5	Y	86322	Exocyst complex component 84B OS=Arabidopsis thaliana OX=3702 GN=EXO84B PE=4 SV=1
1743	2952	F4K7F5	85.28	12	12	7.44E6	5	5	5	Y	89760	Exocyst complex component 84B OS=Arabidopsis thaliana OX=3702 GN=EXO84B PE=4 SV=1
1787	4345	Q8LPT3	85.18	14	14	8.17E6	6	6	6	N	82551	Membrane protein of ER body-like protein OS=Arabidopsis thaliana OX=3702 GN=MEBL PE=2 SV=1
1787	4350	A0A1P8B475	85.18	14	14	8.17E6	6	6	6	N	84959	Vacuolar iron transporter (VIT) family protein OS=Arabidopsis thaliana OX=3702 GN=At4g27870 PE=4 SV=1
2562	8877	Q39061	85.16	13	13	2.2E7	3	3	4	N	35744	RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP33 PE=2 SV=1
2562	8878	A0A178VGE7	85.16	13	13	2.2E7	3	3	4	N	35744	PDE322 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g46800 PE=4 SV=1
2131	5017	A0A178WL48	85.16	26	26	1.86E7	5	5	5	Y	34130	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g16860 PE=1 SV=1
2131	5018	Q9S9M7	85.16	26	26	1.86E7	5	5	5	Y	34130	Nuclear protein OS=Arabidopsis thaliana OX=3702 GN=At1g16080 PE=1 SV=1
1893	3302	Q9ZVB0	85.07	27	27	9.79E6	5	5	6	N	41053	F9K20.3 OS=Arabidopsis thaliana OX=3702 GN=F9K20.3 PE=4 SV=1
1893	3303	Q8GWV1	85.07	26	26	9.79E6	5	5	6	N	42579	At1g78915 OS=Arabidopsis thaliana OX=3702 GN=At1g78915 PE=2 SV=1
1893	3304	F4IBX4	85.07	25	25	9.79E6	5	5	6	N	44708	Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g78915 PE=4 SV=1
1893	3305	F4IBX5	85.07	25	25	9.79E6	5	5	6	N	45038	Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g78915 PE=4 SV=1
1495	3973	A1L4Y1	85.06	35	35	9.12E6	8	6	9	Y	44754	At3g10350 OS=Arabidopsis thaliana OX=3702 GN=At3g10350 PE=1 SV=1
2003	6156	A0A2P2CLF5	84.97	36	36	2.89E7	4	4	5	Y	17227	Ribosomal protein S7 OS=Arabidopsis thaliana OX=3702 GN=rps7 PE=4 SV=1
1442	8114	A0A178VAQ8	84.96	17	17	1.34E7	6	6	6	Y	56619	Tyrosine--tRNA ligase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g01920 PE=3 SV=1
1442	8115	Q9M876	84.96	17	17	1.34E7	6	6	6	Y	56619	Tyrosine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB2768 PE=2 SV=1
2111	9303	A0A178WKB7	84.96	44	44	5.46E7	3	2	5	Y	10357	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g23660 PE=4 SV=1
2111	9304	Q8LAJ9	84.96	44	44	5.46E7	3	2	5	Y	10357	At1g22520 OS=Arabidopsis thaliana OX=3702 GN=At1g22520 PE=2 SV=1
2111	11276	F4I1E5	84.96	25	25	5.46E7	3	2	5	Y	19992	MICOS complex subunit Mic10-like protein (DUF543) OS=Arabidopsis thaliana OX=3702 GN=At1g22520 PE=4 SV=1
2016	7549	A0A178UBT5	84.95	19	19	9.4E6	4	4	5	N	29985	GR-RBP3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g60500 PE=4 SV=1
2016	7550	Q9FNR1	84.95	19	19	9.4E6	4	4	5	N	29985	Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RBG3 PE=1 SV=1
1954	4430	P28185	84.93	31	31	1.33E7	5	2	6	N	23927	Ras-related protein RABA1a OS=Arabidopsis thaliana OX=3702 GN=RABA1A PE=1 SV=1
1954	4431	A0A178W910	84.93	31	31	1.33E7	5	2	6	N	23927	ATRABA1A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g06020 PE=4 SV=1
1703	8658	Q6NLR2	84.87	16	16	3.74E6	6	2	7	N	50658	At1g64650 OS=Arabidopsis thaliana OX=3702 GN=At1g64650 PE=2 SV=1
1703	8659	A0A178W607	84.87	16	16	3.74E6	6	2	7	N	50658	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g58250 PE=4 SV=1
1703	8660	Q0WQ33	84.87	16	16	3.74E6	6	2	7	N	50686	Uncharacterized protein At1g64650 OS=Arabidopsis thaliana OX=3702 GN=At1g64650 PE=2 SV=1
1340	4912	Q8LBJ7	84.86	23	23	2.9E8	4	4	6	N	19682	50S ribosomal protein L12-C OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1340	4365	A0A178V6Q1	84.86	23	23	2.9E8	4	4	6	N	19699	RPL12-C OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g30350 PE=3 SV=1
1340	4366	P36212	84.86	23	23	2.9E8	4	4	6	N	19682	50S ribosomal protein L12-3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPL12C PE=2 SV=2
1340	4367	P36210	84.86	23	23	2.9E8	4	4	6	N	20075	50S ribosomal protein L12-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPL12A PE=2 SV=1
1340	4368	A0A178VJ19	84.86	23	23	2.9E8	4	4	6	N	20075	RPL12-A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g30330 PE=3 SV=1
1820	59373	Q8VYF7	84.77	21	21	1.84E7	3	3	5	N	26295	Single-stranded DNA-binding protein WHY2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=WHY2 PE=1 SV=1
2284	5785	Q5XEV6	84.77	14	14	1.33E7	3	3	4	Y	33640	At4g24090 OS=Arabidopsis thaliana OX=3702 GN=At4g24090 PE=2 SV=1
2284	5786	A0A178UWF6	84.77	14	14	1.33E7	3	3	4	Y	33689	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g27900 PE=4 SV=1
1999	7252	O04200	84.74	27	27	1.79E7	5	5	6	Y	36213	Peroxisomal nicotinamide adenine dinucleotide carrier OS=Arabidopsis thaliana OX=3702 GN=PXN PE=1 SV=1
1999	7253	A0A178VUN6	84.74	27	27	1.79E7	5	5	6	Y	36213	PXN OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g36970 PE=3 SV=1
1660	2134	A0A178V911	84.61	5	5	4.52E6	5	5	5	Y	192839	BEN1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g36560 PE=4 SV=1
1660	2133	F4IXW2	84.61	5	5	4.52E6	5	5	5	Y	192881	Brefeldin A-inhibited guanine nucleotide-exchange protein 5 OS=Arabidopsis thaliana OX=3702 GN=BIG5 PE=1 SV=2
1843	59422	Q9FNL5	84.57	8	8	1.3E7	5	5	6	Y	120325	Similarity to guanylate binding protein OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
1843	59423	F4KG14	84.57	8	8	1.3E7	5	5	6	Y	122777	Guanylate-binding family protein OS=Arabidopsis thaliana OX=3702 GN=MCL19.12 PE=4 SV=1
1843	59424	A0A178U9S9	84.57	8	8	1.3E7	5	5	6	Y	122777	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g44510 PE=4 SV=1
2060	7470	A0A1P8BG65	84.53	40	40	1.61E7	4	4	4	N	25460	Ubiquinol-cytochrome C chaperone family protein OS=Arabidopsis thaliana OX=3702 GN=MWD22.17 PE=4 SV=1
2060	6581	A0A178U764	84.53	32	32	1.61E7	4	4	4	N	32114	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g50010 PE=4 SV=1
2060	6582	Q500Z1	84.53	32	32	1.61E7	4	4	4	N	32114	At5g51220 OS=Arabidopsis thaliana OX=3702 GN=MWD22.17 PE=2 SV=1
2060	6583	Q0WPX2	84.53	32	32	1.61E7	4	4	4	N	32142	Uncharacterized protein At5g51220 OS=Arabidopsis thaliana OX=3702 GN=At5g51220 PE=2 SV=1
2134	6292	O48661	84.51	26	26	1.03E7	5	3	5	Y	37140	Spermidine synthase 2 OS=Arabidopsis thaliana OX=3702 GN=SPDSYN2 PE=1 SV=2
2134	6293	Q5PNT7	84.51	26	26	1.03E7	5	3	5	Y	37140	At1g70310 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2134	6294	A0A384L9M6	84.51	26	26	1.03E7	5	3	5	Y	37140	SPDS2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g64440 PE=3 SV=1
1768	5661	A0A097PSQ3	84.50	32	32	1.69E7	3	3	3	Y	19021	AT4G29520-like protein (Fragment) OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1768	4499	Q8LER2	84.50	17	17	1.69E7	3	3	3	Y	34034	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1768	4500	Q9SU93	84.50	17	17	1.69E7	3	3	3	Y	34364	Nucleophosmin OS=Arabidopsis thaliana OX=3702 GN=At4g29520 PE=4 SV=1
1995	6087	A0A178W3F2	84.38	22	22	9.23E6	5	5	5	Y	54208	ALDH7B4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g48530 PE=3 SV=1
1995	6088	Q9SYG7	84.38	22	22	9.23E6	5	5	5	Y	54208	Aldehyde dehydrogenase family 7 member B4 OS=Arabidopsis thaliana OX=3702 GN=ALDH7B4 PE=2 SV=3
1970	8485	A0A178VV43	84.24	29	29	9.87E6	4	4	5	N	23510	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g38870 PE=4 SV=1
1970	8486	A8MSD8	84.24	29	29	9.87E6	4	4	5	N	23510	Mitochondrial glycoprotein family protein OS=Arabidopsis thaliana OX=3702 GN=At2g41600 PE=4 SV=1
1970	8487	B3H6S7	84.24	27	27	9.87E6	4	4	5	N	24991	Mitochondrial glycoprotein family protein OS=Arabidopsis thaliana OX=3702 GN=At2g41600 PE=4 SV=1
1970	8488	A0A1P8AZU6	84.24	26	26	9.87E6	4	4	5	N	26384	Mitochondrial glycoprotein family protein OS=Arabidopsis thaliana OX=3702 GN=At2g41600 PE=4 SV=1
2147	3074	A0A178W1Y9	84.23	27	27	5.15E6	4	3	5	Y	26790	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g40550 PE=4 SV=1
2147	3075	Q9ZW85	84.23	27	27	5.15E6	4	3	5	Y	26790	3-isopropylmalate dehydratase small subunit 3 OS=Arabidopsis thaliana OX=3702 GN=At2g43090 PE=1 SV=1
1584	2931	A0A1P8ARS7	84.23	16	16	1.48E7	6	6	6	Y	53758	TCP-1/cpn60 chaperonin family protein OS=Arabidopsis thaliana OX=3702 GN=At1g24510 PE=3 SV=1
1584	2932	O04450	84.23	15	15	1.48E7	6	6	6	Y	59385	T-complex protein 1 subunit epsilon OS=Arabidopsis thaliana OX=3702 GN=CCT5 PE=1 SV=1
1584	2933	A0A178WF65	84.23	15	15	1.48E7	6	6	6	Y	59385	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g25770 PE=3 SV=1
1358	5104	Q9LUQ6	84.21	30	30	3.5E7	5	2	9	N	24330	60S ribosomal protein L19-2 OS=Arabidopsis thaliana OX=3702 GN=RPL19B PE=2 SV=1
1706	3764	A0A178UME7	84.20	35	35	2.48E7	6	6	7	Y	23036	Emb2731 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g55110 PE=4 SV=1
1706	3761	Q8LBG0	84.20	35	35	2.48E7	6	6	7	Y	22791	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1706	3762	Q9FG71	84.20	35	35	2.48E7	6	6	7	Y	22979	ER membrane protein complex subunit 8/9 homolog OS=Arabidopsis thaliana OX=3702 GN=EMB2731 PE=2 SV=1
1706	3763	Q0WW87	84.20	35	35	2.48E7	6	6	7	Y	22979	Uncharacterized protein At5g55940 OS=Arabidopsis thaliana OX=3702 GN=At5g55940 PE=2 SV=1
2002	3660	A8MR27	84.09	22	22	2.82E7	4	4	5	Y	48020	Polypyrimidine tract-binding protein 3 OS=Arabidopsis thaliana OX=3702 GN=PTB3 PE=4 SV=1
2002	3661	Q6ICX4	84.09	22	22	2.82E7	4	4	5	Y	48234	Polypyrimidine tract-binding protein homolog 3 OS=Arabidopsis thaliana OX=3702 GN=At1g43190 PE=2 SV=1
2002	3662	Q0WQH0	84.09	22	22	2.82E7	4	4	5	Y	48234	Uncharacterized protein At1g43190 OS=Arabidopsis thaliana OX=3702 GN=At1g43190 PE=2 SV=1
2424	5411	Q9LMS8	83.97	19	19	1.77E7	4	4	4	Y	25067	T10F20.7 protein OS=Arabidopsis thaliana OX=3702 GN=T10F20.7 PE=4 SV=1
2424	5412	A0A178WBS9	83.97	19	19	1.77E7	4	4	4	Y	25067	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g18950 PE=4 SV=1
2424	5413	Q9LM40	83.97	19	19	1.77E7	4	4	4	Y	25198	AT1g18060/T10F20.23 OS=Arabidopsis thaliana OX=3702 GN=At1g18060 PE=2 SV=1
2415	108091	A0A178VLW9	83.95	16	16	1.05E7	3	3	3	Y	44763	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g54900 PE=3 SV=1
2415	108092	Q5XF59	83.95	16	16	1.05E7	3	3	3	Y	44763	3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g60510 PE=1 SV=1
2415	108093	F4JBV0	83.95	15	15	1.05E7	3	3	3	Y	47431	ATP-dependent caseinolytic (Clp) protease/crotonase family protein OS=Arabidopsis thaliana OX=3702 GN=At3g60510 PE=3 SV=1
1939	3836	A0A178UEP3	83.93	14	14	1.23E7	5	5	5	Y	64033	BON2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g06970 PE=4 SV=1
1939	3837	Q5S1W2	83.93	14	14	1.23E7	5	5	5	Y	64033	Protein BONZAI 2 OS=Arabidopsis thaliana OX=3702 GN=BON2 PE=1 SV=2
2220	8043	Q683B7	83.85	13	13	5.73E6	4	4	4	Y	52126	Prolyl carboxypeptidase like protein (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At4g36195 PE=2 SV=1
2220	8044	Q683F9	83.85	13	13	5.73E6	4	4	4	Y	53712	Prolyl carboxypeptidase like protein OS=Arabidopsis thaliana OX=3702 GN=At4g36195 PE=2 SV=1
2220	8045	Q94CC6	83.85	12	12	5.73E6	4	4	4	Y	54774	Prolyl carboxypeptidase like protein OS=Arabidopsis thaliana OX=3702 GN=At4g36195 PE=2 SV=1
2220	8046	Q67X97	83.85	12	12	5.73E6	4	4	4	Y	54788	Prolyl carboxypeptidase like protein OS=Arabidopsis thaliana OX=3702 GN=At4g36195 PE=2 SV=1
2220	8048	A0A178V4U9	83.85	12	12	5.73E6	4	4	4	Y	54774	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g41350 PE=4 SV=1
2050	6668	A0A097PND6	83.85	13	13	1.24E7	4	4	5	Y	50695	Iron-sulfur cluster biosynthesis family protein (Fragment) OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2050	5452	Q8GW20	83.85	11	11	1.24E7	4	4	5	Y	59501	Uncharacterized protein At5g03900, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g03900 PE=2 SV=2
1590	7581	Q9S9P1	83.83	35	35	5.68E7	4	2	8	Y	15377	40S ribosomal protein S12-1 OS=Arabidopsis thaliana OX=3702 GN=RPS12A PE=2 SV=1
1590	7582	A0A178W9Y0	83.83	35	35	5.68E7	4	2	8	Y	15377	40S ribosomal protein S12 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g16690 PE=3 SV=1
2459	9714	A0A178W0J8	83.82	41	41	9.73E6	3	3	3	N	11108	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g22070 PE=4 SV=1
2459	9715	O64847	83.82	41	41	9.73E6	3	3	3	N	11108	Protein FATTY ACID EXPORT 7 OS=Arabidopsis thaliana OX=3702 GN=FAX7 PE=3 SV=1
1934	3108	A0A384KH77	83.80	12	12	9.07E6	5	3	5	Y	69466	Auxin efflux carrier component OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g65120 PE=3 SV=1
1934	3109	Q9S7Z8	83.80	12	12	9.07E6	5	3	5	Y	69466	Auxin efflux carrier component 3 OS=Arabidopsis thaliana OX=3702 GN=PIN3 PE=1 SV=1
1934	3110	Q0WV81	83.80	12	12	9.07E6	5	3	5	Y	69466	Auxin efflux carrier component OS=Arabidopsis thaliana OX=3702 GN=At1g70940 PE=2 SV=1
2132	5603	A0A178VLM7	83.75	21	21	1.88E7	5	5	5	N	41005	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g51620 PE=4 SV=1
2132	5604	Q4V3D9	83.75	21	21	1.88E7	5	5	5	N	41001	Protein STRICTOSIDINE SYNTHASE-LIKE 10 OS=Arabidopsis thaliana OX=3702 GN=SSL10 PE=2 SV=1
1315	3223	A0A178VT51	83.65	9	9	1.38E7	4	4	6	Y	69744	VSR3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g09900 PE=4 SV=1
1315	3224	O80977	83.65	9	9	1.38E7	4	4	6	Y	69744	Vacuolar-sorting receptor 3 OS=Arabidopsis thaliana OX=3702 GN=VSR3 PE=2 SV=1
1994	2745	A0A178WN13	83.64	16	16	1.66E7	4	4	5	N	38373	Eukaryotic translation initiation factor 3 subunit H OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g11040 PE=3 SV=1
1994	2746	Q9C5Z2	83.64	16	16	1.66E7	4	4	5	N	38373	Eukaryotic translation initiation factor 3 subunit H OS=Arabidopsis thaliana OX=3702 GN=TIF3H1 PE=1 SV=2
1721	9171	Q39232	83.46	12	12	2.07E7	4	4	6	N	54858	Sucrose transport protein SUC1 OS=Arabidopsis thaliana OX=3702 GN=SUC1 PE=1 SV=1
1721	9172	A0A178W2N3	83.46	12	12	2.07E7	4	4	6	N	54858	SUC1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g66020 PE=4 SV=1
2495	6165	C0Z2S7	83.38	15	15	3.39E6	4	4	4	Y	62283	Endoglucanase OS=Arabidopsis thaliana OX=3702 GN=At5g49720 PE=2 SV=1
2495	5069	A0A178UPV5	83.38	13	13	3.39E6	4	4	4	Y	69191	Endoglucanase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g48570 PE=3 SV=1
2495	5070	Q38890	83.38	13	13	3.39E6	4	4	4	Y	69191	Endoglucanase 25 OS=Arabidopsis thaliana OX=3702 GN=KOR PE=1 SV=1
1763	4140	Q94JS4	83.38	19	19	4.64E6	5	3	7	Y	40124	24-methylenesterol C-methyltransferase 3 OS=Arabidopsis thaliana OX=3702 GN=SMT3 PE=2 SV=1
1763	4141	A0A178WGT2	83.38	19	19	4.64E6	5	3	7	Y	40124	Methyltransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g70540 PE=3 SV=1
1857	59263	Q8L9A0	83.37	31	31	3.1E7	5	5	5	Y	30908	50S ribosomal protein L21, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RPL21M PE=2 SV=1
1857	59264	A0A178UZG0	83.37	31	31	3.1E7	5	5	5	Y	30908	NFD1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g35450 PE=3 SV=1
1935	4372	A0A178WD32	83.31	36	36	3.07E7	5	5	5	N	23421	DHAR2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g69710 PE=3 SV=1
1935	4373	Q9FRL8	83.31	36	36	3.07E7	5	5	5	N	23407	Glutathione S-transferase DHAR2 OS=Arabidopsis thaliana OX=3702 GN=DHAR2 PE=1 SV=1
1694	3681	Q9FIH8	83.31	9	9	1.38E7	7	7	7	Y	140607	Stromal processing peptidase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SPP PE=2 SV=1
1694	3692	A0A178UNL7	83.31	9	9	1.38E7	7	7	7	Y	140622	SPP OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g40240 PE=4 SV=1
1942	4031	A0A178V0R5	83.26	26	26	4.53E6	5	5	5	Y	27727	NdhS OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g27660 PE=4 SV=1
1942	4032	Q9T0A4	83.26	26	26	4.53E6	5	5	5	Y	27727	NAD(P)H-quinone oxidoreductase subunit S, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhS PE=1 SV=1
2420	7765	Q0WQY6	83.25	20	20	1.19E7	2	2	2	Y	28792	Hydroxyacylglutathione hydrolase cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At3g10850 PE=2 SV=1
2420	7766	A0A178VDR0	83.25	20	20	1.19E7	2	2	2	Y	28779	GLY2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g10720 PE=3 SV=1
2420	7767	O24496	83.25	20	20	1.19E7	2	2	2	Y	28792	Hydroxyacylglutathione hydrolase cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=GLX2-2 PE=1 SV=2
1816	5194	A0A178V6R9	83.21	38	38	1.45E7	5	5	5	Y	24644	Proteasome subunit beta OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g55190 PE=3 SV=1
1816	5771	F4JD01	83.21	38	38	1.45E7	5	5	5	Y	24685	Proteasome subunit beta OS=Arabidopsis thaliana OX=3702 GN=PBF1 PE=3 SV=1
1816	5195	P42742	83.21	38	38	1.45E7	5	5	5	Y	24644	Proteasome subunit beta type-1 OS=Arabidopsis thaliana OX=3702 GN=PBF1 PE=1 SV=2
2418	4261	Q9SL96	83.17	16	16	1.7E7	3	3	4	N	35128	Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g25670 PE=2 SV=1
2418	4262	Q8VZ43	83.17	16	16	1.7E7	3	3	4	N	35155	Uncharacterized protein At2g25670 OS=Arabidopsis thaliana OX=3702 GN=At2g25670 PE=2 SV=1
2418	4263	A0A178VLK8	83.17	16	16	1.7E7	3	3	4	N	35128	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g21500 PE=4 SV=1
2418	4264	Q8LFB4	83.17	16	16	1.7E7	3	3	4	N	35176	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2418	4265	B9DH39	83.17	16	16	1.7E7	3	3	4	N	35129	AT2G25670 protein OS=Arabidopsis thaliana OX=3702 GN=At2g25670 PE=2 SV=1
1183	108046	A0A178VQU7	83.10	13	13	3.66E6	6	6	6	Y	105846	Vacuolar protein sorting-associated protein 11 homolog OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g04300 PE=3 SV=1
1183	108047	Q9SJ40	83.10	13	13	3.66E6	6	6	6	Y	105713	Vacuolar protein-sorting-associated protein 11 homolog OS=Arabidopsis thaliana OX=3702 GN=VPS11 PE=1 SV=1
1617	3950	Q8GYN9	83.10	19	19	3.03E7	5	5	5	Y	37056	1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=MENB PE=1 SV=2
1617	3951	A0A178WJJ6	83.10	19	19	3.03E7	5	5	5	Y	37014	ECHID OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g53620 PE=3 SV=1
2055	59287	Q9SHH7	82.92	28	28	1.32E7	4	4	4	Y	25591	Glutathione S-transferase U25 OS=Arabidopsis thaliana OX=3702 GN=GSTU25 PE=1 SV=1
2055	59286	A0A178W2G2	82.92	28	28	1.32E7	4	4	4	Y	25591	GSTU25 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g17990 PE=4 SV=1
2237	6648	Q7GB61	82.89	10	10	5.11E6	3	3	4	Y	54512	At1g04280 OS=Arabidopsis thaliana OX=3702 GN=At1g04280 PE=2 SV=1
2237	6649	Q7DM36	82.89	9	9	5.11E6	3	3	4	Y	59064	H1flk (Fragment) OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2237	6650	Q0WUY1	82.89	9	9	5.11E6	3	3	4	Y	59977	p-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g04280 PE=2 SV=1
2237	8339	A0A178WPI2	82.89	9	9	5.11E6	3	3	4	Y	60166	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g03570 PE=4 SV=1
2068	6531	A0A178WMU1	82.84	42	42	8.82E6	4	3	5	Y	15098	Superoxide dismutase [Cu-Zn] OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g08650 PE=3 SV=1
2068	6532	P24704	82.84	42	42	8.82E6	4	3	5	Y	15098	Superoxide dismutase [Cu-Zn] 1 OS=Arabidopsis thaliana OX=3702 GN=CSD1 PE=1 SV=2
1758	8256	O81770	82.83	11	11	9.96E6	6	6	6	Y	58538	Monogalactosyldiacylglycerol synthase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MGD1 PE=1 SV=1
1758	8259	A0A1P8B6W3	82.83	11	11	9.96E6	6	6	6	Y	61643	Monogalactosyl diacylglycerol synthase 1 OS=Arabidopsis thaliana OX=3702 GN=MGD1 PE=4 SV=1
2133	5899	Q94C69	82.72	24	24	1.32E7	4	4	4	Y	29564	Cold shock domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=CSP3 PE=1 SV=1
2103	5814	F4IJM1	82.69	12	12	4.23E7	4	4	4	N	47072	63 kDa inner membrane family protein OS=Arabidopsis thaliana OX=3702 GN=ALB3 PE=1 SV=1
2103	5815	Q8LBP4	82.69	11	11	4.23E7	4	4	4	N	50246	Inner membrane protein ALBINO3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ALB3 PE=1 SV=2
2103	5816	A0A178VUV3	82.69	11	11	4.23E7	4	4	4	N	50246	ALB3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g24900 PE=3 SV=1
1885	5227	A0A178VVX2	82.63	11	11	1.39E6	6	2	6	N	71967	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g21200 PE=4 SV=1
1885	5228	Q8LF20	82.63	11	11	1.39E6	6	2	6	N	72084	Putative clathrin assembly protein At2g25430 OS=Arabidopsis thaliana OX=3702 GN=At2g25430 PE=1 SV=2
2052	8692	A0A178VBJ7	82.62	26	26	1.38E7	4	4	4	Y	19325	TRXF1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g02000 PE=4 SV=1
2052	8693	Q9XFH8	82.62	26	26	1.38E7	4	4	4	Y	19325	Thioredoxin F1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g02730 PE=1 SV=2
1955	4595	A0A1P8APN5	82.62	22	22	3.01E7	4	4	4	Y	30374	Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein OS=Arabidopsis thaliana OX=3702 GN=At1g74070 PE=4 SV=1
1955	4596	F4HTT6	82.62	20	20	3.01E7	4	4	4	Y	34375	Peptidyl-prolyl cis-trans isomerase CYP26-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CYP26-2 PE=2 SV=1
2153	2628	Q9LK43	82.61	7	7	6.93E6	4	4	4	Y	99964	Receptor-like kinase TMK4 OS=Arabidopsis thaliana OX=3702 GN=TMK4 PE=1 SV=1
1707	59867	Q94C90	82.58	17	17	8.82E6	6	6	6	Y	50605	Protein arginine methyltransferase NDUFAF7 OS=Arabidopsis thaliana OX=3702 GN=At1g04900 PE=2 SV=1
1707	59868	A0A178WEZ0	82.58	17	17	8.82E6	6	6	6	Y	50605	Protein arginine methyltransferase NDUFAF7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g04230 PE=3 SV=1
2144	5445	A0A178V7L2	82.57	15	15	8.46E6	4	4	5	N	53767	FLN1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g48510 PE=4 SV=1
2144	5446	Q9M394	82.57	15	15	8.46E6	4	4	5	N	53781	Fructokinase-like 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FLN1 PE=1 SV=1
1412	5324	A0A178WBF7	82.39	12	12	3.15E7	7	7	7	Y	82596	NFD5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g20490 PE=4 SV=1
2232	11996	A0A178UJB5	82.30	16	16	1.48E7	4	3	5	Y	42914	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g60190 PE=4 SV=1
2232	11997	Q5XF80	82.30	16	16	1.48E7	4	3	5	Y	42940	Anion-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=MUP24.8 PE=2 SV=1
2232	11998	Q9FF47	82.30	15	15	1.48E7	4	3	5	Y	45927	Arsenite translocating ATPase-like protein OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2250	6027	A0A178UEN0	82.30	47	47	1.96E7	3	3	4	Y	14404	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g64010 PE=4 SV=1
2250	6028	Q9FME9	82.30	47	47	1.96E7	3	3	4	Y	14404	CHCH domain protein OS=Arabidopsis thaliana OX=3702 GN=MSJ1.24 PE=2 SV=1
2012	5153	A0A178VSY7	82.27	38	38	4.59E7	4	4	6	N	16122	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g29660 PE=4 SV=1
2012	5154	O49313	82.27	38	38	4.59E7	4	4	6	N	16122	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-B OS=Arabidopsis thaliana OX=3702 GN=At2g33220 PE=2 SV=1
1960	6835	Q8LCL2	82.22	18	18	6.84E6	6	6	6	Y	45904	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1960	6836	A0A178V9B9	82.22	18	18	6.84E6	6	6	6	Y	45933	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g29670 PE=4 SV=1
1960	5733	Q9LK30	82.22	18	18	6.84E6	6	6	6	Y	45861	At3g27230 OS=Arabidopsis thaliana OX=3702 GN=At3g27230 PE=2 SV=1
1627	4382	A0A178WN74	82.17	24	24	7.35E7	3	3	8	N	25246	ACR11 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g17670 PE=4 SV=1
1627	4462	A0A178WLF3	82.17	19	19	7.35E7	3	3	8	N	31295	ACR11 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g17670 PE=4 SV=1
1627	4463	Q9FZ47	82.17	19	19	7.35E7	3	3	8	N	31295	ACT domain-containing protein ACR11 OS=Arabidopsis thaliana OX=3702 GN=ACR11 PE=1 SV=1
1823	3908	Q8LEI7	82.16	16	16	1.89E7	4	4	6	N	49399	Ras-GTPase-activating protein SH3-domain binding protein-like OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1823	3909	F4K1Y4	82.16	16	16	1.89E7	4	4	6	N	49415	Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=MSL3.12 PE=1 SV=1
1823	3910	Q9FME2	82.16	16	16	1.89E7	4	4	6	N	49543	AT5g60980/MSL3_100 OS=Arabidopsis thaliana OX=3702 GN=MSL3.12 PE=1 SV=1
1823	3911	A0A178U9D2	82.16	13	13	1.89E7	4	4	6	N	57409	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g60450 PE=4 SV=1
1823	3912	A0A178U8D7	82.16	13	13	1.89E7	4	4	6	N	57537	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g60450 PE=4 SV=1
2172	7005	A4GNA8	82.13	13	13	6.08E7	4	4	5	N	70352	Phosphatidylserine decarboxylase proenzyme 3 OS=Arabidopsis thaliana OX=3702 GN=PSD3 PE=1 SV=1
2172	7006	A0A178UYW2	82.13	13	13	6.08E7	4	4	5	N	70337	Phosphatidylserine decarboxylase proenzyme 2 OS=Arabidopsis thaliana OX=3702 GN=PSD2 PE=3 SV=1
1546	4247	O65655	82.11	12	12	9.6E6	6	6	6	N	69442	SAP domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At4g39680 PE=1 SV=1
1546	4248	A0A178V0X9	82.11	12	12	9.6E6	6	6	6	N	69578	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g45060 PE=4 SV=1
1805	4725	Q9LPD0	82.05	22	22	1.67E7	6	5	6	N	38685	ATPase F22M8.4 OS=Arabidopsis thaliana OX=3702 GN=F22M8.4 PE=3 SV=1
1805	4726	A0A178WPT5	82.05	22	22	1.67E7	6	5	6	N	39671	ATPase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g01010 PE=1 SV=1
1805	4727	Q949M9	82.05	22	22	1.67E7	6	5	6	N	39671	ATPase OS=Arabidopsis thaliana OX=3702 GN=At1g01910 PE=1 SV=1
1998	5072	Q9M1J7	82.01	24	24	9.07E6	5	5	6	Y	41980	Protein STRICTOSIDINE SYNTHASE-LIKE 8 OS=Arabidopsis thaliana OX=3702 GN=SSL8 PE=2 SV=1
1998	5073	A0A178VJ69	82.01	24	24	9.07E6	5	5	6	Y	41980	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g51600 PE=4 SV=1
1540	6985	A0A178VIW7	81.97	26	26	1.62E7	5	5	7	Y	26610	Chalcone-flavonone isomerase family protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g49700 PE=3 SV=1
1540	6986	P41088	81.97	26	26	1.62E7	5	5	7	Y	26596	Chalcone--flavonone isomerase 1 OS=Arabidopsis thaliana OX=3702 GN=CHI1 PE=1 SV=2
2159	3844	Q9C5L8	81.95	12	12	9.55E6	4	4	5	Y	65508	Uncharacterized protein At5g13030 OS=Arabidopsis thaliana OX=3702 GN=At5g13030 PE=2 SV=1
2159	3846	Q67YJ0	81.95	11	11	9.55E6	4	4	5	Y	70755	mRNA, partial cds, clone: RAFL24-27-O06 (Fragment) OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2159	3847	Q67XT4	81.95	11	11	9.55E6	4	4	5	Y	70967	mRNA, partial cds, clone: RAFL25-06-C11 (Fragment) OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2159	3848	A0A178U9F5	81.95	11	11	9.55E6	4	4	5	Y	71098	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g12450 PE=1 SV=1
2159	3849	Q8H126	81.95	11	11	9.55E6	4	4	5	Y	71098	Selenoprotein O OS=Arabidopsis thaliana OX=3702 GN=At5g13030 PE=1 SV=1
2159	3842	Q9LXT6	81.95	12	12	9.55E6	4	4	5	Y	62001	Uncharacterized protein T24H18_200 OS=Arabidopsis thaliana OX=3702 GN=T24H18_200 PE=4 SV=1
2166	9284	Q9SXJ6	81.77	25	25	1.95E7	4	4	5	N	33925	ATP-dependent Clp protease proteolytic subunit 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPP3 PE=1 SV=1
2166	9285	A0A178WG76	81.77	25	25	1.95E7	4	4	5	N	33925	ATP-dependent Clp protease proteolytic subunit OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g60420 PE=3 SV=1
1812	3111	A0A178V9J0	81.75	21	21	9.35E6	5	5	6	Y	45754	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g04030 PE=3 SV=1
1812	3598	F4J4T3	81.75	21	21	9.35E6	5	5	6	Y	45767	Nucleotidylyl transferase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g04600 PE=3 SV=1
1812	3112	Q9SR15	81.75	21	21	9.35E6	5	5	6	Y	45754	Tryptophan--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At3g04600 PE=2 SV=1
2101	4742	Q9SR92	81.73	25	25	2.5E7	4	4	5	N	23780	Rhodanese-like domain-containing protein 10 OS=Arabidopsis thaliana OX=3702 GN=STR10 PE=2 SV=1
1616	2942	A0A178UW29	81.72	28	28	1.87E7	6	6	8	Y	42571	SHS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g37170 PE=3 SV=1
1616	2943	Q9SUV1	81.72	28	28	1.87E7	6	6	8	Y	42571	Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=BT1 PE=1 SV=1
2082	3526	C0LGE9	81.67	15	15	9.49E6	5	5	5	Y	65424	Leucine-rich repeat receptor-like protein kinase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=LRR-RLK PE=2 SV=1
2082	3527	O04567	81.67	15	15	9.49E6	5	5	5	Y	65424	Probable inactive receptor kinase At1g27190 OS=Arabidopsis thaliana OX=3702 GN=At1g27190 PE=1 SV=1
2082	3528	A0A178WG87	81.67	15	15	9.49E6	5	5	5	Y	65452	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g27640 PE=4 SV=1
2849	11557	A0A178W2U7	81.66	19	19	4.06E6	3	3	3	N	30480	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g16370 PE=4 SV=1
2849	11558	Q9SKS8	81.66	19	19	4.06E6	3	3	3	N	30480	At2g20920/F5H14.11 OS=Arabidopsis thaliana OX=3702 GN=At2g20920 PE=2 SV=1
1803	2979	F4I3M3	81.65	13	13	5.8E6	4	2	5	Y	54798	Serine/threonine-protein kinase BSK7 OS=Arabidopsis thaliana OX=3702 GN=BSK7 PE=3 SV=1
1803	2980	A0A178WJ26	81.65	13	13	5.8E6	4	2	5	Y	54798	BSK7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g56960 PE=4 SV=1
2013	9462	A0A178UJI2	81.62	37	37	2.05E7	4	4	6	N	23746	PnsB5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g41820 PE=4 SV=1
2013	9463	Q9FG89	81.62	37	37	2.05E7	4	4	6	N	23746	Photosynthetic NDH subunit of subcomplex B 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PNSB5 PE=2 SV=1
2115	7465	Q94BT9	81.57	54	54	3.12E7	4	4	5	Y	8158	Copper transport protein ATX1 OS=Arabidopsis thaliana OX=3702 GN=ATX1 PE=1 SV=2
2112	6965	P56795	81.57	29	29	2E7	3	3	5	N	18587	50S ribosomal protein L22, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rpl22 PE=3 SV=1
2112	6966	A0A1B1W4Y2	81.57	29	29	2E7	3	3	5	N	18587	50S ribosomal protein L22, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rpl22 PE=3 SV=1
2254	59660	Q9FKK1	81.56	55	55	3.32E7	4	3	5	N	10865	Protein transport protein Sec61 subunit beta OS=Arabidopsis thaliana OX=3702 GN=MUF9.9 PE=2 SV=1
2254	59659	A0A178UKY9	81.56	55	55	3.32E7	4	3	5	N	10895	Protein transport protein Sec61 subunit beta OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g59900 PE=3 SV=1
2846	11589	A0A178V9X5	81.43	16	16	2.96E6	3	3	3	Y	38200	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g17200 PE=3 SV=1
2846	11590	Q9LU14	81.43	16	16	2.96E6	3	3	3	Y	38200	GDSL esterase/lipase APG OS=Arabidopsis thaliana OX=3702 GN=APG PE=2 SV=1
1124	6718	Q9SF53	81.31	24	24	6.31E7	5	2	11	N	14285	60S ribosomal protein L35-1 OS=Arabidopsis thaliana OX=3702 GN=RPL35A PE=2 SV=1
1124	6719	A0A178V980	81.31	24	24	6.31E7	5	2	11	N	14285	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g09150 PE=3 SV=1
1996	2712	Q9FJH6	81.31	12	12	9.38E6	5	5	6	Y	66886	ABC transporter F family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCF1 PE=2 SV=1
1996	2713	A0A178UQ26	81.31	12	12	9.38E6	5	5	6	Y	66886	GCN1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g60250 PE=4 SV=1
2137	5386	A0A178VGB4	81.23	20	20	6.54E6	5	4	5	Y	38984	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g47960 PE=3 SV=1
2137	5387	Q9LFG2	81.23	20	20	6.54E6	5	4	5	Y	38984	Diaminopimelate epimerase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DAPF PE=1 SV=1
2098	745	Q9SGH6	81.19	10	10	1.16E7	4	4	5	N	73158	Alpha-dioxygenase 1 OS=Arabidopsis thaliana OX=3702 GN=DOX1 PE=1 SV=1
1523	3913	Q9C835	81.12	36	36	5.05E7	6	6	9	N	26427	Peptidyl-prolyl cis-trans isomerase CYP21-4 OS=Arabidopsis thaliana OX=3702 GN=CYP21-4 PE=2 SV=1
1523	3914	A0A178VHR2	81.12	36	36	5.05E7	6	6	9	N	26427	Peptidyl-prolyl cis-trans isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g06490 PE=3 SV=1
2216	5291	A0A178W9K9	81.10	23	23	9E6	5	4	5	Y	43490	LYP2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g22950 PE=4 SV=1
2216	5292	Q93ZH0	81.10	23	23	9E6	5	4	5	Y	43490	LysM domain-containing GPI-anchored protein 1 OS=Arabidopsis thaliana OX=3702 GN=LYM1 PE=1 SV=1
2325	3924	O80480	81.03	14	14	2.47E6	4	3	4	Y	59446	Importin subunit alpha-4 OS=Arabidopsis thaliana OX=3702 GN=IMPA4 PE=1 SV=1
2325	3925	A0A178WMY7	81.03	14	14	2.47E6	4	3	4	Y	59446	Importin subunit alpha OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g09150 PE=3 SV=1
2155	4731	Q8RX89	81.02	12	12	1.44E6	4	4	4	Y	81779	AT5g23390/T32G24_2 OS=Arabidopsis thaliana OX=3702 GN=At5g23390 PE=1 SV=1
2155	4732	Q9FGE0	81.02	12	12	1.44E6	4	4	4	Y	82298	Gb\|AAD20392.1 OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
1824	6989	Q9SS37	81.01	26	26	8.12E6	4	4	6	Y	27913	Reticulon-like protein B8 OS=Arabidopsis thaliana OX=3702 GN=RTNLB8 PE=2 SV=1
1824	6990	A0A178V9N5	81.01	26	26	8.12E6	4	4	6	Y	27913	Reticulon-like protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g10040 PE=4 SV=1
1449	5915	Q9LZV4	81.00	19	19	1.15E7	5	5	6	N	54979	Serine/threonine-protein kinase STN8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=STN8 PE=2 SV=1
1449	5916	A0A178U7X9	81.00	19	19	1.15E7	5	5	6	N	54965	STN8 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g01010 PE=4 SV=1
1871	2669	A0A178WDZ1	80.95	10	10	1.09E7	3	3	4	Y	57869	Endoglucanase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g70130 PE=3 SV=1
1871	2327	Q8LCP6	80.95	10	10	1.09E7	3	3	4	Y	57868	Endoglucanase 10 OS=Arabidopsis thaliana OX=3702 GN=At1g75680 PE=2 SV=2
1705	3246	Q8LAN3	80.92	31	31	1.93E7	6	3	7	Y	33061	Probable prolyl 4-hydroxylase 4 OS=Arabidopsis thaliana OX=3702 GN=P4H4 PE=2 SV=1
2063	3834	Q9FFC7	80.89	5	5	5.24E6	3	3	3	N	107830	Alanine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB86 PE=1 SV=2
2063	3835	A0A178U9H3	80.89	5	5	5.24E6	3	3	3	N	107830	Probable alanine--tRNA ligase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g22270 PE=3 SV=1
2063	3838	A0A1P8BCC6	80.89	5	5	5.24E6	3	3	3	N	111075	Probable alanine--tRNA ligase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=EMB1030 PE=1 SV=1
1951	3864	Q9SD41	80.86	10	10	1.07E7	4	4	4	N	75371	Uncharacterized protein F24M12.90 OS=Arabidopsis thaliana OX=3702 GN=F24M12.90 PE=4 SV=1
1951	3363	F4J381	80.86	10	10	1.07E7	4	4	4	N	77675	FG-GAP repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=At3g51050 PE=4 SV=1
1951	3364	Q8W0Z8	80.86	10	10	1.07E7	4	4	4	N	77694	At3g51050/F24M12_90 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1951	3365	A0A178VL07	80.86	10	10	1.07E7	4	4	4	N	77649	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g45330 PE=4 SV=1
1974	7052	O23403	80.77	16	16	1.46E7	4	4	5	N	32266	PsbP domain-containing protein 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPD1 PE=1 SV=1
1974	7053	A0A178UV94	80.77	16	16	1.46E7	4	4	5	N	32266	PPD1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g18120 PE=4 SV=1
1649	7781	A0A1B1W4X8	80.72	33	33	8.98E7	5	5	8	Y	15024	30S ribosomal protein S11, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rps11 PE=3 SV=1
1649	7782	P56802	80.72	33	33	8.98E7	5	5	8	Y	15024	30S ribosomal protein S11, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rps11 PE=3 SV=1
1562	3976	Q0WSC3	80.72	24	24	1.61E7	5	5	6	Y	39366	Uncharacterized protein At1g22800 OS=Arabidopsis thaliana OX=3702 GN=At1g22800 PE=2 SV=1
1562	3977	A0A178WDF2	80.72	24	24	1.61E7	5	5	6	Y	39311	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g23930 PE=4 SV=1
1562	3978	O80543	80.72	24	24	1.61E7	5	5	6	Y	39366	Putative methyltransferase At1g22800, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g22800 PE=1 SV=2
2183	6491	Q38936	80.70	29	29	1.88E7	4	2	5	Y	17658	Peptidyl-prolyl cis-trans isomerase FKBP15-2 OS=Arabidopsis thaliana OX=3702 GN=FKBP15-2 PE=2 SV=2
2183	6492	A0A178UPA7	80.70	29	29	1.88E7	4	2	5	Y	17658	Peptidylprolyl isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g47170 PE=4 SV=1
1760	3187	A0A178VJ78	80.65	9	9	7.92E6	3	3	3	Y	58841	RANGAP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g57410 PE=4 SV=1
1760	3188	Q9LE82	80.65	9	9	7.92E6	3	3	3	Y	58827	RAN GTPase-activating protein 1 OS=Arabidopsis thaliana OX=3702 GN=RANGAP1 PE=1 SV=1
2409	11091	F4JGD2	80.59	7	7	1.32E7	3	3	3	N	55102	Saposin-like aspartyl protease family protein OS=Arabidopsis thaliana OX=3702 GN=At4g04460 PE=3 SV=1
2409	11092	Q9XEC4	80.59	7	7	1.32E7	3	3	3	N	55571	Aspartic proteinase A3 OS=Arabidopsis thaliana OX=3702 GN=APA3 PE=2 SV=1
2409	11093	A0A178V6K3	80.59	7	7	1.32E7	3	3	3	N	55599	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g05900 PE=3 SV=1
2024	5056	Q9LQ73	80.57	20	20	3.47E7	4	3	6	N	25912	Peroxisomal membrane protein 11C OS=Arabidopsis thaliana OX=3702 GN=PEX11C PE=1 SV=1
2024	5057	A0A178W4K0	80.57	20	20	3.47E7	4	3	6	N	25912	PEX11C OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g00950 PE=4 SV=1
2494	10372	Q9FIU6	80.57	51	51	2.91E7	4	4	4	N	17090	Organelle RRM domain-containing protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ORRM2 PE=1 SV=1
2494	10373	A0A178UJY3	80.57	51	51	2.91E7	4	4	4	N	17090	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g53670 PE=4 SV=1
2352	108115	A0A178VZ34	80.54	6	6	8.87E6	3	2	4	N	95490	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g40640 PE=4 SV=1
2352	59697	Q67YI9	80.54	6	6	8.87E6	3	2	4	N	95478	Clathrin interactor EPSIN 2 OS=Arabidopsis thaliana OX=3702 GN=EPSIN2 PE=1 SV=1
1941	8970	A0A178V1H3	80.52	17	17	9.08E6	5	5	5	Y	46168	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g20860 PE=4 SV=1
1941	8971	O23614	80.52	15	15	9.08E6	5	5	5	Y	55763	Carboxyl-terminal-processing peptidase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CTPA2 PE=1 SV=1
2487	5831	Q9C7F7	80.51	28	28	5.54E7	4	4	4	Y	19759	Non-specific lipid transfer protein GPI-anchored 1 OS=Arabidopsis thaliana OX=3702 GN=LTPG1 PE=2 SV=1
2487	5832	A0A178WLV2	80.51	28	28	5.54E7	4	4	4	Y	19759	LTPG1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g28320 PE=4 SV=1
1938	4414	Q9SVQ9	80.48	34	34	1.23E7	6	6	6	Y	27657	AT4g13180/F17N18_70 OS=Arabidopsis thaliana OX=3702 GN=At4g13180 PE=1 SV=1
2104	6859	A0A178W6P6	80.46	16	16	1.12E7	4	4	4	Y	41247	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g60160 PE=3 SV=1
2104	6860	Q9C524	80.46	16	16	1.12E7	4	4	4	Y	41471	Probable fructokinase-6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g66430 PE=2 SV=1
1898	2767	Q9SX85	80.46	6	6	3.29E7	4	2	5	Y	100065	Exocyst complex component SEC3A OS=Arabidopsis thaliana OX=3702 GN=SEC3A PE=1 SV=1
1898	2768	F4HTA1	80.46	6	6	3.29E7	4	2	5	Y	100164	Exocyst complex component sec3A OS=Arabidopsis thaliana OX=3702 GN=SEC3A PE=4 SV=1
1886	5391	Q9C8H3	80.35	12	12	1.44E7	6	6	6	Y	89154	FT-interacting protein 4 OS=Arabidopsis thaliana OX=3702 GN=FTIP4 PE=1 SV=1
1886	5392	A0A178W7D8	80.35	12	12	1.44E7	6	6	6	Y	89154	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g45780 PE=4 SV=1
1971	8459	Q37165	80.27	12	12	1.82E7	4	3	5	N	40021	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhA PE=3 SV=2
1971	8460	A0A1B1W4Z8	80.27	12	12	1.82E7	4	3	5	N	40163	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhA PE=3 SV=1
2130	5355	O23207	80.22	38	38	1.05E7	5	5	5	Y	28754	Probable NAD(P)H dehydrogenase (quinone) FQR1-like 2 OS=Arabidopsis thaliana OX=3702 GN=At4g36750 PE=1 SV=1
1711	5168	A0A178UG88	80.21	38	38	2.96E7	5	5	6	N	23398	NdhN OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g57600 PE=4 SV=1
1711	5169	Q9LVM2	80.21	38	38	2.96E7	5	5	6	N	23398	NAD(P)H-quinone oxidoreductase subunit N, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhN PE=2 SV=1
985	7141	A0A178V7W6	80.02	39	39	2.71E8	4	4	15	Y	10241	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g54640 PE=3 SV=1
985	7142	Q8RXU5	80.02	39	39	2.71E8	4	4	15	Y	10241	60S ribosomal protein L37a-2 OS=Arabidopsis thaliana OX=3702 GN=RPL37AC PE=3 SV=1
1776	6619	Q9ZQX4	80.01	41	41	4.26E7	5	5	6	N	14259	V-type proton ATPase subunit F OS=Arabidopsis thaliana OX=3702 GN=VHA-F PE=2 SV=1
1776	6620	A0A178V4M8	80.01	41	41	4.26E7	5	5	6	N	14259	V-type proton ATPase subunit F OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g03270 PE=3 SV=1
1683	4448	Q9LVI8	79.98	21	21	3.63E6	5	2	5	Y	38595	Glutamine synthetase cytosolic isozyme 1-3 OS=Arabidopsis thaliana OX=3702 GN=GLN1-3 PE=1 SV=1
1683	4449	A0A178VNQ6	79.98	21	21	3.63E6	5	2	5	Y	38595	Glutamine synthetase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g18870 PE=3 SV=1
2505	6067	A0A178VWU3	79.90	5	5	1.28E6	3	3	3	Y	134622	TIP120 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g01550 PE=4 SV=1
2505	6068	Q8L5Y6	79.90	5	5	1.28E6	3	3	3	Y	134897	Cullin-associated NEDD8-dissociated protein 1 OS=Arabidopsis thaliana OX=3702 GN=CAND1 PE=1 SV=1
2505	6069	A0A178VV83	79.90	5	5	1.28E6	3	3	3	Y	134898	TIP120 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g01550 PE=4 SV=1
2845	4424	A0A1P8B9J8	79.87	8	8	3.95E6	3	3	3	Y	67940	Translation factor GUF1 homolog, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g08650 PE=3 SV=1
2845	4425	Q9FNM5	79.87	7	7	3.95E6	3	3	3	Y	75437	Translation factor GUF1 homolog, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g08650 PE=1 SV=2
2845	4426	A0A178USI8	79.87	7	7	3.95E6	3	3	3	Y	75437	Translation factor GUF1 homolog, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g08570 PE=3 SV=1
1914	7164	P58684	79.84	21	21	3.68E7	3	3	5	N	21642	Probable signal peptidase complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=At2g39960 PE=2 SV=1
1914	7165	A0A178VMY0	79.84	21	21	3.68E7	3	3	5	N	21642	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g36960 PE=4 SV=1
1740	5848	O48587	79.84	25	25	1.55E7	5	5	5	N	28809	At5g44730 OS=Arabidopsis thaliana OX=3702 GN=T19K24.16 PE=2 SV=1
1740	5849	A0A178UJ81	79.84	25	25	1.55E7	5	5	5	N	28809	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g42990 PE=4 SV=1
2490	3796	A0A384LJ62	79.83	13	13	1.11E7	4	4	4	N	61190	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g31190 PE=4 SV=1
2490	3797	Q94C59	79.83	13	13	1.11E7	4	4	4	N	61190	Patellin-4 OS=Arabidopsis thaliana OX=3702 GN=PATL4 PE=1 SV=2
2490	3798	B9DHD5	79.83	13	13	1.11E7	4	4	4	N	61190	AT1G30690 protein OS=Arabidopsis thaliana OX=3702 GN=At1g30690 PE=2 SV=1
1548	3566	A0A1P8BCY2	79.82	7	7	5.29E6	6	4	6	Y	166509	Myosin family protein with Dil OS=Arabidopsis thaliana OX=3702 GN=XIK PE=1 SV=1
1548	3307	A0A178UIJ0	79.82	7	7	5.29E6	6	4	6	Y	172558	XIK OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g20440 PE=3 SV=1
1548	3310	F4K5J1	79.82	7	7	5.29E6	6	4	6	Y	173376	Myosin-17 OS=Arabidopsis thaliana OX=3702 GN=XI-K PE=1 SV=2
2006	7353	A0A178UP37	79.79	13	13	1.16E7	4	4	5	N	50323	Histidinol dehydrogenase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g63470 PE=3 SV=1
2006	7354	Q9C5U8	79.79	13	13	1.16E7	4	4	5	N	50323	Histidinol dehydrogenase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HISN8 PE=2 SV=1
1799	5996	A0A1P8AUM2	79.77	13	13	4.62E6	4	4	4	Y	50904	OPC-8:0 CoA ligase1 OS=Arabidopsis thaliana OX=3702 GN=OPCL1 PE=4 SV=1
1799	5997	A0A178W4B4	79.77	13	13	4.62E6	4	4	4	Y	50944	OPCL1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g21460 PE=4 SV=1
1799	5998	F4HST9	79.77	13	13	4.62E6	4	4	4	Y	51223	OPC-8:0 CoA ligase1 OS=Arabidopsis thaliana OX=3702 GN=OPCL1 PE=4 SV=1
1799	5282	Q84P21	79.77	11	11	4.62E6	4	4	4	Y	59375	4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana OX=3702 GN=4CLL5 PE=1 SV=2
1868	5924	A0A1I9LPV3	79.70	6	6	3.56E6	3	3	3	Y	116115	Multidrug resistance-associated protein 6 OS=Arabidopsis thaliana OX=3702 GN=ABCC8 PE=4 SV=1
1868	5929	A0A178VH67	79.70	4	4	3.56E6	3	3	3	Y	162024	MRP6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g22730 PE=4 SV=1
1868	5939	A0A1I9LPV6	79.70	4	4	3.56E6	3	3	3	Y	161567	Multidrug resistance-associated protein 6 OS=Arabidopsis thaliana OX=3702 GN=ABCC8 PE=4 SV=1
1868	5940	Q8LGU1	79.70	4	4	3.56E6	3	3	3	Y	162071	ABC transporter C family member 8 OS=Arabidopsis thaliana OX=3702 GN=ABCC8 PE=2 SV=3
1868	5941	A0A1I9LPV5	79.70	4	4	3.56E6	3	3	3	Y	162840	Multidrug resistance-associated protein 6 OS=Arabidopsis thaliana OX=3702 GN=ABCC8 PE=4 SV=1
1669	4571	Q9T042	79.63	8	8	2.82E7	3	3	5	Y	53893	Protein disulfide-isomerase 5-4 OS=Arabidopsis thaliana OX=3702 GN=PDIL5-4 PE=2 SV=1
1415	2697	Q9ZQ26	79.55	8	8	2.27E7	3	3	5	N	50352	AT2G24420 protein OS=Arabidopsis thaliana OX=3702 GN=At2g24420 PE=2 SV=2
1819	4991	A0A178V4I8	79.50	10	10	5.3E6	4	4	6	Y	61353	Beta-amylase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g20170 PE=3 SV=1
1819	4992	O23553	79.50	10	10	5.3E6	4	4	6	Y	61353	Beta-amylase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=BAM3 PE=1 SV=3
2735	7288	Q84JZ4	79.42	16	16	3.51E6	3	3	3	Y	40413	Homoserine dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=At5g21060 PE=2 SV=1
2735	7289	A0A178UB93	79.42	16	16	3.51E6	3	3	3	Y	40413	Homoserine dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g21030 PE=3 SV=1
2735	9459	Q8LF92	79.42	16	16	3.51E6	3	3	3	Y	40455	Homoserine dehydrogenase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2735	7290	F4K6Y9	79.42	16	16	3.51E6	3	3	3	Y	40669	Homoserine dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=At5g21060 PE=3 SV=1
2735	7291	F4K6Y8	79.42	16	16	3.51E6	3	3	3	Y	40670	Homoserine dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=At5g21060 PE=3 SV=1
2735	7292	A0A178U956	79.42	16	16	3.51E6	3	3	3	Y	40670	Homoserine dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g21030 PE=3 SV=1
1863	3240	Q9SIZ2	79.39	23	23	4.41E7	5	5	5	Y	38748	Eukaryotic translation initiation factor 2 subunit alpha homolog OS=Arabidopsis thaliana OX=3702 GN=At2g40290 PE=1 SV=2
1863	3241	A0A178VYF4	79.39	23	23	4.41E7	5	5	5	Y	38748	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g37360 PE=4 SV=1
2218	3987	Q94K30	79.39	29	29	9.44E6	5	5	5	Y	31660	AT1G01800 protein OS=Arabidopsis thaliana OX=3702 GN=At1g01800 PE=2 SV=1
2218	3988	A0A178WIX4	79.39	29	29	9.44E6	5	5	5	Y	31660	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g00930 PE=3 SV=1
2218	3989	Q9LQ75	79.39	26	26	9.44E6	5	5	5	Y	35171	T1N6.22 protein OS=Arabidopsis thaliana OX=3702 GN=T1N6.22 PE=3 SV=1
1918	5510	P57681	79.37	12	12	3.4E6	3	3	4	Y	55298	Farnesylcysteine lyase OS=Arabidopsis thaliana OX=3702 GN=FLCY PE=1 SV=1
1918	5511	A0A178UCJ3	79.37	12	12	3.4E6	3	3	4	Y	55298	FCLY OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g63500 PE=4 SV=1
1611	3312	Q9STI1	79.34	17	17	6.44E6	5	3	6	N	58659	Cytochrome P450, family 706, subfamily A, polypeptide 4 OS=Arabidopsis thaliana OX=3702 GN=''cytochrome P450 PE=2 SV=1
1611	3313	A0A178V1P1	79.34	17	17	6.44E6	5	3	6	N	58659	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g13790 PE=3 SV=1
1919	5640	Q9SR70	79.18	17	17	4.43E7	3	3	5	N	24505	Peptidyl-prolyl cis-trans isomerase FKBP16-4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FKBP16-4 PE=1 SV=1
1919	5641	A0A178V516	79.18	17	17	4.43E7	3	3	5	N	24505	Peptidylprolyl isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g09760 PE=4 SV=1
2099	4754	P56754	79.01	41	41	1.58E7	4	4	5	Y	18558	NAD(P)H-quinone oxidoreductase subunit J, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhJ PE=3 SV=1
2099	4755	A0A1B1W4V0	79.01	41	41	1.58E7	4	4	5	Y	18558	NAD(P)H-quinone oxidoreductase subunit J, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhJ PE=3 SV=1
2099	5107	B0FFQ7	79.01	51	51	1.58E7	4	4	5	Y	14807	NAD(P)H-quinone oxidoreductase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=ndhJ PE=3 SV=1
1663	3172	A0A178VP05	79.00	35	35	5.25E7	5	4	6	N	24146	GSTF9 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g26980 PE=3 SV=1
1663	3173	O80852	79.00	35	35	5.25E7	5	4	6	N	24146	Glutathione S-transferase F9 OS=Arabidopsis thaliana OX=3702 GN=GSTF9 PE=1 SV=1
2127	6795	Q42546	78.97	29	29	1.43E7	5	5	5	Y	37564	SAL1 phosphatase OS=Arabidopsis thaliana OX=3702 GN=SAL1 PE=1 SV=1
2127	6796	A0A178UF94	78.97	25	25	1.43E7	5	5	5	Y	43509	SUPO1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g63570 PE=4 SV=1
1650	6340	Q9FFH6	78.94	23	23	4.18E7	4	3	8	Y	26205	Fasciclin-like arabinogalactan protein 13 OS=Arabidopsis thaliana OX=3702 GN=FLA13 PE=1 SV=1
1650	6341	A0A178U8W9	78.94	23	23	4.18E7	4	3	8	Y	26205	FLA13 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g42260 PE=4 SV=1
2395	6376	A0A1P8AXX8	78.93	31	31	1.42E7	4	4	4	Y	25296	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=At2g34310 PE=1 SV=1
2395	6377	O80780	78.93	30	30	1.42E7	4	4	4	Y	26144	Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g34310 PE=1 SV=2
2148	6845	Q9C542	78.91	28	28	5.68E7	5	5	5	N	20828	At1g55160/T7N22.11 OS=Arabidopsis thaliana OX=3702 GN=F7A10.9 PE=2 SV=1
2148	6846	F4HYQ1	78.91	24	24	5.68E7	5	5	5	N	23844	WAS/WASL-interacting family protein OS=Arabidopsis thaliana OX=3702 GN=At1g55160 PE=4 SV=1
2148	6861	B3H4C4	78.91	38	38	5.68E7	5	5	5	N	15423	WAS/WASL-interacting family protein OS=Arabidopsis thaliana OX=3702 GN=At1g55160 PE=4 SV=1
2148	6862	A0A178WCV7	78.91	38	38	5.68E7	5	5	5	N	15423	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g49650 PE=4 SV=1
1913	10040	A0A178U9Q7	78.84	30	30	1.9E7	4	4	5	Y	25803	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g23520 PE=4 SV=1
1913	10041	Q9FF88	78.84	30	30	1.9E7	4	4	5	Y	25803	At5g23920 OS=Arabidopsis thaliana OX=3702 GN=MRO11.4 PE=2 SV=1
2243	7364	A0A178V785	78.81	12	12	2.33E7	3	3	4	N	33440	ATP-dependent Clp protease proteolytic subunit OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g20110 PE=3 SV=1
2243	7365	Q8LB10	78.81	12	12	2.33E7	3	3	4	N	33440	ATP-dependent Clp protease proteolytic subunit-related protein 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPR4 PE=1 SV=1
2387	6784	Q9M8L6	78.81	16	16	9.83E6	4	3	4	N	49488	At1g80480 OS=Arabidopsis thaliana OX=3702 GN=PTAC17 PE=2 SV=1
2387	6785	A0A178W622	78.81	16	16	9.83E6	4	3	4	N	49560	PTAC17 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g75330 PE=4 SV=1
1906	108067	A0A178VX04	78.77	16	16	7.57E6	4	4	4	Y	55759	NFC4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g14870 PE=4 SV=1
1906	108068	O22607	78.77	16	16	7.57E6	4	4	4	Y	55759	WD-40 repeat-containing protein MSI4 OS=Arabidopsis thaliana OX=3702 GN=MSI4 PE=1 SV=3
2170	6539	Q680A5	78.77	16	16	4.16E6	3	3	4	N	37560	Ribose-phosphate pyrophosphokinase 4 OS=Arabidopsis thaliana OX=3702 GN=PRS4 PE=1 SV=2
1478	7798	A0A178UFK2	78.75	9	9	1.44E7	3	2	5	Y	49914	Cand7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g18320 PE=4 SV=1
1478	7802	Q56YB8	78.75	9	9	1.44E7	3	2	5	Y	50303	Uncharacterized protein At5g18520 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1478	7803	F4JY11	78.75	9	9	1.44E7	3	2	5	Y	50245	Lung seven transmembrane receptor family protein OS=Arabidopsis thaliana OX=3702 GN=Cand7 PE=4 SV=1
2058	5779	Q0WRZ7	78.73	27	27	1.08E7	4	3	5	N	27910	Signal recognition particle receptor beta subunit-like protein OS=Arabidopsis thaliana OX=3702 GN=At5g05670 PE=2 SV=1
2058	4774	A0A178UJQ1	78.73	25	25	1.08E7	4	3	5	N	29076	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g05170 PE=1 SV=1
2058	4775	Q9FFK7	78.73	25	25	1.08E7	4	3	5	N	29076	AT5G05670 protein OS=Arabidopsis thaliana OX=3702 GN=MJJ3.7 PE=1 SV=1
2659	7960	Q9M081	78.71	5	5	1.68E6	3	2	3	Y	116322	Protein transport protein Sec24-like At4g32640 OS=Arabidopsis thaliana OX=3702 GN=At4g32640 PE=3 SV=3
2659	7961	R4WCW1	78.71	4	4	1.68E6	3	2	3	Y	117639	Sec24-like transport protein OS=Arabidopsis thaliana OX=3702 GN=AT4G32640 PE=2 SV=1
2659	7962	A0A178V3S0	78.71	4	4	1.68E6	3	2	3	Y	117624	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g37440 PE=4 SV=1
2083	6797	F4K7E0	78.69	18	18	2.48E7	4	4	4	N	43485	Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=MRH10.6 PE=4 SV=1
2083	6798	Q9FND0	78.69	15	15	2.48E7	4	4	4	N	50122	Gb\|AAD20086.1 OS=Arabidopsis thaliana OX=3702 GN=MRH10.6 PE=1 SV=1
1869	2181	Q9FM96	78.69	12	12	1.7E7	4	4	5	Y	73214	Glucosidase 2 subunit beta OS=Arabidopsis thaliana OX=3702 GN=PSL4 PE=2 SV=1
2110	9633	C0Z2C6	78.69	31	31	4.51E7	5	5	5	Y	14118	AT1G09310 protein OS=Arabidopsis thaliana OX=3702 GN=At1g09310 PE=2 SV=1
2110	7394	A0A178W8C5	78.69	22	22	4.51E7	5	5	5	Y	19947	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g09210 PE=1 SV=1
2110	7395	Q9ZPZ4	78.69	22	22	4.51E7	5	5	5	Y	19947	T31J12.3 protein OS=Arabidopsis thaliana OX=3702 GN=At1g09310 PE=1 SV=1
1950	3524	A0A178VAT7	78.58	32	32	5.99E6	5	5	5	Y	35464	PGR7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g22660 PE=4 SV=1
1950	3525	Q9LU39	78.58	32	32	5.99E6	5	5	5	Y	35463	Glutamyl-tRNA reductase-binding protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GLUTRBP PE=1 SV=1
2014	6930	A0A1P8AQ84	78.51	10	10	2.18E6	4	4	4	N	63100	DEA(D/H)-box RNA helicase family protein OS=Arabidopsis thaliana OX=3702 GN=EMB3108 PE=4 SV=1
2014	6933	A0A178W6P4	78.51	9	9	2.18E6	4	4	4	N	64834	RH22 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g53090 PE=4 SV=1
2014	6934	Q944S1	78.51	9	9	2.18E6	4	4	4	N	64747	DEAD-box ATP-dependent RNA helicase 22 OS=Arabidopsis thaliana OX=3702 GN=RH22 PE=2 SV=1
1907	6205	A0A1P8B108	78.50	15	15	9.19E6	4	4	5	Y	42822	N-acetyl-gamma-glutamyl-phosphate reductase OS=Arabidopsis thaliana OX=3702 GN=At2g19940 PE=3 SV=1
1907	6206	Q93Z70	78.50	14	14	9.19E6	4	4	5	Y	44136	Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g19940 PE=1 SV=2
1907	6207	A0A178VYZ7	78.50	14	14	9.19E6	4	4	5	Y	44136	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g15280 PE=3 SV=1
1907	6208	C0Z2J2	78.50	14	14	9.19E6	4	4	5	Y	44136	AT2G19940 protein OS=Arabidopsis thaliana OX=3702 GN=At2g19940 PE=2 SV=1
2341	6330	Q9T0I8	78.26	33	33	5.98E6	3	3	3	Y	28451	5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase 1 OS=Arabidopsis thaliana OX=3702 GN=MTN1 PE=1 SV=1
2341	6331	A0A178UXV8	78.26	33	33	5.98E6	3	3	3	Y	28451	MTN1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g44120 PE=4 SV=1
2224	6175	A0A178WE75	78.08	39	39	2.33E7	4	4	4	Y	14857	Peptidyl-prolyl cis-trans isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g26910 PE=4 SV=1
2224	6176	Q9FE18	78.08	39	39	2.33E7	4	4	4	Y	14857	Peptidyl-prolyl cis-trans isomerase OS=Arabidopsis thaliana OX=3702 GN=T1K7.8 PE=2 SV=1
2512	6811	A0A1P8BBM1	78.05	16	16	1E7	3	3	3	N	25813	Superoxide dismutase OS=Arabidopsis thaliana OX=3702 GN=FSD2 PE=3 SV=1
2512	6929	A0A1P8BBK0	78.05	16	16	1E7	3	3	3	N	27226	Superoxide dismutase OS=Arabidopsis thaliana OX=3702 GN=FSD2 PE=3 SV=1
2512	5879	A0A1P8BBJ5	78.05	12	12	1E7	3	3	3	N	33595	Fe superoxide dismutase 2 OS=Arabidopsis thaliana OX=3702 GN=FSD2 PE=4 SV=1
2512	5880	A0A178UQJ4	78.05	12	12	1E7	3	3	3	N	34678	FSD2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g49880 PE=4 SV=1
2512	5881	Q9LU64	78.05	12	12	1E7	3	3	3	N	34664	Superoxide dismutase [Fe] 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FSD2 PE=1 SV=1
2503	12039	A0A178WKH7	78.03	26	26	1.74E7	4	4	4	N	25309	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g41740 PE=4 SV=1
2503	12040	Q9SX96	78.03	26	26	1.74E7	4	4	4	N	25309	At1g47640/F16N3_6 OS=Arabidopsis thaliana OX=3702 GN=At1g47640 PE=2 SV=1
2114	2944	Q9FLW9	77.96	10	10	1.55E7	3	3	4	Y	63522	Plastidial pyruvate kinase 2 OS=Arabidopsis thaliana OX=3702 GN=PKP2 PE=1 SV=1
2114	2945	A0A178U9G2	77.96	10	10	1.55E7	3	3	4	Y	63522	Pyruvate kinase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g51800 PE=3 SV=1
2682	8025	Q8L9M8	77.81	34	34	1.34E7	3	3	3	N	15698	Zinc finger/BTB domain protein OS=Arabidopsis thaliana OX=3702 GN=At1g33810 PE=1 SV=1
2682	8026	A0A178WN70	77.81	34	34	1.34E7	3	3	3	N	15698	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g34490 PE=1 SV=1
2399	6349	Q9SS58	77.75	24	24	1.37E7	4	4	4	N	28952	F16G16.1 protein (Fragment) OS=Arabidopsis thaliana OX=3702 GN=F16G16.1 PE=4 SV=1
2399	6350	A0A178WBR2	77.75	19	19	1.37E7	4	4	4	N	35624	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g58620 PE=4 SV=1
2399	6351	Q5XF12	77.75	19	19	1.37E7	4	4	4	N	35624	At1g65020 OS=Arabidopsis thaliana OX=3702 GN=At1g65020 PE=2 SV=1
2851	7578	Q9FI47	77.75	20	20	4.56E7	3	3	3	Y	17230	Rubredoxin-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g51010 PE=2 SV=1
2851	7579	A0A178UGM8	77.75	20	20	4.56E7	3	3	3	Y	17230	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g49800 PE=4 SV=1
1676	4918	Q9LRN0	77.69	11	11	5.77E6	5	5	5	N	87437	AT3g24190/MUJ8_17 OS=Arabidopsis thaliana OX=3702 GN=At3g24190 PE=2 SV=1
1676	4919	A0A384KHA5	77.69	11	11	5.77E6	5	5	5	N	87437	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g26140 PE=4 SV=1
2439	8083	Q9LJQ6	77.69	8	8	2.1E7	2	2	3	N	48053	AT3G18240 protein OS=Arabidopsis thaliana OX=3702 GN=At3g18240 PE=1 SV=1
2439	8084	A0A384L363	77.69	8	8	2.1E7	2	2	3	N	48053	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g19340 PE=1 SV=1
2169	7774	A0A178UCR6	77.65	36	36	3.23E7	4	4	5	Y	23897	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g49900 PE=4 SV=1
2169	7775	Q9LU63	77.65	36	36	3.23E7	4	4	5	Y	23897	Probable pterin-4-alpha-carbinolamine dehydratase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ATP1 PE=1 SV=1
1828	9694	Q9ZVL0	77.62	19	19	1.41E8	3	3	5	Y	21569	Glycoprotein membrane GPI-anchored OS=Arabidopsis thaliana OX=3702 GN=T22H22.25 PE=2 SV=1
1828	9695	A0A178WIR6	77.62	19	19	1.41E8	3	3	5	Y	21627	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g49350 PE=4 SV=1
2210	7630	A0A178ULM8	77.57	26	26	2.87E7	3	3	4	N	12010	PDE335 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g01230 PE=4 SV=1
2210	7631	O81208	77.57	26	26	2.87E7	3	3	4	N	12010	Light-harvesting complex-like protein OHP1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OHP1 PE=1 SV=1
2370	8448	Q0WWC5	77.56	19	19	5.85E7	3	3	4	N	18726	Uncharacterized protein At1g48350 OS=Arabidopsis thaliana OX=3702 GN=At1g48350 PE=2 SV=1
2370	8449	A0A384KQD1	77.56	19	19	5.85E7	3	3	4	N	18726	EMB3105 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g42420 PE=3 SV=1
2370	8450	Q9SX68	77.56	19	19	5.85E7	3	3	4	N	18726	50S ribosomal protein L18, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPL18 PE=2 SV=1
1614	3342	A0A178W4F2	77.54	10	10	3.24E6	5	5	5	N	82559	FKFBP OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g06730 PE=4 SV=1
1614	3343	Q9MB58	77.54	10	10	3.24E6	5	5	5	N	82559	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana OX=3702 GN=FKFBP PE=1 SV=1
1626	6678	Q84JW1	77.52	20	20	4.36E7	4	3	6	N	25512	Peroxisomal membrane protein 11E OS=Arabidopsis thaliana OX=3702 GN=PEX11E PE=1 SV=1
1626	6679	A0A178VG67	77.52	20	20	4.36E7	4	3	6	N	25512	PEX11E OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g55330 PE=4 SV=1
2048	7064	A0A178UH61	77.50	13	13	8.62E6	5	5	5	N	69103	TAP2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g36480 PE=4 SV=1
2048	7065	Q0WML0	77.50	13	13	8.62E6	5	5	5	N	69104	ABC transporter B family member 27 OS=Arabidopsis thaliana OX=3702 GN=ABCB27 PE=1 SV=1
2421	5019	Q67XZ5	77.45	18	18	4.22E7	3	3	4	N	29124	Putative ribosome recycling factor OS=Arabidopsis thaliana OX=3702 GN=At3g01800 PE=2 SV=1
2421	5020	A0A178V8D4	77.45	18	18	4.22E7	3	3	4	N	29124	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g00930 PE=4 SV=1
2421	5021	Q6NQM0	77.45	18	18	4.22E7	3	3	4	N	29172	At3g01800 OS=Arabidopsis thaliana OX=3702 GN=At3g01800 PE=2 SV=1
2421	5022	Q9SGJ1	77.45	17	17	4.22E7	3	3	4	N	31124	Putative ribosome recycling factor OS=Arabidopsis thaliana OX=3702 GN=F28J7.13 PE=4 SV=1
2107	6663	C0Z2Q3	77.45	21	21	1.53E7	3	3	3	Y	27435	Proteasome subunit beta OS=Arabidopsis thaliana OX=3702 GN=At3g27430 PE=2 SV=1
2107	6655	A0A178VCF7	77.45	20	20	1.53E7	3	3	3	Y	29555	Proteasome subunit beta OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g29940 PE=3 SV=1
2107	6656	O23710	77.45	20	20	1.53E7	3	3	3	Y	29555	Proteasome subunit beta type-7-A OS=Arabidopsis thaliana OX=3702 GN=PBB1 PE=1 SV=2
2492	6222	A0A178VQX2	77.41	19	19	3.38E7	4	4	4	Y	28620	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g07110 PE=4 SV=1
2492	6223	Q9SKI0	77.41	18	18	3.38E7	4	4	4	Y	29648	At2g10940/F15K19.1 OS=Arabidopsis thaliana OX=3702 GN=At2g10940 PE=2 SV=1
2283	6540	A0A178VMU8	77.41	15	15	1.71E7	3	3	4	N	37195	HCC1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g08540 PE=4 SV=1
2283	6541	Q8VYP0	77.41	15	15	1.71E7	3	3	4	N	37195	Protein SCO1 homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HCC1 PE=2 SV=1
1772	12578	A0A178V429	77.34	11	11	8.9E6	4	4	4	N	59598	PHT4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g00500 PE=4 SV=1
1772	12579	Q8GX78	77.34	11	11	8.9E6	4	4	4	N	59614	Ascorbate transporter, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PHT4;4 PE=1 SV=1
1509	5039	Q9XEX2	77.34	28	28	3.58E7	4	3	8	N	17428	Peroxiredoxin-2B OS=Arabidopsis thaliana OX=3702 GN=PRXIIB PE=1 SV=1
1963	6544	C0Z3C3	77.33	16	16	4.48E6	3	3	3	N	37981	AT1G75330 protein OS=Arabidopsis thaliana OX=3702 GN=At1g75330 PE=2 SV=1
1963	6547	O50039	77.33	15	15	4.48E6	3	3	3	N	41002	Ornithine carbamoyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OTC PE=1 SV=2
1963	6548	A0A178W4A4	77.33	15	15	4.48E6	3	3	3	N	41002	OTC OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g69770 PE=3 SV=1
2225	6197	A0A178WA13	77.32	28	28	2.97E7	4	4	5	N	25701	Proteasome subunit alpha type OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g17250 PE=3 SV=1
2225	6198	O23708	77.32	28	28	2.97E7	4	4	5	N	25701	Proteasome subunit alpha type-2-A OS=Arabidopsis thaliana OX=3702 GN=PAB1 PE=1 SV=1
2230	5042	Q9C865	77.29	18	18	2.23E6	4	4	5	Y	49258	SH3 domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=SH3P1 PE=1 SV=1
2493	7686	Q9LIL3	77.27	31	31	1.25E6	4	3	4	Y	27107	Aluminum induced protein with YGL and LRDR motifs OS=Arabidopsis thaliana OX=3702 GN=At3g22850 PE=1 SV=1
2493	7687	A0A384LGT1	77.27	31	31	1.25E6	4	3	4	Y	27107	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g24620 PE=1 SV=1
2408	6979	Q9LDF5	77.26	17	17	6.76E6	3	3	4	Y	31690	3-hydroxyacyl-CoA dehydrogenase family protein OS=Arabidopsis thaliana OX=3702 GN=At3g15290 PE=2 SV=1
2408	6980	A0A384KN26	77.26	17	17	6.76E6	3	3	4	Y	31690	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g15940 PE=4 SV=1
2408	9510	A0A1I9LST4	77.26	21	21	6.76E6	3	3	4	Y	25781	3-hydroxyacyl-CoA dehydrogenase family protein OS=Arabidopsis thaliana OX=3702 GN=At3g15290 PE=4 SV=1
2498	4504	Q949Y3	77.24	17	17	9.64E6	4	4	4	N	55010	Bifunctional purple acid phosphatase 26 OS=Arabidopsis thaliana OX=3702 GN=PAP26 PE=1 SV=1
2498	4505	A0A178UD94	77.24	17	17	9.64E6	4	4	4	N	55010	Purple acid phosphatase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g30750 PE=3 SV=1
1904	6062	A0A178W747	77.18	21	21	3.29E7	4	4	5	Y	21777	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g70290 PE=4 SV=1
1904	6063	Q38937	77.18	21	21	3.29E7	4	4	5	Y	21777	Rac-like GTP-binding protein ARAC5 OS=Arabidopsis thaliana OX=3702 GN=ARAC5 PE=1 SV=1
1904	6085	A0A178W4W7	77.18	16	16	3.29E7	4	4	5	Y	29304	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g70290 PE=4 SV=1
2511	7523	A0A384LG12	77.18	17	17	1.56E7	3	3	3	N	29745	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g54380 PE=4 SV=1
2511	7524	Q9M1X8	77.18	17	17	1.56E7	3	3	3	N	29745	Nucleic acid-binding, OB-fold-like protein OS=Arabidopsis thaliana OX=3702 GN=F24G16.250 PE=2 SV=1
1647	4943	A0A178VDG6	77.11	12	12	7.87E6	3	2	4	N	41596	SSL4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g45730 PE=4 SV=1
1647	4944	Q9SD07	77.11	12	12	7.87E6	3	2	4	N	41596	Protein STRICTOSIDINE SYNTHASE-LIKE 4 OS=Arabidopsis thaliana OX=3702 GN=SSL4 PE=1 SV=1
1704	3902	A0A178VBP3	77.11	9	9	1.99E7	6	6	6	Y	99926	EMB2083 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g17120 PE=4 SV=1
1704	3139	A8MPR5	77.11	9	9	1.99E7	6	6	6	Y	99864	Probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FTSHI2 PE=1 SV=1
1905	4920	Q9M898	77.00	24	24	2.43E7	4	4	6	N	39611	AT3g02420/F16B3_5 OS=Arabidopsis thaliana OX=3702 GN=At3g02420 PE=1 SV=1
1899	5156	O78318	76.96	15	15	5.51E6	3	3	4	N	30565	NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic (Fragment) OS=Arabidopsis thaliana OX=3702 GN=ndhF PE=3 SV=1
1899	5159	A0A3T0D2J9	76.96	13	13	5.51E6	3	3	4	N	35595	NADH dehydrogenase F (Fragment) OS=Arabidopsis thaliana OX=3702 GN=ndhF PE=4 SV=1
1899	5173	K9MEQ3	76.96	6	6	5.51E6	3	3	4	N	77729	NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic (Fragment) OS=Arabidopsis thaliana OX=3702 GN=ndhF PE=3 SV=1
1899	5174	E7CHF4	76.96	6	6	5.51E6	3	3	4	N	78392	NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic (Fragment) OS=Arabidopsis thaliana OX=3702 GN=ndhF PE=3 SV=1
1899	5177	P56752	76.96	5	5	5.51E6	3	3	4	N	85239	NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhF PE=3 SV=1
1899	5178	A0A1B1W4Y7	76.96	5	5	5.51E6	3	3	4	N	85239	NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhF PE=3 SV=1
1899	5717	Q8HRN8	76.96	12	12	5.51E6	3	3	4	N	38091	NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic (Fragment) OS=Arabidopsis thaliana OX=3702 GN=ndhF PE=3 SV=1
2349	7764	Q8L953	76.95	46	46	1.24E8	4	3	4	Y	9490	40S ribosomal protein S27-3 OS=Arabidopsis thaliana OX=3702 GN=RPS27D PE=2 SV=2
2294	7029	Q9M6K3	76.94	22	22	3.43E7	4	4	4	Y	32620	Isopentenyl pyrophosphate:dimethyllallyl pyrophosphate isomerase OS=Arabidopsis thaliana OX=3702 GN=ipiAt1 PE=2 SV=1
2294	7030	A0A178V9S3	76.94	22	22	3.43E7	4	4	4	Y	32606	IPP2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g02050 PE=4 SV=1
2294	7031	Q42553	76.94	22	22	3.43E7	4	4	4	Y	32607	Isopentenyl-diphosphate Delta-isomerase II, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=IPP2 PE=1 SV=1
1325	3317	A0A178WKP2	76.92	10	10	1.78E7	6	5	6	N	59229	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g18960 PE=4 SV=1
1325	3318	Q8L835	76.92	10	10	1.78E7	6	5	6	N	59243	At1g18070 OS=Arabidopsis thaliana OX=3702 GN=At1g18070 PE=1 SV=1
1325	3319	Q9LMS7	76.92	9	9	1.78E7	6	5	6	N	60507	T10F20.8 protein OS=Arabidopsis thaliana OX=3702 GN=At1g18070 PE=1 SV=1
1325	3858	Q9LM39	76.92	8	8	1.78E7	6	5	6	N	69043	T10O22.4 OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
1773	4422	O23052	76.85	9	9	8.19E6	4	2	5	N	90169	Uncharacterized TPR repeat-containing protein At1g05150 OS=Arabidopsis thaliana OX=3702 GN=At1g05150 PE=1 SV=1
1773	4423	A0A1W6AK06	76.85	9	9	8.19E6	4	2	5	N	90169	Calcium-binding tetratricopeptide family protein (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT1G05150.1 PE=2 SV=1
1773	5358	A0A178WHK7	76.85	9	9	8.19E6	4	2	5	N	90543	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g04540 PE=4 SV=1
1578	4502	Q8GYJ7	76.78	12	12	1.02E7	7	7	7	N	78321	FAD/NAD(P)-binding oxidoreductase family protein OS=Arabidopsis thaliana OX=3702 GN=EMB2421 PE=2 SV=1
2190	5741	F4IHY7	76.76	8	8	9.21E6	3	3	3	N	60895	Protein PLASTID TRANSCRIPTIONALLY ACTIVE 12, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PTAC12 PE=1 SV=1
2190	5742	A0A178W212	76.76	8	8	9.21E6	3	3	3	N	60895	TAC12 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g31190 PE=4 SV=1
1427	8560	Q8VZQ8	76.71	9	9	4.71E6	3	3	3	Y	68744	Putative kinesin light chain OS=Arabidopsis thaliana OX=3702 GN=At2g31240 PE=2 SV=1
1427	8689	A0A178VY42	76.71	7	7	4.71E6	3	3	3	Y	91274	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g27440 PE=4 SV=1
1427	8899	A0A178VWP7	76.71	5	5	4.71E6	3	3	3	Y	128564	Glutamyl-tRNA reductase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g27450 PE=3 SV=1
1428	12445	Q8VZG2	76.66	10	10	9.76E6	5	4	5	N	66136	Protein HYPER-SENSITIVITY-RELATED 4 OS=Arabidopsis thaliana OX=3702 GN=HSR4 PE=2 SV=1
1428	12446	A0A178V737	76.66	10	10	9.76E6	5	4	5	N	66170	BCS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g45210 PE=3 SV=1
1777	6079	A0A178W6M8	76.61	76	76	1.67E8	4	4	7	Y	7832	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g45860 PE=4 SV=1
1777	6080	Q96253	76.61	76	76	1.67E8	4	4	7	Y	7832	ATP synthase subunit epsilon, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g51650 PE=1 SV=3
1289	6556	A0A178W7I8	76.60	22	22	5.28E8	6	6	9	N	17115	PSAG OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g50290 PE=4 SV=1
1289	6557	Q9S7N7	76.60	22	22	5.28E8	6	6	9	N	17085	Photosystem I reaction center subunit V, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSAG PE=1 SV=1
2252	7943	A0A1P8B0Z7	76.48	11	11	7.82E6	3	3	5	N	62331	AFG1-like ATPase family protein OS=Arabidopsis thaliana OX=3702 GN=At2g25530 PE=4 SV=1
2252	7944	Q9SKJ6	76.48	9	9	7.82E6	3	3	5	N	75411	AFG1-like ATPase family protein OS=Arabidopsis thaliana OX=3702 GN=At2g25530 PE=4 SV=1
1541	8502	A0A178VFX8	76.46	7	7	1.57E7	4	4	5	N	68442	OVA1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g49990 PE=3 SV=1
1541	59273	Q9M2T9	76.46	7	7	1.57E7	4	4	5	N	69274	Methionine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA1 PE=2 SV=1
1762	5298	P61841	76.38	36	36	6.8E7	5	5	7	N	17357	30S ribosomal protein S7, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rps7-A PE=1 SV=1
1762	5299	Q6KGZ1	76.38	36	36	6.8E7	5	5	7	N	17357	30S ribosomal protein S7, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rps7 PE=3 SV=1
1519	8697	O48593	76.37	13	13	1.68E7	5	5	6	Y	63698	Asparagine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SYNO PE=2 SV=3
1519	8698	A0A178UXJ8	76.37	13	13	1.68E7	5	5	6	Y	66133	OVA8 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g20360 PE=3 SV=1
1519	8699	A0A1P8B3X2	76.37	13	13	1.68E7	5	5	6	Y	66084	Class II aminoacyl-tRNA and biotin synthetases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=NS1 PE=3 SV=1
1662	7203	A0A1P8BDP2	76.29	6	6	1.93E6	5	2	5	N	119188	Kinesin like protein for actin based chloroplast movement 2 OS=Arabidopsis thaliana OX=3702 GN=KAC2 PE=1 SV=1
1662	7227	A0A1P8BDS9	76.29	6	6	1.93E6	5	2	5	N	124824	Kinesin like protein for actin based chloroplast movement 2 OS=Arabidopsis thaliana OX=3702 GN=KAC2 PE=1 SV=1
1662	7207	Q9FKP4	76.29	5	5	1.93E6	5	2	5	N	140396	Kinesin-like protein KIN-14B OS=Arabidopsis thaliana OX=3702 GN=KIN14B PE=1 SV=1
1662	7209	A0A1P8BDQ0	76.29	5	5	1.93E6	5	2	5	N	140794	Kinesin like protein for actin based chloroplast movement 2 OS=Arabidopsis thaliana OX=3702 GN=KAC2 PE=1 SV=1
1662	7210	A0A178UC07	76.29	5	5	1.93E6	5	2	5	N	140808	KCA2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g65280 PE=3 SV=1
1662	7213	A0A1P8BDP7	76.29	5	5	1.93E6	5	2	5	N	141587	Kinesin like protein for actin based chloroplast movement 2 OS=Arabidopsis thaliana OX=3702 GN=KAC2 PE=1 SV=1
2501	9337	A0A384KKU3	76.28	12	12	2.99E6	3	3	3	N	39134	PMP OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g26100 PE=4 SV=1
2501	9338	Q9ZSJ7	76.28	12	12	2.99E6	3	3	3	N	39134	AT3g24160/MUJ8_16 OS=Arabidopsis thaliana OX=3702 GN=PMP PE=2 SV=1
1943	108053	F4ISP6	76.27	26	26	1.7E7	5	5	5	Y	43913	Nucleotidylyl transferase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=OVA4 PE=1 SV=1
1943	108054	Q8RXE9	76.27	25	25	1.7E7	5	5	5	Y	45300	Tryptophan--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA4 PE=1 SV=1
1943	108055	A0A178VQC6	76.27	25	25	1.7E7	5	5	5	Y	45853	OVA4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g21690 PE=1 SV=1
1943	108056	F4ISP4	76.27	25	25	1.7E7	5	5	5	Y	45853	Nucleotidylyl transferase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=OVA4 PE=1 SV=1
2554	9227	A0A178VW24	76.20	11	11	9.79E6	2	2	3	N	32206	CXIP2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g35130 PE=4 SV=1
2554	9228	Q8H7F6	76.20	11	11	9.79E6	2	2	3	N	32206	Bifunctional monothiol glutaredoxin-S16, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GRXS16 PE=1 SV=2
2553	7594	Q8LGC6	76.16	14	14	1.12E6	2	2	2	N	22780	Nascent polypeptide-associated complex subunit alpha-like protein 5 OS=Arabidopsis thaliana OX=3702 GN=At1g33040 PE=2 SV=2
3252	9401	A0A178VU21	76.11	24	24	3.16E7	2	2	2	Y	19077	GRP2B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g16490 PE=4 SV=1
3252	9402	Q38896	76.11	24	24	3.16E7	2	2	2	Y	19077	Cold shock domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=CSP4 PE=1 SV=1
2182	5652	B9DHR4	76.06	20	20	5.32E6	3	2	4	N	28457	AT4G30440 protein (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At4g30440 PE=2 SV=1
2182	5634	Q9M0B6	76.06	12	12	5.32E6	3	2	4	N	47458	UDP-glucuronate 4-epimerase 1 OS=Arabidopsis thaliana OX=3702 GN=GAE1 PE=1 SV=1
2182	5635	I1VCA9	76.06	12	12	5.32E6	3	2	4	N	47458	UDP-D-glucuronate 4-epimerase 1 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=GAE1 PE=2 SV=1
2182	5636	A0A384LBP5	76.06	12	12	5.32E6	3	2	4	N	47458	GAE1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g34900 PE=4 SV=1
2342	2559	A0A178WA54	75.97	16	16	2.1E7	3	3	4	N	35319	SS2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g68370 PE=4 SV=1
2342	2560	P94111	75.97	16	16	2.1E7	3	3	4	N	35293	Protein STRICTOSIDINE SYNTHASE-LIKE 12 OS=Arabidopsis thaliana OX=3702 GN=SSL12 PE=2 SV=2
2246	6874	Q8LC75	75.95	35	35	2.09E7	3	3	4	N	13656	Nuclear transport factor 2, putative OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2246	6875	A0A178W1S4	75.95	34	34	2.09E7	3	3	4	N	14002	NTF2B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g28340 PE=4 SV=1
2246	6876	Q9C7F5	75.95	34	34	2.09E7	3	3	4	N	14002	Nuclear transport factor 2B OS=Arabidopsis thaliana OX=3702 GN=NTF2B PE=1 SV=1
2246	6877	A8MS55	75.95	32	32	2.09E7	3	3	4	N	15004	Nuclear transport factor 2B OS=Arabidopsis thaliana OX=3702 GN=NTF2B PE=1 SV=1
1664	4030	A0A178UR82	75.92	2	2	3.61E6	3	3	3	Y	210696	EMB3012 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g38210 PE=4 SV=1
1664	3866	F4KHD8	75.92	2	2	3.61E6	3	3	3	Y	210664	Nuclear pore complex protein GP210 OS=Arabidopsis thaliana OX=3702 GN=GB210 PE=1 SV=1
1979	7681	C0Z3G0	75.88	44	44	4.15E7	4	4	6	Y	13998	Profilin OS=Arabidopsis thaliana OX=3702 GN=At4g29350 PE=2 SV=1
1979	7682	Q42418	75.88	44	44	4.15E7	4	4	6	Y	13998	Profilin-2 OS=Arabidopsis thaliana OX=3702 GN=PRO2 PE=2 SV=1
1979	7683	Q8LCJ1	75.88	44	44	4.15E7	4	4	6	Y	13989	Profilin OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1979	7684	A0A384LEY9	75.88	44	44	4.15E7	4	4	6	Y	13998	Profilin OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g33720 PE=3 SV=1
2850	9370	A0A178V2J3	75.85	12	12	9.59E5	3	3	3	N	50428	Non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g28260 PE=3 SV=1
2850	9371	Q9STV4	75.85	12	12	9.59E5	3	3	3	N	50428	CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana OX=3702 GN=CIPK8 PE=1 SV=1
2100	3429	A0A178VIH4	75.85	6	6	7.18E6	4	4	5	Y	147214	VCS OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g13560 PE=4 SV=1
2029	7990	A0A1B1W4X5	75.81	46	46	3.72E7	3	3	6	N	10608	30S ribosomal protein S19, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rps19 PE=3 SV=1
2029	7991	P56808	75.81	46	46	3.72E7	3	3	6	N	10608	30S ribosomal protein S19, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rps19 PE=3 SV=1
2876	7376	Q8S8N9	75.79	8	8	7E5	3	3	3	Y	79180	Golgin candidate 1 OS=Arabidopsis thaliana OX=3702 GN=GC1 PE=2 SV=2
2876	7377	A0A178VUM2	75.79	8	8	7E5	3	3	3	Y	79535	GC1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g15290 PE=4 SV=1
1844	3325	A0A178VTA1	75.74	14	14	2.27E7	4	3	4	N	41753	NFA2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g14830 PE=3 SV=1
1844	3326	F4ISI7	75.74	13	13	2.27E7	4	3	4	N	42847	Nucleosome assembly protein 12 OS=Arabidopsis thaliana OX=3702 GN=NAP1:2 PE=1 SV=1
1844	3327	A0A178VUR1	75.74	13	13	2.27E7	4	3	4	N	42961	NFA2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g14830 PE=3 SV=1
1844	3328	A8MRK6	75.74	13	13	2.27E7	4	3	4	N	42975	Nucleosome assembly protein 12 OS=Arabidopsis thaliana OX=3702 GN=NAP1:2 PE=1 SV=1
1844	3332	Q9ZUP3	75.74	13	13	2.27E7	4	3	4	N	43543	Nucleosome assembly protein 1;2 OS=Arabidopsis thaliana OX=3702 GN=NAP1;2 PE=1 SV=1
1875	7984	P58049	75.72	10	10	1.81E6	3	2	3	N	56899	Cytochrome P450 71B11 OS=Arabidopsis thaliana OX=3702 GN=CYP71B11 PE=2 SV=1
1875	7985	A0A178UEP7	75.72	10	10	1.81E6	3	2	3	N	56968	CYP71B11 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g24980 PE=3 SV=1
1667	4577	Q9SX52	75.69	30	30	8.76E5	4	4	4	Y	34819	Phytochrome-associated serine/threonine-protein phosphatase 1 OS=Arabidopsis thaliana OX=3702 GN=FYPP1 PE=1 SV=1
1667	4578	Q9LHE7	75.69	30	30	8.76E5	4	4	4	Y	34845	Phytochrome-associated serine/threonine-protein phosphatase 3 OS=Arabidopsis thaliana OX=3702 GN=FYPP3 PE=1 SV=1
1667	4579	A0A178VAH8	75.69	30	30	8.76E5	4	4	4	Y	34845	Serine/threonine-protein phosphatase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g21290 PE=3 SV=1
1667	4580	A0A178W0C4	75.69	30	30	8.76E5	4	4	4	Y	34819	Serine/threonine-protein phosphatase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g44570 PE=3 SV=1
1821	6733	Q8LDU0	75.68	17	17	1.15E7	4	4	4	N	30456	At4g28360 OS=Arabidopsis thaliana OX=3702 GN=At4g28355 PE=2 SV=1
1680	3884	Q94K71	75.65	16	16	3.47E7	4	4	6	Y	34245	CBBY-like protein OS=Arabidopsis thaliana OX=3702 GN=CBBY PE=1 SV=1
1680	4620	A0A178VE98	75.65	16	16	3.47E7	4	4	6	Y	34245	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g42530 PE=4 SV=1
2491	6500	A0A178WBB2	75.65	15	15	5.46E6	4	4	4	N	48092	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g05530 PE=4 SV=1
2491	6501	W8PVE7	75.65	15	15	5.46E6	4	4	4	N	48122	Glycosyltransferase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT1G06000 PE=2 SV=1
2491	6502	Q9LNE6	75.65	15	15	5.46E6	4	4	4	N	48122	UDP-glycosyltransferase 89C1 OS=Arabidopsis thaliana OX=3702 GN=UGT89C1 PE=2 SV=1
2233	108073	F4HYR4	75.46	9	9	8.13E6	4	4	5	Y	73296	O-fucosyltransferase 15 OS=Arabidopsis thaliana OX=3702 GN=OFUT15 PE=2 SV=1
2086	6337	A8MRW5	75.28	19	19	1.22E7	4	4	4	Y	33835	Oxidoreductase, zinc-binding dehydrogenase family protein OS=Arabidopsis thaliana OX=3702 GN=At4g21580 PE=4 SV=1
2086	6338	O65423	75.28	18	18	1.22E7	4	4	4	Y	34465	AT4g21580/F18E5_200 OS=Arabidopsis thaliana OX=3702 GN=F18E5.200 PE=2 SV=1
2086	6339	A0A178V300	75.28	18	18	1.22E7	4	4	4	Y	34465	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g25030 PE=4 SV=1
1587	7022	A0A2P2CLF3	75.24	9	9	1.48E7	5	4	5	N	64776	Ribosomal protein S3 OS=Arabidopsis thaliana OX=3702 GN=rps3 PE=4 SV=2
2279	7154	P51422	75.22	24	24	9.86E6	2	2	3	N	12785	60S ribosomal protein L35a-4 OS=Arabidopsis thaliana OX=3702 GN=RPL35AD PE=3 SV=2
2279	7155	A0A178V8C0	75.22	24	24	9.86E6	2	2	3	N	12785	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g50380 PE=3 SV=1
2279	7127	Q9C912	75.22	24	24	9.86E6	2	2	3	N	12916	60S ribosomal protein L35a-3 OS=Arabidopsis thaliana OX=3702 GN=RPL35AC PE=3 SV=1
2313	5508	A0A178VKH6	75.17	7	7	2.14E6	2	2	2	Y	57301	Carboxypeptidase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g10210 PE=3 SV=1
2313	5509	P32826	75.17	7	7	2.14E6	2	2	2	Y	57301	Serine carboxypeptidase-like 49 OS=Arabidopsis thaliana OX=3702 GN=SCPL49 PE=2 SV=2
2397	6726	Q9LZL9	75.10	16	16	4.25E6	4	4	4	Y	45764	At5g02130 OS=Arabidopsis thaliana OX=3702 GN=NDP1 PE=2 SV=1
2397	6727	A0A178UD62	75.10	16	16	4.25E6	4	4	4	Y	45796	NDP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g01240 PE=4 SV=1
2397	6728	Q8LFK4	75.10	16	16	4.25E6	4	4	4	Y	45763	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2156	59356	A0A178UUM6	75.10	14	14	1.38E7	3	3	3	N	37383	Peroxidase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g25490 PE=3 SV=1
2156	59357	Q9SB81	75.10	14	14	1.38E7	3	3	3	N	37295	Peroxidase 42 OS=Arabidopsis thaliana OX=3702 GN=PER42 PE=1 SV=2
2686	5382	A0A178VY19	75.08	22	22	5.98E6	2	2	3	N	19125	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g15570 PE=4 SV=1
2686	5383	Q8LBS4	75.08	22	22	5.98E6	2	2	3	N	19125	Monothiol glutaredoxin-S12, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GRXS12 PE=1 SV=2
2108	8326	A0A178VN76	75.00	14	14	5.93E6	3	3	3	Y	46160	RECA2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g14840 PE=3 SV=1
2108	8327	Q9ZUP2	75.00	14	14	5.93E6	3	3	3	Y	46160	DNA repair protein recA homolog 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g19490 PE=2 SV=2
2108	8328	A0A178VNJ5	75.00	14	14	5.93E6	3	3	3	Y	46474	RECA2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g14840 PE=3 SV=1
2015	9737	Q9SVW7	74.99	41	41	1.39E7	5	5	6	Y	16888	At4g35490 OS=Arabidopsis thaliana OX=3702 GN=MRPL11 PE=2 SV=1
2015	9738	A0A384KJP0	74.99	41	41	1.39E7	5	5	6	Y	16888	MRPL11 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g40520 PE=3 SV=1
1625	6903	A0A384L496	74.94	41	41	6.85E7	4	4	6	N	10020	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g42170 PE=4 SV=1
1625	6904	Q42338	74.94	41	41	6.85E7	4	4	6	N	10020	AT3G48140 protein OS=Arabidopsis thaliana OX=3702 GN=T24C20_20 PE=2 SV=1
1625	6916	A0A178V7L9	74.94	28	28	6.85E7	4	4	6	N	14383	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g42170 PE=4 SV=1
2324	9613	Q8GZ29	74.83	10	10	9.65E6	4	3	4	Y	66979	Indole-3-acetic acid-amido synthetase GH3.15 OS=Arabidopsis thaliana OX=3702 GN=GH3.15 PE=1 SV=1
2411	59486	A0A178V2U4	74.78	11	11	8.95E7	3	3	4	Y	78143	SVR7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g19210 PE=4 SV=1
2411	59487	Q8GWE0	74.78	11	11	8.95E7	3	3	4	Y	78243	Pentatricopeptide repeat-containing protein At4g16390, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=P67 PE=1 SV=3
1656	7538	F4IHJ8	74.77	31	31	1.59E7	5	2	7	N	11941	Ribosomal protein S25 family protein OS=Arabidopsis thaliana OX=3702 GN=At2g21580 PE=4 SV=1
1656	7539	Q9SIK2	74.77	31	31	1.59E7	5	2	7	N	12069	40S ribosomal protein S25-2 OS=Arabidopsis thaliana OX=3702 GN=RPS25B PE=3 SV=1
1656	7540	A0A178VWT5	74.77	31	31	1.59E7	5	2	7	N	12069	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g17110 PE=4 SV=1
1980	7916	P46421	74.76	17	17	1.52E7	4	4	6	N	26000	Glutathione S-transferase U5 OS=Arabidopsis thaliana OX=3702 GN=GSTU5 PE=2 SV=1
1980	7917	A0A178VPP0	74.76	17	17	1.52E7	4	4	6	N	26000	GSTU5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g25530 PE=3 SV=1
1980	9522	Q42199	74.76	43	43	1.52E7	4	4	6	N	9907	Auxin-induced mRNA (Fragment) OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2534	7598	B3H6E6	74.63	42	42	8.5E7	3	3	4	Y	10904	Mitochondrial pyruvate carrier OS=Arabidopsis thaliana OX=3702 GN=AtMPC1 PE=3 SV=1
2534	7601	A0A178UR79	74.63	37	37	8.5E7	3	3	4	Y	12438	Mitochondrial pyruvate carrier OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g20050 PE=3 SV=1
2534	7602	Q949R9	74.63	37	37	8.5E7	3	3	4	Y	12438	Mitochondrial pyruvate carrier 1 OS=Arabidopsis thaliana OX=3702 GN=MPC1 PE=3 SV=1
2416	7541	A0A178USA1	74.55	7	7	4.55E6	3	3	3	N	69198	ATH12 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g03260 PE=4 SV=1
2416	7542	Q9LZB8	74.55	7	7	4.55E6	3	3	3	N	69198	ABC transporter B family member 29, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABCB29 PE=1 SV=1
2662	59291	Q9LRT1	74.52	4	4	2.17E6	2	2	2	Y	111932	Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana OX=3702 GN=At3g28040 PE=1 SV=1
2521	6537	Q9FPG2	74.47	29	29	2.96E7	4	3	4	Y	19452	Outer envelope pore protein 21B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OEP21B PE=2 SV=1
2521	6538	A0A178W9W0	74.47	29	29	2.96E7	4	3	4	Y	19452	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g70870 PE=4 SV=1
2336	3962	A0A178UQG0	74.42	8	8	8.64E6	4	4	4	N	81093	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g26510 PE=3 SV=1
2336	3306	O82462	74.42	8	8	8.64E6	4	4	4	N	81065	Glutamate--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At5g26710 PE=1 SV=1
2150	6128	A0A178VTF0	74.40	14	14	1.39E6	4	3	5	Y	54157	3-ketoacyl-CoA synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g10340 PE=3 SV=1
2150	6129	Q4V3C9	74.40	14	14	1.39E6	4	3	5	Y	54191	3-ketoacyl-CoA synthase 8 OS=Arabidopsis thaliana OX=3702 GN=KCS8 PE=2 SV=1
2085	5697	Q9LSI9	74.39	13	13	8.29E6	5	5	5	Y	66945	Inactive LRR receptor-like serine/threonine-protein kinase BIR2 OS=Arabidopsis thaliana OX=3702 GN=BIR2 PE=1 SV=1
1804	7945	A0A178WL87	74.32	5	5	6.59E6	4	4	4	N	116191	ICU9 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g42500 PE=3 SV=1
1804	7946	O04379	74.32	5	5	6.59E6	4	4	4	N	116191	Protein argonaute 1 OS=Arabidopsis thaliana OX=3702 GN=AGO1 PE=1 SV=1
1804	7947	A0A178WL72	74.32	5	5	6.59E6	4	4	4	N	116460	ICU9 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g42500 PE=3 SV=1
2089	3018	Q9SF29	74.27	21	21	1.09E7	4	4	4	N	29983	Syntaxin-71 OS=Arabidopsis thaliana OX=3702 GN=SYP71 PE=1 SV=1
2089	3019	Q2HIU8	74.27	21	21	1.09E7	4	4	4	N	29983	At3g09740 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2089	3020	A0A384KWM4	74.27	21	21	1.09E7	4	4	4	N	29983	SYP71 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g09410 PE=3 SV=1
2128	6752	Q8L606	74.22	17	17	9.49E6	4	4	4	Y	38665	Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g53560 PE=2 SV=1
2128	6755	A0A384KTJ9	74.22	15	15	9.49E6	4	4	4	Y	44001	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g47940 PE=4 SV=1
2128	6756	Q9LFG3	74.22	15	15	9.49E6	4	4	4	Y	44001	Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F4P12_260 PE=4 SV=1
1910	5415	Q945M1	74.22	33	33	3.36E7	4	4	4	N	13616	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Arabidopsis thaliana OX=3702 GN=CIB22 PE=1 SV=1
1757	8626	A0A178UFM6	74.18	12	12	1.25E7	5	5	6	N	60245	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g04670 PE=4 SV=1
1757	8627	Q9ASX5	74.18	12	12	1.25E7	5	5	6	N	60314	Uncharacterized aarF domain-containing protein kinase At5g05200, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g05200 PE=1 SV=1
2032	108139	Q9LVH7	74.11	19	19	8.79E6	2	2	3	N	14338	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2032	59726	A0A384LGN8	74.11	13	13	8.79E6	2	2	3	N	20913	DAC OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g19000 PE=1 SV=1
2032	108140	Q8LDI7	74.11	13	13	8.79E6	2	2	3	N	20913	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2032	108141	Q94BY7	74.11	13	13	8.79E6	2	2	3	N	20913	AT3g17930/MEB5_15 OS=Arabidopsis thaliana OX=3702 GN=DAC PE=1 SV=1
2327	5780	A0A178UNC1	74.07	41	41	4.79E7	3	3	3	Y	10851	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g46400 PE=4 SV=1
2327	5781	Q9FIJ2	74.07	41	41	4.79E7	3	3	3	Y	10851	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=At5g47890 PE=3 SV=1
2136	6892	A0A178VCD8	74.07	14	14	1.28E7	5	5	5	Y	59550	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g13300 PE=4 SV=1
2136	6893	Q9LK58	74.07	14	14	1.28E7	5	5	5	Y	60630	Pentatricopeptide repeat-containing protein At3g13150 OS=Arabidopsis thaliana OX=3702 GN=At3g13150 PE=2 SV=1
2857	4192	Q9SR19	74.02	13	13	2.86E6	3	3	3	N	50199	Rubisco accumulation factor 1.2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RAF1.2 PE=1 SV=1
2857	4193	A0A178V6F9	74.02	13	13	2.86E6	3	3	3	N	50173	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g03980 PE=4 SV=1
2429	59441	A0A178UL23	74.00	18	18	2.42E7	3	3	4	Y	36662	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g19170 PE=4 SV=1
2429	59440	Q8VZV6	74.00	18	18	2.42E7	3	3	4	Y	36662	Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g19290 PE=2 SV=1
1827	10153	Q9FLF3	73.99	17	17	4.51E7	6	6	7	N	31200	Ribosomal protein L18e/L15 superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MUB3.19 PE=2 SV=1
1827	10154	A0A178UPM8	73.99	17	17	4.51E7	6	6	7	N	31200	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g64310 PE=3 SV=1
2394	5801	A0A178W7U4	73.85	9	9	1.45E6	4	2	4	Y	86357	Protein transport protein SEC23 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g04940 PE=1 SV=1
2394	5802	Q93ZN7	73.85	9	9	1.45E6	4	2	4	Y	86344	Protein transport protein SEC23 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2394	5803	Q8H0S3	73.85	9	9	1.45E6	4	2	4	Y	86357	Protein transport protein SEC23 OS=Arabidopsis thaliana OX=3702 GN=At1g05520 PE=1 SV=1
2394	5804	Q9ZVY6	73.85	8	8	1.45E6	4	2	4	Y	89649	Protein transport protein SEC23 OS=Arabidopsis thaliana OX=3702 PE=3 SV=1
2234	5887	Q9CB01	73.79	28	28	4.88E6	4	2	5	N	21889	Ras-related protein RABF1 OS=Arabidopsis thaliana OX=3702 GN=RABF1 PE=1 SV=1
2234	5888	A0A178VAL4	73.79	28	28	4.88E6	4	2	5	N	21889	RABF1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g49370 PE=4 SV=1
1756	4853	A0A178UAZ3	73.75	11	11	6.13E6	4	4	5	N	50463	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g02200 PE=1 SV=1
1756	4854	Q93ZH7	73.75	11	11	6.13E6	4	4	5	N	50463	AT5g03040/F15A17_70 OS=Arabidopsis thaliana OX=3702 GN=iqd2 PE=1 SV=1
2168	7750	A0A178VSK5	73.75	17	17	2.71E7	4	4	5	N	30669	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g41150 PE=4 SV=1
2168	7751	Q8VYY8	73.75	17	17	2.71E7	4	4	5	N	30700	Nucleusenvelope protein OS=Arabidopsis thaliana OX=3702 GN=At2g43630 PE=2 SV=1
2351	9185	A0A178UPF0	73.61	36	36	8.47E6	2	2	3	N	15551	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g62260 PE=4 SV=1
2351	9196	F4K7S5	73.61	27	27	8.47E6	2	2	3	N	21013	Integral membrane HPP family protein OS=Arabidopsis thaliana OX=3702 GN=MQB2.4 PE=4 SV=1
2351	9201	Q8GZ51	73.61	22	22	8.47E6	2	2	3	N	25828	At5g62720 OS=Arabidopsis thaliana OX=3702 GN=MQB2.4 PE=2 SV=1
2351	9202	A0A178UPA4	73.61	22	22	8.47E6	2	2	3	N	25846	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g62260 PE=4 SV=1
2351	9033	Q8LAK4	73.61	22	22	8.47E6	2	2	3	N	25817	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2071	8757	A0A178VQJ3	73.61	26	26	1.8E7	3	3	3	Y	21889	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g27310 PE=4 SV=1
2071	8760	Q84VZ6	73.61	25	25	1.8E7	3	3	3	Y	23132	At2g31140 OS=Arabidopsis thaliana OX=3702 GN=At2g31140 PE=2 SV=1
2071	8759	O82270	73.61	25	25	1.8E7	3	3	3	Y	23140	Uncharacterized protein At2g31140 OS=Arabidopsis thaliana OX=3702 GN=At2g31140 PE=4 SV=1
2729	7315	Q8GYN5	73.59	26	26	6.5E6	3	3	3	Y	23371	RPM1-interacting protein 4 OS=Arabidopsis thaliana OX=3702 GN=RIN4 PE=1 SV=1
2729	7241	B2BDQ4	73.59	26	26	6.5E6	3	3	3	Y	23355	RPM1-interacting protein 4 OS=Arabidopsis thaliana OX=3702 GN=RIN4 PE=4 SV=1
2729	7441	B2BDQ1	73.59	26	26	6.5E6	3	3	3	Y	23429	RPM1-interacting protein 4 OS=Arabidopsis thaliana OX=3702 GN=RIN4 PE=4 SV=1
2729	7442	A0A178VFN6	73.59	26	26	6.5E6	3	3	3	Y	23429	RIN4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g27070 PE=4 SV=1
2729	7316	Q2HII6	73.59	26	26	6.5E6	3	3	3	Y	23371	At3g25070 OS=Arabidopsis thaliana OX=3702 GN=RIN4 PE=2 SV=1
2729	7443	A0A178VDD7	73.59	25	25	6.5E6	3	3	3	Y	24962	RIN4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g27070 PE=4 SV=1
2729	7317	A0A1I9LMJ4	73.59	25	25	6.5E6	3	3	3	Y	24904	RPM1 interacting protein 4 OS=Arabidopsis thaliana OX=3702 GN=RIN4 PE=1 SV=1
2729	7439	B2BDP8	73.59	26	26	6.5E6	3	3	3	Y	23170	RPM1-interacting protein 4 OS=Arabidopsis thaliana OX=3702 GN=RIN4 PE=4 SV=1
2729	7440	B2BDQ0	73.59	26	26	6.5E6	3	3	3	Y	23113	RPM1-interacting protein 4 OS=Arabidopsis thaliana OX=3702 GN=RIN4 PE=4 SV=1
2729	7240	B2BDR4	73.59	26	26	6.5E6	3	3	3	Y	23323	RPM1-interacting protein 4 OS=Arabidopsis thaliana OX=3702 GN=RIN4 PE=4 SV=1
2191	59601	Q9SN73	73.56	40	40	2E7	3	3	5	Y	14546	Protein BUNDLE SHEATH DEFECTIVE 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=BSD2 PE=1 SV=1
2191	59602	A0A384KD29	73.56	40	40	2E7	3	3	5	Y	14546	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g41640 PE=4 SV=1
1726	7035	Q9M5A9	73.53	9	9	3.51E7	3	3	5	N	42329	Glucose-6-phosphate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GPT1 PE=2 SV=1
1726	7036	A0A178UL59	73.53	9	9	3.51E7	3	3	5	N	42329	GPT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g53920 PE=4 SV=1
2502	7225	Q39055	73.50	19	19	2.18E6	4	4	4	Y	43413	GTP 3',8-cyclase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CNX2 PE=1 SV=1
2502	7226	A0A178W0P6	73.50	19	19	2.18E6	4	4	4	Y	43413	CNX2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g28230 PE=3 SV=1
2280	5923	F4IFC5	73.50	10	10	1.9E7	4	4	4	N	74785	Threonine--tRNA ligase, chloroplastic/mitochondrial 2 OS=Arabidopsis thaliana OX=3702 GN=EMB2761 PE=2 SV=1
1922	6732	Q8W4P8	73.48	8	8	9.6E5	4	3	4	Y	68170	Membrane protein of ER body 1 OS=Arabidopsis thaliana OX=3702 GN=MEB1 PE=1 SV=1
1922	6734	A0A1P8B7C6	73.48	8	8	9.6E5	4	3	4	Y	69004	Vacuolar iron transporter (VIT) family protein OS=Arabidopsis thaliana OX=3702 GN=MEB1 PE=4 SV=1
1922	6736	A0A1P8B7E1	73.48	8	8	9.6E5	4	3	4	Y	69162	Vacuolar iron transporter (VIT) family protein OS=Arabidopsis thaliana OX=3702 GN=MEB1 PE=4 SV=1
2522	6771	A0A178WNQ0	73.45	24	24	7.71E6	3	3	3	N	27802	Chlorophyll a-b binding protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g40960 PE=3 SV=1
2522	6772	Q9C639	73.45	24	24	7.71E6	3	3	3	N	27802	Photosystem I chlorophyll a/b-binding protein 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LHCA5 PE=1 SV=1
2310	7094	A0A1I9LR72	73.37	12	12	5.72E6	3	3	3	N	44849	Beta-galactosidase OS=Arabidopsis thaliana OX=3702 GN=At3g27930 PE=4 SV=1
2310	7095	Q8W106	73.37	12	12	5.72E6	3	3	3	N	47197	AT3g27930/K24A2_2 OS=Arabidopsis thaliana OX=3702 GN=At3g27930 PE=2 SV=1
2310	7096	Q8LGE2	73.37	12	12	5.72E6	3	3	3	N	47205	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2310	7097	A0A384LHR4	73.37	12	12	5.72E6	3	3	3	N	47197	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g30500 PE=4 SV=1
2871	9460	Q8GXV5	73.32	25	25	1.78E7	3	3	3	N	33673	(S)-ureidoglycine aminohydrolase OS=Arabidopsis thaliana OX=3702 GN=UGLYAH PE=1 SV=1
2871	9461	A0A178V1S3	73.32	25	25	1.78E7	3	3	3	N	33688	UGLYAH OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g20120 PE=4 SV=1
1900	6373	A0A178WGZ3	73.16	18	18	2.51E7	4	4	5	N	39496	NDT2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g26170 PE=3 SV=1
1900	6374	Q8RWA5	73.16	18	18	2.51E7	4	4	5	N	39496	Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDT2 PE=1 SV=1
2402	11285	Q66GR6	73.12	18	18	4.84E6	4	3	4	N	29728	Single-stranded DNA-binding protein WHY3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=WHY3 PE=1 SV=1
2402	11286	A0A178VLN3	73.12	18	18	4.84E6	4	3	4	N	29728	WHY3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g01700 PE=4 SV=1
2251	7259	O65686	73.01	50	50	2.2E7	3	3	4	N	12699	30S ribosomal protein S16-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPS16-1 PE=2 SV=1
2251	7260	A0A178UZA3	73.01	50	50	2.2E7	3	3	4	N	12699	SSR16 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g39620 PE=3 SV=1
2120	7953	A8MRV1	72.96	48	48	2.44E7	4	4	4	N	9394	Histone H4 OS=Arabidopsis thaliana OX=3702 GN=At1g07660 PE=1 SV=1
2120	7954	P59259	72.96	40	40	2.44E7	4	4	4	N	11409	Histone H4 OS=Arabidopsis thaliana OX=3702 GN=At1g07660 PE=1 SV=2
2120	7955	A0A384LKZ7	72.96	40	40	2.44E7	4	4	4	N	11409	Histone H4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g07310 PE=3 SV=1
2120	7956	Q6NR90	72.96	40	40	2.44E7	4	4	4	N	11409	Histone H4 OS=Arabidopsis thaliana OX=3702 GN=At1g07660 PE=2 SV=1
2307	5097	Q9AST9	72.91	12	12	5.34E6	4	4	4	N	48325	At1g73110/F3N23_39 OS=Arabidopsis thaliana OX=3702 GN=At1g73110 PE=2 SV=1
2333	5094	Q9SD66	72.87	34	34	1.42E7	3	3	3	N	10530	Thylakoid soluble phosphoprotein OS=Arabidopsis thaliana OX=3702 GN=F13I12.120 PE=1 SV=1
2333	5095	Q94CB6	72.87	34	34	1.42E7	3	3	3	N	10561	Uncharacterized protein At3g47070 OS=Arabidopsis thaliana OX=3702 GN=At3g47070 PE=2 SV=1
1895	5994	A0A178V0W6	72.85	12	12	1.53E7	4	4	4	Y	61290	TIC55-IV OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g29590 PE=4 SV=1
1895	5995	Q8W496	72.85	11	11	1.53E7	4	4	4	Y	63819	Protochlorophyllide-dependent translocon component 52, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PTC52 PE=2 SV=1
2140	5586	Q9LNC5	72.81	7	7	3.3E6	5	5	5	N	110442	110 kDa U5 small nuclear ribonucleoprotein component CLO OS=Arabidopsis thaliana OX=3702 GN=CLO PE=1 SV=1
1396	7862	A0A178UWU5	72.64	21	21	1.73E8	3	3	5	N	13940	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g33860 PE=4 SV=1
1396	7863	Q9M0D5	72.64	21	21	1.73E8	3	3	5	N	13940	AT4g29480/F17A13_300 OS=Arabidopsis thaliana OX=3702 GN=At4g29480 PE=2 SV=1
1956	4332	Q9SZ83	72.63	20	20	1.28E7	5	5	6	N	39562	Uncharacterized oxidoreductase At4g09670 OS=Arabidopsis thaliana OX=3702 GN=At4g09670 PE=1 SV=1
1956	5339	A0A178UWI8	72.63	20	20	1.28E7	5	5	6	N	39516	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g10870 PE=4 SV=1
2209	9554	A0A178VGF4	72.63	38	38	4.04E7	3	3	5	Y	9974	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g05360 PE=4 SV=1
2209	9555	Q9M9M3	72.63	38	38	4.04E7	3	3	5	Y	9974	Defensin-like protein 205 OS=Arabidopsis thaliana OX=3702 GN=At3g05730 PE=3 SV=1
2852	6550	Q9LN50	72.61	7	7	6.33E6	3	3	3	Y	82662	Probable methyltransferase PMT28 OS=Arabidopsis thaliana OX=3702 GN=At1g19430 PE=2 SV=1
2852	6551	A0A178W568	72.61	7	7	6.33E6	3	3	3	Y	82703	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g20390 PE=4 SV=1
1686	3315	Q9LZ23	72.54	12	12	3.49E7	5	5	6	N	33242	ACT domain-containing protein ACR12 OS=Arabidopsis thaliana OX=3702 GN=ACR12 PE=2 SV=1
1686	3316	A0A178UNY1	72.54	12	12	3.49E7	5	5	6	N	33242	ACR12 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g04150 PE=4 SV=1
2187	6898	Q94AU2	72.54	28	28	8.25E6	3	3	4	N	25332	25.3 kDa vesicle transport protein OS=Arabidopsis thaliana OX=3702 GN=SEC22 PE=2 SV=1
2187	6899	A0A178WBU4	72.54	28	28	8.25E6	3	3	4	N	25332	SEC22 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g12250 PE=3 SV=1
1902	7793	A0A178VP66	72.53	17	17	2.59E7	3	3	4	N	41447	PDK OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g06260 PE=4 SV=1
1902	7794	Q9SBJ1	72.53	17	17	2.59E7	3	3	4	N	41447	[Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDK PE=1 SV=1
2436	9481	A0A178WFJ6	72.53	15	15	2.04E6	2	2	3	N	36960	TGD3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g59040 PE=4 SV=1
2436	9482	A0A178WFC3	72.53	15	15	2.04E6	2	2	3	N	37344	TGD3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g59040 PE=4 SV=1
2436	9483	Q9AT00	72.53	14	14	2.04E6	2	2	3	N	37518	Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TGD3 PE=1 SV=1
2499	4218	A0A1P8B279	72.51	15	15	5.02E6	4	4	4	N	53501	ThiaminC OS=Arabidopsis thaliana OX=3702 GN=THIC PE=3 SV=1
2499	4219	A0A178VPK8	72.51	11	11	5.02E6	4	4	4	N	72005	THIC OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g25890 PE=3 SV=1
2499	4220	O82392	72.51	11	11	5.02E6	4	4	4	N	71987	Phosphomethylpyrimidine synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=THIC PE=1 SV=1
1810	5825	Q9FN50	72.38	21	21	4.76E7	4	4	5	N	28816	Protein CHAPERONE-LIKE PROTEIN OF POR1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CPP1 PE=1 SV=1
1810	5826	A0A178UEX5	72.38	21	21	4.76E7	4	4	5	N	28816	CDF1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g22550 PE=4 SV=1
2422	7402	A0A178V153	72.34	30	30	1.81E7	3	3	4	Y	15733	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g12590 PE=3 SV=1
2422	7403	O82499	72.34	30	30	1.81E7	3	3	4	Y	15733	Translation initiation factor IF-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At4g11175 PE=2 SV=2
2744	7475	Q9LUH5	72.19	6	6	3.44E6	3	3	3	N	96138	Mycolic acid methyl transferase-like protein OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2744	8407	A0A178VGS2	72.19	6	6	3.44E6	3	3	3	N	97939	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g25150 PE=4 SV=1
2744	6706	A0A178V8G6	72.19	6	6	3.44E6	3	3	3	N	98120	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g25140 PE=4 SV=1
2744	6707	Q8VZH1	72.19	6	6	3.44E6	3	3	3	N	98062	AT3g23510/MEE5_5 OS=Arabidopsis thaliana OX=3702 GN=At3g23530 PE=2 SV=1
2744	6708	Q8VZE6	72.19	6	6	3.44E6	3	3	3	N	98032	At3g23510/MEE5_5 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2744	6709	Q67YS7	72.19	6	6	3.44E6	3	3	3	N	98063	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2393	108072	Q8L733	72.16	20	20	1.44E7	4	4	4	Y	43528	Putative transferase At4g12130, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g12130 PE=1 SV=1
2240	6585	A0A178VV15	72.14	8	8	5.08E6	3	3	4	Y	64421	PTR2-B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g01070 PE=3 SV=1
2240	6586	P46032	72.14	8	8	5.08E6	3	3	4	Y	64421	Protein NRT1/ PTR FAMILY 8.3 OS=Arabidopsis thaliana OX=3702 GN=NPF8.3 PE=1 SV=1
1780	7531	A0A178W513	72.13	11	11	1.82E6	5	4	5	Y	54573	Phosphotransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g44660 PE=3 SV=1
1780	7532	Q9LPS1	72.13	11	11	1.82E6	5	4	5	Y	54591	Hexokinase-3 OS=Arabidopsis thaliana OX=3702 GN=At1g50460 PE=1 SV=1
2149	4642	A0A178USV9	72.13	9	9	4.44E6	4	4	4	Y	74782	ATERDJ2B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g24510 PE=4 SV=1
2149	4643	F4JIN3	72.13	9	9	4.44E6	4	4	4	Y	74825	DnaJ protein ERDJ2B OS=Arabidopsis thaliana OX=3702 GN=ERDJ2B PE=1 SV=1
2152	8038	A0A1P8B373	72.05	21	21	8.65E6	3	3	3	Y	42412	Plastid transcriptionally active 14 OS=Arabidopsis thaliana OX=3702 GN=PTAC14 PE=4 SV=1
2152	8041	Q84JF5	72.05	16	16	8.65E6	3	3	3	Y	55611	Protein PLASTID TRANSCRIPTIONALLY ACTIVE 14 OS=Arabidopsis thaliana OX=3702 GN=PTAC14 PE=1 SV=1
2152	8042	A0A178V257	72.05	16	16	8.65E6	3	3	3	Y	55645	TAC14 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g23610 PE=4 SV=1
2179	7830	Q9SKR7	71.96	43	43	4.4E7	4	4	4	Y	14143	At2g20940 OS=Arabidopsis thaliana OX=3702 GN=At2g20940 PE=2 SV=1
2179	7831	A0A384KKL9	71.96	43	43	4.4E7	4	4	4	Y	14143	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g16390 PE=4 SV=1
2856	8148	A0A178UMY3	71.95	24	24	1.79E7	3	3	3	N	21715	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g13200 PE=4 SV=1
2856	8149	Q9FKI4	71.95	24	24	1.79E7	3	3	3	N	21715	N-terminal acetyltransferase A complex catalytic subunit NAA10 OS=Arabidopsis thaliana OX=3702 GN=NAA10 PE=1 SV=1
2330	108075	A0A178UUQ9	71.92	12	12	1.53E6	3	3	3	N	49799	Glycylpeptide N-tetradecanoyltransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g56240 PE=3 SV=1
2330	108076	Q9LTR9	71.92	12	12	1.53E6	3	3	3	N	49799	Glycylpeptide N-tetradecanoyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=NMT1 PE=1 SV=2
2154	6405	Q94JT5	71.92	19	19	4.96E6	3	3	3	Y	29988	Cyclase-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=CYCLASE2 PE=2 SV=1
2154	6406	A0A178V1K5	71.92	19	19	4.96E6	3	3	3	Y	29988	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g40250 PE=4 SV=1
2496	3066	A0A1I9LLZ3	71.92	11	11	1.56E7	4	4	4	Y	76328	BED zinc finger and hAT dimerization domain-containing protein DAYSLEEPER OS=Arabidopsis thaliana OX=3702 GN=DAYSLEEPER PE=4 SV=1
2496	3067	Q9M2N5	71.92	11	11	1.56E7	4	4	4	Y	78814	Zinc finger BED domain-containing protein DAYSLEEPER OS=Arabidopsis thaliana OX=3702 GN=HAT PE=1 SV=1
2496	3068	A0A178VJS5	71.92	11	11	1.56E7	4	4	4	Y	78814	DAYSLEEPER OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g33980 PE=4 SV=1
2733	4803	A0A178VHE3	71.88	11	11	4.76E6	3	3	3	N	54912	Proline dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g34710 PE=3 SV=1
2733	4804	P92983	71.88	11	11	4.76E6	3	3	3	N	54956	Proline dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=POX1 PE=1 SV=2
2026	7723	A0A178W040	71.81	13	13	1.74E6	3	2	6	Y	36255	Annexin OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g35640 PE=3 SV=1
2026	7724	Q9SE45	71.81	13	13	1.74E6	3	2	6	Y	36255	Annexin D3 OS=Arabidopsis thaliana OX=3702 GN=ANN3 PE=2 SV=2
2860	8143	Q9FZ88	71.73	14	14	9.84E6	3	3	3	N	30279	F3H9.20 protein OS=Arabidopsis thaliana OX=3702 GN=At1g28140 PE=1 SV=1
2860	8144	A0A178WAV2	71.73	14	14	9.84E6	3	3	3	N	30245	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g28530 PE=4 SV=1
2860	8145	Q9C7E0	71.73	14	14	9.84E6	3	3	3	N	31966	Uncharacterized protein F13K9.23 OS=Arabidopsis thaliana OX=3702 GN=F13K9.23 PE=4 SV=1
2334	8128	Q9GCB9	71.70	27	27	1.12E7	4	4	4	Y	24773	Ribosomal protein S2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RPS2 PE=2 SV=1
2334	8129	A0A384L231	71.70	27	27	1.12E7	4	4	4	Y	24773	RPS2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g02960 PE=4 SV=1
2334	8130	Q0WU50	71.70	27	27	1.12E7	4	4	4	Y	24773	Putative ribosomal protein S2 OS=Arabidopsis thaliana OX=3702 GN=At3g03600 PE=2 SV=1
2062	4290	P82715	71.67	21	21	4.84E7	5	5	5	Y	33365	PsbP domain-containing protein 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPD5 PE=1 SV=3
2062	4282	A0A178U9N5	71.67	20	20	4.84E7	5	5	5	Y	35328	PsbP domain protein (Mog1/PsbP/DUF1795-like photosystem II reaction center PsbP family protein) OS=Arabidopsis thaliana OX=3702 GN=PPD5 PE=4 SV=1
2062	4283	A0A384KVS7	71.67	20	20	4.84E7	5	5	5	Y	35328	PPD5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g11180 PE=4 SV=1
2507	10893	Q2L7C6	71.67	12	12	4.52E6	3	3	3	Y	38058	Gamma-tocopherol methyltransferase OS=Arabidopsis thaliana OX=3702 GN=TMT PE=2 SV=1
2507	10894	Q9ZSK1	71.67	12	12	4.52E6	3	3	3	Y	38075	Tocopherol O-methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=VTE4 PE=1 SV=2
2532	10216	A0A178VDJ0	71.66	20	20	4.24E6	3	3	3	N	26892	Superoxide dismutase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g50980 PE=3 SV=1
2532	10217	Q9LYK8	71.66	20	20	4.24E6	3	3	3	N	26892	Superoxide dismutase [Mn] 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MSD2 PE=2 SV=1
2449	108152	A0A178W7E3	71.57	5	5	1.94E6	2	2	2	Y	58067	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g26160 PE=4 SV=1
2449	108153	Q682P6	71.57	5	5	1.94E6	2	2	2	Y	58067	Metallo-hydrolase/oxidoreductase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g25375 PE=2 SV=1
2449	14101	Q9FRI6	71.57	4	4	1.94E6	2	2	2	Y	87670	Uncharacterized protein F4F7.24 OS=Arabidopsis thaliana OX=3702 GN=F4F7.24 PE=4 SV=3
1965	4603	A0A178WHK1	71.53	29	29	2.27E7	5	5	5	Y	33685	CDSP32 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g70530 PE=4 SV=1
1965	4604	Q9SGS4	71.53	29	29	2.27E7	5	5	5	Y	33685	Thioredoxin-like protein CDSP32, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CDSP32 PE=1 SV=1
2019	9335	Q93ZC5	71.51	18	18	3.03E7	4	3	5	Y	27809	Allene oxide cyclase 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AOC4 PE=2 SV=1
2312	6365	A0A178VWV5	71.47	5	5	7.5E6	3	3	3	N	109963	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g21650 PE=4 SV=1
2312	6366	Q0WQB7	71.47	5	5	7.5E6	3	3	3	N	109963	Elongation factor Ts (DUF810) OS=Arabidopsis thaliana OX=3702 GN=At2g25800 PE=2 SV=1
2312	6367	O82317	71.47	5	5	7.5E6	3	3	3	N	110550	Uncharacterized protein At2g25800 OS=Arabidopsis thaliana OX=3702 GN=At2g25800 PE=4 SV=1
2743	9394	O48815	71.45	14	14	5.44E6	3	3	3	N	47351	At2g39670/F17A14.4 OS=Arabidopsis thaliana OX=3702 GN=At2g39670 PE=2 SV=2
2743	9395	A0A178W0C3	71.45	14	14	5.44E6	3	3	3	N	47351	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g36580 PE=3 SV=1
2873	59634	Q56YA7	71.37	30	30	1.55E7	3	3	3	N	18295	Uncharacterized protein At5g62140 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At5g62140 PE=2 SV=1
2873	10156	A0A178UKA6	71.37	21	21	1.55E7	3	3	3	N	26443	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g61630 PE=4 SV=1
2873	10157	Q9FIS4	71.37	21	21	1.55E7	3	3	3	N	26439	ATP-dependent Clp protease ATP-binding subunit OS=Arabidopsis thaliana OX=3702 GN=MTG10.17 PE=2 SV=1
2242	7009	Q8LGF7	71.37	33	33	8.72E6	3	3	3	Y	17708	Protein PEROXIN-4 OS=Arabidopsis thaliana OX=3702 GN=PEX4 PE=1 SV=1
2161	3405	A0A178VIB0	71.34	11	11	1.14E7	4	2	4	Y	64299	Hexosyltransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g27140 PE=3 SV=1
2161	3406	Q9LSG3	71.34	11	11	1.14E7	4	2	4	Y	64368	Galacturonosyltransferase 8 OS=Arabidopsis thaliana OX=3702 GN=GAUT8 PE=1 SV=1
2161	3407	W8PVC6	71.34	11	11	1.14E7	4	2	4	Y	64368	Hexosyltransferase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT3G25140 PE=2 SV=1
2124	5348	A0A178WF48	71.33	17	17	3.3E7	3	3	5	N	36539	KV-BETA1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g04030 PE=4 SV=1
2124	5349	O23016	71.33	17	17	3.3E7	3	3	5	N	36539	Probable voltage-gated potassium channel subunit beta OS=Arabidopsis thaliana OX=3702 GN=KAB1 PE=1 SV=1
2329	3635	Q9LN62	71.29	16	16	1.53E7	4	4	4	Y	48251	Arabinosyltransferase RRA3 OS=Arabidopsis thaliana OX=3702 GN=RRA3 PE=2 SV=1
2329	3636	A0A178WBS7	71.29	16	16	1.53E7	4	4	4	Y	48251	Glycosyltransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g20300 PE=3 SV=1
2887	8273	A0A178UKD0	71.28	16	16	8.15E6	3	2	3	N	24842	RABA4a OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g65060 PE=4 SV=1
2887	8274	Q9FJN8	71.28	16	16	8.15E6	3	2	3	N	24842	Ras-related protein RABA4a OS=Arabidopsis thaliana OX=3702 GN=RABA4A PE=1 SV=1
2863	10429	Q9SRP6	71.26	29	29	1.04E7	3	3	3	Y	21798	Mitochondrial inner membrane protease ATP23 OS=Arabidopsis thaliana OX=3702 GN=At3g03420 PE=1 SV=1
2863	10430	A0A384L4E1	71.26	29	29	1.04E7	3	3	3	Y	21798	Mitochondrial inner membrane protease ATP23 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g02780 PE=1 SV=1
1781	6617	Q9LSE4	71.16	15	15	4.32E7	5	5	6	N	30101	Protein COFACTOR ASSEMBLY OF COMPLEX C SUBUNIT B CCB1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CCB1 PE=1 SV=1
1781	6618	A0A178VJY5	71.16	15	15	4.32E7	5	5	6	N	30101	CCB1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g29030 PE=4 SV=1
2305	4997	Q8RWC3	71.15	11	11	1.87E7	4	4	4	N	56788	Aminopeptidase (DUF3754) OS=Arabidopsis thaliana OX=3702 GN=At3g19340 PE=2 SV=1
2305	4998	A0A178VM20	71.15	11	11	1.87E7	4	4	4	N	56811	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g20550 PE=4 SV=1
2305	4999	Q9LT83	71.15	11	11	1.87E7	4	4	4	N	60205	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2763	4597	A0A178WLL7	71.13	9	9	2.99E6	2	2	2	N	37754	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g47030 PE=4 SV=1
2763	4598	Q9SSS7	71.13	9	9	2.99E6	2	2	2	N	37754	AT1G52730 protein OS=Arabidopsis thaliana OX=3702 GN=At1g52730 PE=2 SV=1
2339	59587	A0A1P8AZM5	71.12	33	33	3.21E7	4	4	4	N	24332	Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g32520 PE=4 SV=1
2339	59589	A0A178VSK1	71.12	31	31	3.21E7	4	4	4	N	25921	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g28860 PE=4 SV=1
2339	59588	Q8LDC7	71.12	31	31	3.21E7	4	4	4	N	25893	Putative carboxymethylenebutenolidase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2339	59590	O80889	71.12	31	31	3.21E7	4	4	4	N	25921	Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g32520 PE=2 SV=1
2339	59591	A0A1P8AZP9	71.12	27	27	3.21E7	4	4	4	N	30037	Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g32520 PE=4 SV=1
2339	59592	A0A1P8AZN3	71.12	23	23	3.21E7	4	4	4	N	34720	Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g32520 PE=4 SV=1
2361	7918	F4I8H5	71.07	18	18	1.3E7	2	2	3	N	18591	Cobalt ion binding protein OS=Arabidopsis thaliana OX=3702 GN=RAD52-1 PE=4 SV=1
2361	7919	A0A178W7V2	71.07	18	18	1.3E7	2	2	3	N	18591	RAD52-1B.2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g65520 PE=4 SV=1
2361	5947	A0A178W7H6	71.07	17	17	1.3E7	2	2	3	N	19484	RAD52-1B.2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g65520 PE=4 SV=1
2361	5948	Q9FVV7	71.07	17	17	1.3E7	2	2	3	N	19484	DNA repair RAD52-like protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RAD52-1 PE=1 SV=1
2054	1926	C0SVF3	71.03	14	14	2.13E7	5	5	5	Y	63027	Uncharacterized protein At3g57150 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At3g57150 PE=2 SV=1
2054	1927	A0A384LF80	71.03	14	14	2.13E7	5	5	5	Y	63027	NAP57 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g51730 PE=4 SV=1
2054	1928	Q9LD90	71.03	14	14	2.13E7	5	5	5	Y	63027	H/ACA ribonucleoprotein complex subunit 4 OS=Arabidopsis thaliana OX=3702 GN=CBF5 PE=1 SV=1
2000	6418	F4I0L1	70.88	16	16	1.11E7	5	5	5	N	42914	Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At1g69250 PE=1 SV=1
2000	6419	Q9LDI9	70.88	14	14	1.11E7	5	5	5	N	46675	At1g69250 OS=Arabidopsis thaliana OX=3702 GN=F23O10.17 PE=1 SV=1
2000	7924	A0A178WM82	70.88	14	14	1.11E7	5	5	5	N	46661	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g63300 PE=4 SV=1
2299	59645	F4JTJ6	70.87	5	5	1.68E6	3	2	3	N	86978	Pantothenate kinase 2 OS=Arabidopsis thaliana OX=3702 GN=PANK2 PE=1 SV=1
2299	59522	Q8L5Y9	70.87	5	5	1.68E6	3	2	3	N	99640	Pantothenate kinase 2 OS=Arabidopsis thaliana OX=3702 GN=PANK2 PE=1 SV=2
2299	59521	A0A178V4D0	70.87	5	5	1.68E6	3	2	3	N	99640	Pantothenate kinase 2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g36860 PE=3 SV=1
2119	8966	B3H745	70.85	5	5	1.5E6	2	2	2	Y	66733	ENHANCED DISEASE RESISTANCE protein (DUF1336) OS=Arabidopsis thaliana OX=3702 GN=At5g35180 PE=1 SV=1
2119	9011	Q8W553	70.85	4	4	1.5E6	2	2	2	Y	87029	AT5g35180/T25C13_60 OS=Arabidopsis thaliana OX=3702 GN=At5g35180 PE=1 SV=1
2119	10962	A0A178UL44	70.85	4	4	1.5E6	2	2	2	Y	86927	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g31350 PE=4 SV=1
2119	10963	A0A178UKI1	70.85	4	4	1.5E6	2	2	2	Y	86957	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g31350 PE=4 SV=1
2119	9012	B3H5W6	70.85	4	4	1.5E6	2	2	2	Y	86999	AT5G35180 protein OS=Arabidopsis thaliana OX=3702 GN=At5g35180 PE=1 SV=1
2119	9013	A0A1P8BH65	70.85	4	4	1.5E6	2	2	2	Y	87549	ENHANCED DISEASE RESISTANCE protein (DUF1336) OS=Arabidopsis thaliana OX=3702 GN=At5g35180 PE=1 SV=1
2119	9025	F4JYC1	70.85	3	3	1.5E6	2	2	2	Y	90932	ENHANCED DISEASE RESISTANCE protein (DUF1336) OS=Arabidopsis thaliana OX=3702 GN=At5g35180 PE=1 SV=1
2731	7460	Q9M7Q7	70.76	19	19	1.64E7	3	3	3	N	29122	Proliferating cellular nuclear antigen 1 OS=Arabidopsis thaliana OX=3702 GN=PCNA PE=1 SV=2
2731	7461	A0A178W9N0	70.76	19	19	1.64E7	3	3	3	N	29122	Proliferating cell nuclear antigen OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g07000 PE=3 SV=1
2731	7462	Q9ZW35	70.76	19	19	1.64E7	3	3	3	N	29222	Proliferating cell nuclear antigen 2 OS=Arabidopsis thaliana OX=3702 GN=PCNA2 PE=1 SV=1
2731	7463	A0A178VSR5	70.76	19	19	1.64E7	3	3	3	N	29222	Proliferating cell nuclear antigen OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g25650 PE=3 SV=1
1957	9117	Q8RUI8	70.70	18	18	1.58E7	5	5	5	Y	44852	C5orf35 OS=Arabidopsis thaliana OX=3702 GN=MKD15.6 PE=1 SV=1
1957	9119	Q9FMY0	70.70	16	16	1.58E7	5	5	5	Y	49140	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2412	6609	Q9M1E7	70.67	15	15	8.95E6	3	3	3	N	31888	Tetraspanin-3 OS=Arabidopsis thaliana OX=3702 GN=TET3 PE=1 SV=1
2412	6610	A0A178VNK4	70.67	15	15	8.95E6	3	3	3	N	31876	TET3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g39420 PE=3 SV=1
1764	4287	Q94AW2	70.66	13	13	9.72E6	4	4	6	N	59777	At5g39590/MIJ24_60 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1764	4288	A0A178UH81	70.66	13	13	9.72E6	4	4	6	N	59909	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g37040 PE=4 SV=1
1764	4289	Q9FKA3	70.66	13	13	9.72E6	4	4	6	N	59909	TLD-domain containing nucleolar protein OS=Arabidopsis thaliana OX=3702 GN=MIJ24.8 PE=4 SV=1
2061	5936	Q9LR44	70.63	10	10	1.52E7	3	3	3	N	52814	UDP-glycosyltransferase 75B1 OS=Arabidopsis thaliana OX=3702 GN=UGT75B1 PE=1 SV=1
2061	5937	A0A384LJH7	70.63	10	10	1.52E7	3	3	3	N	52814	Glycosyltransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g05000 PE=3 SV=1
2061	5938	W8QPC2	70.63	10	10	1.52E7	3	3	3	N	52814	Glycosyltransferase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT1G05560 PE=2 SV=1
2061	5953	A0A1P8AP70	70.63	9	9	1.52E7	3	3	3	N	58585	Glycosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGT75B1 PE=3 SV=1
2510	6884	Q7XA88	70.51	19	19	1.15E7	4	2	4	N	29026	At3g59500 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2510	6885	Q9M1B7	70.51	19	19	1.15E7	4	2	4	N	29056	Uncharacterized protein T16L24.50 OS=Arabidopsis thaliana OX=3702 GN=T16L24.50 PE=4 SV=1
2510	6841	A0A384KJM4	70.51	18	18	1.15E7	4	2	4	N	30174	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g53920 PE=4 SV=1
2510	6842	F4J8C0	70.51	18	18	1.15E7	4	2	4	N	30174	HRF1 protein OS=Arabidopsis thaliana OX=3702 GN=HRF1 PE=2 SV=1
2510	6843	Q0WT16	70.51	18	18	1.15E7	4	2	4	N	30144	Uncharacterized protein At3g59500 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2005	4674	Q9SI07	70.39	10	10	1.63E7	5	5	5	Y	64560	At2g04280 OS=Arabidopsis thaliana OX=3702 GN=AT2G04280.1 PE=2 SV=1
2005	4675	A0A178VYI8	70.39	10	10	1.63E7	5	5	5	Y	64546	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g03380 PE=4 SV=1
3210	10885	P11829	70.38	14	14	6.81E6	2	2	2	N	15055	Acyl carrier protein 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ACP1 PE=1 SV=1
3210	10886	A0A384LIE6	70.38	14	14	6.81E6	2	2	2	N	15055	Acyl carrier protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g04510 PE=3 SV=1
3210	10887	Q0WT41	70.38	14	14	6.81E6	2	2	2	N	15055	Acyl carrier protein OS=Arabidopsis thaliana OX=3702 GN=At3g05020 PE=2 SV=1
2074	6983	Q9FFS0	70.36	14	14	1.44E7	3	2	4	N	28949	Reticulon-like protein B4 OS=Arabidopsis thaliana OX=3702 GN=RTNLB4 PE=1 SV=1
2074	6984	A0A178UBJ5	70.36	14	14	1.44E7	3	2	4	N	28949	Reticulon-like protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g39360 PE=4 SV=1
2235	8050	A0A178UNE3	70.35	9	9	2.34E6	3	2	3	Y	54830	BSK5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g58400 PE=4 SV=1
2235	6471	Q9FIL1	70.35	9	9	2.34E6	3	2	3	Y	54854	Serine/threonine-protein kinase BSK5 OS=Arabidopsis thaliana OX=3702 GN=BSK5 PE=1 SV=1
2281	5637	A0A178VY11	70.30	4	4	2.93E6	4	4	4	Y	217404	MOR1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g32240 PE=4 SV=1
2281	5638	A0A178VWV1	70.30	4	4	2.93E6	4	4	4	Y	217532	MOR1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g32240 PE=4 SV=1
2281	5639	Q94FN2	70.30	4	4	2.93E6	4	4	4	Y	217548	Protein MOR1 OS=Arabidopsis thaliana OX=3702 GN=MOR1 PE=1 SV=1
1834	8577	A0A178WGM0	70.20	42	42	3.81E7	3	3	4	N	9062	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g00180 PE=4 SV=1
1834	8578	Q2HIQ2	70.20	42	42	3.81E7	3	3	4	N	9062	At1g01170 OS=Arabidopsis thaliana OX=3702 GN=At1g01170 PE=2 SV=1
1834	8579	Q8GXJ9	70.20	42	42	3.81E7	3	3	4	N	9078	Uncharacterized protein At1g01170/F6F3_5 OS=Arabidopsis thaliana OX=3702 GN=At1g01170/F6F3_5 PE=2 SV=1
1959	4412	Q9S713	70.16	9	9	1.69E7	4	4	5	Y	63252	Serine/threonine-protein kinase STN7, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=STN7 PE=1 SV=1
1959	4413	A0A178W9J0	70.16	9	9	1.69E7	4	4	5	Y	63252	STN7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g62920 PE=4 SV=1
2504	6015	A0A178U8N7	70.15	22	22	6.69E6	4	3	4	Y	31431	HIR4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g62280 PE=4 SV=1
2504	6016	Q9FM19	70.15	22	22	6.69E6	4	3	4	Y	31431	Hypersensitive-induced response protein 1 OS=Arabidopsis thaliana OX=3702 GN=HIR1 PE=1 SV=1
2118	5976	A8MQL0	69.90	28	28	3.47E7	3	3	5	N	18146	Ribosomal protein PSRP-3/Ycf65 OS=Arabidopsis thaliana OX=3702 GN=PSRP3 PE=4 SV=1
2118	5977	A0A178W6Q0	69.90	28	28	3.47E7	3	3	5	N	18472	PSRP3/1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g62650 PE=4 SV=1
2118	5978	Q9SX22	69.90	28	28	3.47E7	3	3	5	N	18472	30S ribosomal protein 3-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g68590 PE=2 SV=1
2357	6188	A0A078	69.90	4	4	6.47E6	2	2	2	N	97568	Endomembrane Ca2+ ATPase 2 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=ECA2 PE=2 SV=1
2357	6189	O23087	69.90	3	3	6.47E6	2	2	2	N	115830	Calcium-transporting ATPase 2, endoplasmic reticulum-type OS=Arabidopsis thaliana OX=3702 GN=ECA2 PE=1 SV=1
2357	6190	A0A178UYB0	69.90	3	3	6.47E6	2	2	2	N	115984	ECA2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g01140 PE=3 SV=1
2348	9061	Q8LGK3	69.80	12	12	1.68E7	3	3	4	Y	44092	Phospholipid scramblase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2348	9062	A0A178VVF1	69.80	12	12	1.68E7	3	3	4	Y	44108	Phospholipid scramblase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g04150 PE=3 SV=1
2348	9063	Q9SI32	69.80	12	12	1.68E7	3	3	4	Y	44122	Phospholipid scramblase OS=Arabidopsis thaliana OX=3702 GN=At2g04940 PE=2 SV=1
1961	5325	A0A178W8U4	69.77	28	28	8.68E6	5	3	6	Y	23457	RABC1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g39950 PE=4 SV=1
1961	5326	O23657	69.77	28	28	8.68E6	5	3	6	Y	23531	Ras-related protein RABC1 OS=Arabidopsis thaliana OX=3702 GN=RABC1 PE=1 SV=1
2017	5393	A0A384LII2	69.74	18	18	9.74E6	3	3	4	N	25039	VAMP711 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g36820 PE=3 SV=1
2017	5394	O49377	69.74	18	18	9.74E6	3	3	4	N	25039	Vesicle-associated membrane protein 711 OS=Arabidopsis thaliana OX=3702 GN=VAMP711 PE=1 SV=2
2017	5395	Q0WWE7	69.74	18	18	9.74E6	3	3	4	N	25039	Vesicle-associated membrane protein 7C OS=Arabidopsis thaliana OX=3702 GN=At4g32150 PE=2 SV=1
2296	8854	Q9C8L9	69.69	11	11	3.89E6	3	3	4	N	56919	At1g53640/F22G10.8 OS=Arabidopsis thaliana OX=3702 GN=F22G10.8 PE=2 SV=1
2296	8855	Q8LA02	69.69	11	11	3.89E6	3	3	4	N	56949	Contains similarity to RNA-binding protein from Arabidopsis thaliana gi\|2129727 and contains RNA recognition PF\|00076 domain OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2296	8856	Q9LPI3	69.69	7	7	3.89E6	3	3	4	N	91197	T3F20.1 protein OS=Arabidopsis thaliana OX=3702 GN=T3F20.1 PE=4 SV=1
2296	8857	A0A178WCM2	69.69	11	11	3.89E6	3	3	4	N	56950	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g48080 PE=4 SV=1
2311	5268	Q9LUC8	69.54	10	10	1.63E6	3	2	3	N	58459	Cytochrome P450 72A13 OS=Arabidopsis thaliana OX=3702 GN=CYP72A13 PE=2 SV=1
2311	5269	A0A178VDY1	69.54	10	10	1.63E6	3	2	3	N	58455	CYP72A13 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g15290 PE=4 SV=1
2167	3299	F4IIU4	69.53	3	3	6.93E5	3	3	3	N	186861	187-kDa microtubule-associated protein AIR9 OS=Arabidopsis thaliana OX=3702 GN=AIR9 PE=1 SV=1
2167	3300	A0A1P8B0X3	69.53	3	3	6.93E5	3	3	3	N	194132	Outer arm dynein light chain 1 protein OS=Arabidopsis thaliana OX=3702 GN=AIR9 PE=1 SV=1
1718	2777	A0A178W3N8	69.53	12	12	1.05E7	4	4	5	N	47803	RPT1A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g48180 PE=3 SV=1
1718	2778	Q9SSB5	69.53	12	12	1.05E7	4	4	5	N	47803	26S proteasome regulatory subunit 7 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPT1A PE=1 SV=1
2197	6688	A0A178VR57	69.47	14	14	1.45E7	3	3	4	N	26405	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g32450 PE=4 SV=1
2197	6689	Q9ZQQ1	69.47	14	14	1.45E7	3	3	4	N	26415	Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g35790 PE=2 SV=1
2526	59274	A0A178VIY7	69.43	20	20	2.57E6	3	3	3	Y	29652	MES10 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g44630 PE=4 SV=1
2526	59275	Q8S9K8	69.43	19	19	2.57E6	3	3	3	Y	31358	Methylesterase 10 OS=Arabidopsis thaliana OX=3702 GN=MES10 PE=2 SV=1
2526	59276	A0A178VHC1	69.43	18	18	2.57E6	3	3	3	Y	32994	MES10 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g44630 PE=4 SV=1
2792	11314	F4K0U3	69.43	14	14	1.19E7	2	2	3	N	34372	RP non-ATPase subunit 8A OS=Arabidopsis thaliana OX=3702 GN=RPN8A PE=4 SV=1
2792	9324	O24412	69.43	14	14	1.19E7	2	2	3	N	34728	26S proteasome non-ATPase regulatory subunit 7 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPN8A PE=1 SV=1
1920	5384	Q9SZR1	69.39	4	4	4.35E6	2	2	2	Y	116858	Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=ACA10 PE=1 SV=2
1920	5385	A0A178USL9	69.39	4	4	4.35E6	2	2	2	Y	116844	Calcium-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g34290 PE=3 SV=1
2793	9415	A0A178VD35	69.37	25	25	1.4E7	2	2	3	Y	14129	GRP4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g25730 PE=4 SV=1
2793	9416	Q9LIS2	69.37	25	25	1.4E7	2	2	3	Y	14129	Glycine-rich RNA-binding protein 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RBG4 PE=2 SV=1
2673	8384	O80476	69.35	12	12	5.02E6	2	2	2	N	29667	Methylesterase 2 OS=Arabidopsis thaliana OX=3702 GN=MES2 PE=1 SV=1
2673	8385	A0A178VS91	69.35	12	12	5.02E6	2	2	2	N	29637	MES2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g19250 PE=4 SV=1
2673	8386	A0A1P8AXQ5	69.35	12	12	5.02E6	2	2	2	N	31400	Acetone-cyanohydrin lyase OS=Arabidopsis thaliana OX=3702 GN=ACL PE=4 SV=1
2497	2216	Q8W4L3	69.35	9	9	5.8E6	4	3	4	Y	54914	Serine/threonine-protein kinase BSK3 OS=Arabidopsis thaliana OX=3702 GN=BSK3 PE=1 SV=1
2497	2623	A0A178V3B2	69.35	9	9	5.8E6	4	3	4	Y	54898	BSK3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g00890 PE=4 SV=1
2206	108201	F4J378	69.34	16	16	4.4E7	2	2	5	Y	25985	Histone deacetylase 3 OS=Arabidopsis thaliana OX=3702 GN=HDA3 PE=1 SV=1
2206	108202	Q9FVE6	69.34	16	16	4.4E7	2	2	5	Y	26372	Histone deacetylase HDT1 OS=Arabidopsis thaliana OX=3702 GN=HDT1 PE=1 SV=1
2545	108124	Q682I1	69.33	24	24	9.16E6	2	2	2	N	17672	Protein BOLA1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=BOLA1 PE=1 SV=1
2545	108125	A0A178WRD0	69.33	24	24	9.16E6	2	2	2	N	17672	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g50430 PE=3 SV=1
2285	5523	A0A178WNS4	69.30	9	9	3.1E6	3	3	3	N	39158	UGE1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g13190 PE=3 SV=1
2285	5524	Q42605	69.30	9	9	3.1E6	3	3	3	N	39158	Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 OS=Arabidopsis thaliana OX=3702 GN=UGE1 PE=1 SV=2
2314	4889	A0A178UU47	69.29	7	7	4.47E6	2	2	2	Y	51675	GNTI OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g43590 PE=4 SV=1
2314	4888	Q9XGM8	69.29	7	7	4.47E6	2	2	2	Y	51634	Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Arabidopsis thaliana OX=3702 GN=GNTI PE=1 SV=1
2314	4890	W8Q2W3	69.29	7	7	4.47E6	2	2	2	Y	51634	Glycosyltransferase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT4G38240 PE=2 SV=1
2867	8117	Q9LVA4	69.24	27	27	1.76E7	3	3	3	Y	22179	Plant invertase/pectin methylesterase inhibitor superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MMI9.21 PE=2 SV=1
2867	8118	Q8L8T0	69.24	27	27	1.76E7	3	3	3	Y	22221	Ripening-related protein-like OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2867	8119	A0A178UCF3	69.24	27	27	1.76E7	3	3	3	Y	22179	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g61880 PE=4 SV=1
2523	59426	Q9C9Z9	69.20	8	8	3.56E6	3	3	3	N	59889	Glycosyltransferase-like KOBITO 1 OS=Arabidopsis thaliana OX=3702 GN=ELD1 PE=1 SV=1
2523	59427	A0A178V9W7	69.20	8	8	3.56E6	3	3	3	N	59889	KOB1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g08120 PE=4 SV=1
2171	8215	A0A178UKU6	69.09	14	14	1.2E7	4	4	5	N	49684	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g50590 PE=4 SV=1
2171	8216	Q8GXE5	69.09	14	14	1.2E7	4	4	5	N	49658	Peptidase family M48 family protein OS=Arabidopsis thaliana OX=3702 GN=MIO24.13 PE=2 SV=1
2171	8217	Q9FLI5	69.09	13	13	1.2E7	4	4	5	N	54639	Peptidase family M48 family protein OS=Arabidopsis thaliana OX=3702 GN=MIO24.13 PE=4 SV=1
1652	59278	P42792	69.07	11	11	1.56E8	3	3	5	N	44291	Cytochrome b OS=Arabidopsis thaliana OX=3702 GN=MT-CYB PE=2 SV=2
1652	59277	A0A2P2CLG2	69.07	11	11	1.56E8	3	3	5	N	44281	Cytochrome b OS=Arabidopsis thaliana OX=3702 GN=cob PE=3 SV=2
1872	2801	Q9LTB2	69.07	6	6	5.05E6	4	4	4	N	118716	Methionine S-methyltransferase OS=Arabidopsis thaliana OX=3702 GN=MMT1 PE=1 SV=1
1872	2802	A0A178U9P4	69.07	6	6	5.05E6	4	4	4	N	118718	Methionine S-methyltransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g48650 PE=3 SV=1
2550	108137	O49634	69.07	4	4	1.81E6	3	2	3	Y	109025	Uncharacterized protein AT4g22290 OS=Arabidopsis thaliana OX=3702 GN=At4g22290 PE=4 SV=1
2282	59280	A0A178UP64	69.05	9	9	1.35E7	3	3	3	Y	58148	NAD(P)H-hydrate epimerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g48820 PE=3 SV=1
2282	59281	Q9LTX3	69.05	9	9	1.35E7	3	3	3	Y	59376	Pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPOX1 PE=1 SV=1
2858	9003	A0A1P8AUF5	69.01	19	19	2.68E6	3	3	3	Y	22884	Histidine biosynthesis bifunctional protein (HISIE) OS=Arabidopsis thaliana OX=3702 GN=AT-IE PE=4 SV=1
2858	9015	A0A178WI36	69.01	16	16	2.68E6	3	3	3	Y	26946	HISN2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g32490 PE=3 SV=1
2858	9026	O82768	69.01	14	14	2.68E6	3	3	3	Y	31668	Histidine biosynthesis bifunctional protein hisIE, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HISN2 PE=1 SV=1
2035	10925	Q9LXJ2	68.98	32	32	8.24E7	3	3	5	N	8449	Ubiquinol--cytochrome-c reductase-like protein OS=Arabidopsis thaliana OX=3702 GN=F3C22_130 PE=2 SV=1
2035	10926	A0A384KNL2	68.98	32	32	8.24E7	3	3	5	N	8449	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g47160 PE=4 SV=1
2343	7535	Q8LD27	68.88	15	15	1.96E7	3	3	4	N	25151	Proteasome subunit beta type-6 OS=Arabidopsis thaliana OX=3702 GN=PBA1 PE=1 SV=2
2343	7536	A0A178V2B3	68.88	15	15	1.96E7	3	3	4	N	25151	Proteasome subunit beta OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g35830 PE=3 SV=1
2343	7537	F4JRY2	68.88	15	15	1.96E7	3	3	4	N	25280	Proteasome subunit beta OS=Arabidopsis thaliana OX=3702 GN=PBA1 PE=3 SV=1
2145	2662	Q9LX66	68.87	6	6	1.52E6	4	2	4	N	91468	Receptor-like protein kinase HERK 1 OS=Arabidopsis thaliana OX=3702 GN=HERK1 PE=1 SV=1
1817	4623	F4IZ56	68.85	39	39	2.76E7	4	4	6	Y	33350	Initiation factor 4F subunit (DUF1350) OS=Arabidopsis thaliana OX=3702 GN=At3g43540 PE=4 SV=1
1817	4632	Q9M236	68.85	31	31	2.76E7	4	4	6	Y	40979	Initiation factor 4F subunit (DUF1350) OS=Arabidopsis thaliana OX=3702 GN=T18D12_110 PE=2 SV=1
2400	5249	A0A178W7H4	68.84	16	16	6.13E6	4	4	4	Y	48672	HCAR OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g03930 PE=4 SV=1
2400	5250	Q8GS60	68.84	15	15	6.13E6	4	4	4	Y	51662	7-hydroxymethyl chlorophyll a reductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HCAR PE=1 SV=1
3253	9433	A0A1I9LP56	68.79	67	67	2.85E7	2	2	2	N	5129	ATP synthase E chain OS=Arabidopsis thaliana OX=3702 GN=At3g01130 PE=1 SV=1
3253	9434	A0A1I9LP53	68.79	65	65	2.85E7	2	2	2	N	5257	ATP synthase E chain OS=Arabidopsis thaliana OX=3702 GN=At3g01130 PE=1 SV=1
3253	9435	F4J2A7	68.79	64	64	2.85E7	2	2	2	N	5217	ATP synthase E chain OS=Arabidopsis thaliana OX=3702 GN=At3g01130 PE=1 SV=1
3253	9436	Q8LDZ3	68.79	64	64	2.85E7	2	2	2	N	5189	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3253	9437	A0A384KSC3	68.79	60	60	2.85E7	2	2	2	N	5547	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g00150 PE=1 SV=1
3253	9438	Q9MAC4	68.79	60	60	2.85E7	2	2	2	N	5547	ATP synthase E chain OS=Arabidopsis thaliana OX=3702 GN=At3g01130 PE=1 SV=1
3253	9439	B9DH79	68.79	60	60	2.85E7	2	2	2	N	5605	AT3G01130 protein OS=Arabidopsis thaliana OX=3702 GN=At3g01130 PE=2 SV=1
3253	9440	A0A1I9LP52	68.79	51	51	2.85E7	2	2	2	N	6683	ATP synthase E chain OS=Arabidopsis thaliana OX=3702 GN=At3g01130 PE=1 SV=1
2064	4728	Q9ZUG4	68.77	21	21	1.49E7	5	5	5	Y	39612	Methylthioribose-1-phosphate isomerase OS=Arabidopsis thaliana OX=3702 GN=At2g05830 PE=1 SV=2
2064	4729	A0A178VTR7	68.77	21	21	1.49E7	5	5	5	Y	39604	Methylthioribose-1-phosphate isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g04890 PE=3 SV=1
2758	5646	A0A178UI51	68.75	6	6	4.74E6	3	2	3	Y	75601	HIPL2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g62170 PE=4 SV=1
2758	5647	Q94F08	68.75	6	6	4.74E6	3	2	3	Y	75617	HIPL2 protein OS=Arabidopsis thaliana OX=3702 GN=HIPL2 PE=2 SV=2
2392	6301	B9DFK5	68.65	15	15	1.06E7	4	4	4	Y	46629	Protein RETICULATA, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RE PE=1 SV=1
2392	6302	A0A178VQ99	68.65	15	15	1.06E7	4	4	4	Y	46595	LCD1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g34690 PE=4 SV=1
2273	11644	A8MQH0	68.63	64	64	5.69E7	2	2	5	N	5262	ATP synthase E chain OS=Arabidopsis thaliana OX=3702 GN=At5g15320 PE=4 SV=1
2273	11645	Q8GXE7	68.63	60	60	5.69E7	2	2	5	N	5603	ATP synthase E chain OS=Arabidopsis thaliana OX=3702 GN=At5g15320 PE=2 SV=1
2273	11646	A0A178UC17	68.63	60	60	5.69E7	2	2	5	N	5603	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g14840 PE=4 SV=1
2273	11647	Q9LXF0	68.63	43	43	5.69E7	2	2	5	N	7948	Uncharacterized protein F8M21_210 OS=Arabidopsis thaliana OX=3702 GN=F8M21_210 PE=4 SV=1
2500	3829	A0A178VRN2	68.59	28	28	6.83E6	4	4	4	Y	20587	RD2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g17150 PE=1 SV=1
2500	3830	Q9SIJ8	68.59	28	28	6.83E6	4	4	4	Y	20587	Adenine nucleotide alpha hydrolases-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=RD2 PE=1 SV=2
2500	4619	Q94II5	68.59	27	27	6.83E6	4	4	4	Y	21253	Adenine nucleotide alpha hydrolases-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=RD2 PE=1 SV=1
2151	7205	A0A178VQ50	68.55	15	15	8.66E5	3	2	3	N	39959	PTI1-4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g44810 PE=3 SV=1
2151	7206	O80719	68.55	15	15	8.66E5	3	2	3	N	39931	Probable receptor-like protein kinase At2g47060 OS=Arabidopsis thaliana OX=3702 GN=At2g47060 PE=1 SV=1
2044	6657	Q9FFZ5	68.47	4	4	7.38E5	2	2	2	N	89645	Gb\|AAF00669.1 OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2044	6662	A0A178UBE5	68.47	4	4	7.38E5	2	2	2	N	92500	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g05730 PE=4 SV=1
2044	6665	F4K2D8	68.47	4	4	7.38E5	2	2	2	N	92407	LETM1-like protein OS=Arabidopsis thaliana OX=3702 GN=MBL20.10 PE=4 SV=1
2044	6677	A0A1P8B9X6	68.47	4	4	7.38E5	2	2	2	N	98399	LETM1-like protein OS=Arabidopsis thaliana OX=3702 GN=MBL20.10 PE=4 SV=1
1775	6974	Q949S6	68.41	19	19	6.51E7	3	3	5	Y	21224	NAD(P)-linked oxidoreductase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g14345 PE=2 SV=1
1775	6975	A0A178WEL2	68.41	19	19	6.51E7	3	3	5	Y	21224	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g14930 PE=4 SV=1
1775	6977	Q9M9S8	68.41	9	9	6.51E7	3	3	5	Y	46676	F14L17.11 protein OS=Arabidopsis thaliana OX=3702 GN=F14L17.11 PE=4 SV=1
2751	5310	A0A178URQ5	68.26	10	10	7.44E6	3	3	3	N	49629	Non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g21190 PE=3 SV=1
2751	5311	Q84VQ3	68.26	10	10	7.44E6	3	3	3	N	49629	CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana OX=3702 GN=CIPK26 PE=1 SV=2
2413	13390	Q9XGY4	68.19	42	42	2.28E7	3	3	4	Y	8750	Mitochondrial import inner membrane translocase subunit TIM8 OS=Arabidopsis thaliana OX=3702 GN=TIM8 PE=1 SV=1
2031	7876	F4IP53	68.07	16	16	1.41E7	3	2	5	Y	29463	General regulatory factor 9 OS=Arabidopsis thaliana OX=3702 GN=GRF9 PE=3 SV=1
2031	7877	A0A178VYW7	68.07	16	16	1.41E7	3	2	5	Y	29520	GRF9 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g39970 PE=3 SV=1
2031	7878	Q96299	68.07	16	16	1.41E7	3	2	5	Y	29520	14-3-3-like protein GF14 mu OS=Arabidopsis thaliana OX=3702 GN=GRF9 PE=1 SV=2
2031	7879	F4IP55	68.07	15	15	1.41E7	3	2	5	Y	30969	General regulatory factor 9 OS=Arabidopsis thaliana OX=3702 GN=GRF9 PE=1 SV=1
2188	2935	O64517	68.05	10	10	2.22E7	3	3	3	N	45484	Metacaspase-4 OS=Arabidopsis thaliana OX=3702 GN=AMC4 PE=1 SV=1
2188	2936	A0A178WK95	68.05	10	10	2.22E7	3	3	3	N	45454	MCP2d OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g74110 PE=4 SV=1
2065	7067	A0A178VVW2	68.02	18	18	1.96E7	4	4	5	N	32102	PUR ALPHA-1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g28380 PE=4 SV=1
2065	7068	A0A178VXA3	68.02	18	18	1.96E7	4	4	5	N	32201	PUR ALPHA-1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g28380 PE=4 SV=1
2065	7069	Q9SKZ1	68.02	18	18	1.96E7	4	4	5	N	32201	Transcription factor Pur-alpha 1 OS=Arabidopsis thaliana OX=3702 GN=PURA1 PE=1 SV=2
2117	7180	Q9FIJ4	67.96	28	28	2.72E7	3	3	5	Y	21409	DNA repair RAD52-like protein 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RAD52-2 PE=1 SV=1
2117	7181	A0A178UQ71	67.96	28	28	2.72E7	3	3	5	Y	21597	RAD52-2B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g46380 PE=4 SV=1
2403	10058	A0A384KR80	67.95	24	24	1.17E7	4	4	4	N	20406	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g37990 PE=4 SV=1
2403	10059	Q9M287	67.95	24	24	1.17E7	4	4	4	N	20406	Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family OS=Arabidopsis thaliana OX=3702 GN=T22K7_60 PE=4 SV=1
2531	8894	A0A178W030	67.90	14	14	1.21E7	3	3	4	N	32576	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g00080 PE=4 SV=1
2531	8895	Q8W592	67.90	14	14	1.21E7	3	3	4	N	32576	At1g01080/T25K16_7 OS=Arabidopsis thaliana OX=3702 GN=At1g01080 PE=2 SV=1
2531	8896	F4HQH8	67.90	14	14	1.21E7	3	3	4	N	32675	RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g01080 PE=4 SV=1
2878	108116	Q42510	67.81	4	4	1.19E6	3	3	3	Y	162618	ARF guanine-nucleotide exchange factor GNOM OS=Arabidopsis thaliana OX=3702 GN=GN PE=1 SV=1
2878	108117	A0A178WBP7	67.81	4	4	1.19E6	3	3	3	Y	162587	VAN7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g14500 PE=4 SV=1
2263	6010	A0A178UIL9	67.76	18	18	1.9E7	2	2	2	N	28514	DHAR3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g16340 PE=3 SV=1
2263	6011	Q8LE52	67.76	18	18	1.9E7	2	2	2	N	28514	Glutathione S-transferase DHAR3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DHAR3 PE=1 SV=1
1894	5487	A0A178W345	67.74	14	14	1.59E7	6	6	6	N	59325	eIF4B2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g13440 PE=4 SV=1
1894	5488	Q9SAD7	67.74	14	14	1.59E7	6	6	6	N	59325	Eukaryotic translation initiation factor 4B2 OS=Arabidopsis thaliana OX=3702 GN=EIF4B2 PE=1 SV=1
2619	9547	A0A178WMZ3	67.71	14	14	4.62E6	3	3	3	Y	38517	Pde194 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g60260 PE=3 SV=1
2619	9548	Q9C712	67.71	14	14	4.62E6	3	3	3	Y	38503	Formyl transferase, putative OS=Arabidopsis thaliana OX=3702 GN=pde194 PE=3 SV=1
2619	9549	Q84R23	67.71	14	14	4.62E6	3	3	3	Y	38473	Putative formyl transferase OS=Arabidopsis thaliana OX=3702 GN=At1g66520 PE=2 SV=1
2619	9545	A0A178WP16	67.71	15	15	4.62E6	3	3	3	Y	35570	Pde194 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g60260 PE=4 SV=1
2619	9546	A0A1P8ARF1	67.71	15	15	4.62E6	3	3	3	Y	35556	Formyltransferase OS=Arabidopsis thaliana OX=3702 GN=pde194 PE=4 SV=1
2247	7857	A0A178VUB6	67.63	8	8	1.33E5	3	2	3	Y	63930	PEN2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g42050 PE=3 SV=1
2247	7858	O64883	67.63	8	8	1.33E5	3	2	3	Y	63916	Beta-glucosidase 26, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=BGLU26 PE=1 SV=1
2008	5306	Q9S7W4	67.61	22	22	9.3E6	4	4	4	Y	35686	AT3g07720/F17A17_6 OS=Arabidopsis thaliana OX=3702 GN=F17A17.6 PE=2 SV=1
2008	5307	A0A384L5Z4	67.61	22	22	9.3E6	4	4	4	Y	35686	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g07720 PE=4 SV=1
2094	108069	A0A178WGF4	67.60	8	8	6.02E6	4	4	4	N	99839	ATAMY3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g63970 PE=4 SV=1
2094	108070	Q94A41	67.60	8	8	6.02E6	4	4	4	N	99842	Alpha-amylase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AMY3 PE=1 SV=1
2626	6397	F4JXD5	67.59	27	27	2.74E7	2	2	3	Y	14124	Actin depolymerizing factor 3 OS=Arabidopsis thaliana OX=3702 GN=ADF3 PE=3 SV=1
2626	6415	A0A178U8Q4	67.59	24	24	2.74E7	2	2	3	Y	15922	ADF3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g59320 PE=3 SV=1
2626	6416	Q9ZSK4	67.59	24	24	2.74E7	2	2	3	Y	15922	Actin-depolymerizing factor 3 OS=Arabidopsis thaliana OX=3702 GN=ADF3 PE=1 SV=1
2142	2870	A0A178VT62	67.54	7	7	4.34E6	5	3	5	N	107842	VLN2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g39020 PE=4 SV=1
2142	2871	O81644	67.54	7	7	4.34E6	5	3	5	N	107842	Villin-2 OS=Arabidopsis thaliana OX=3702 GN=VLN2 PE=1 SV=2
2160	3091	Q9LF46	67.53	7	7	6.8E6	3	3	3	N	61471	2-hydroxyacyl-CoA lyase OS=Arabidopsis thaliana OX=3702 GN=HACL PE=1 SV=1
2160	3092	A0A178UM85	67.53	7	7	6.8E6	3	3	3	N	61470	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g17060 PE=3 SV=1
2900	7145	Q0WNW0	67.49	5	5	6.46E6	2	2	2	N	72304	Glycosyl hydrolase family protein OS=Arabidopsis thaliana OX=3702 GN=At5g04885 PE=2 SV=1
2900	7146	A0A178UT89	67.49	5	5	6.46E6	2	2	2	N	72747	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g04320 PE=4 SV=1
2900	7147	A0A178UQY2	67.49	5	5	6.46E6	2	2	2	N	73774	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g04320 PE=4 SV=1
2900	7148	A0A1P8B9U3	67.49	5	5	6.46E6	2	2	2	N	74344	Glycosyl hydrolase family protein OS=Arabidopsis thaliana OX=3702 GN=At5g04885 PE=4 SV=1
2175	4045	Q9M1X2	67.47	18	18	1.48E7	3	3	3	N	30394	Fatty-acid-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=FAP1 PE=1 SV=1
2175	4046	A0A178V7B2	67.47	18	18	1.48E7	3	3	3	N	30394	FAP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g57450 PE=4 SV=1
1972	7057	A0A178WBX4	67.47	12	12	5.2E7	3	2	4	N	30722	PAPP2C OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g23370 PE=4 SV=1
1972	7058	Q9LME4	67.47	12	12	5.2E7	3	2	4	N	30722	Probable protein phosphatase 2C 9 OS=Arabidopsis thaliana OX=3702 GN=At1g22280 PE=1 SV=1
1972	7059	F4I1B4	67.47	12	12	5.2E7	3	2	4	N	31435	Phytochrome-associated protein phosphatase type 2C OS=Arabidopsis thaliana OX=3702 GN=PAPP2C PE=1 SV=1
2759	7819	Q9FMX0	67.45	15	15	8.86E6	3	3	3	N	30360	Superoxide dismutase [Fe] 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FSD3 PE=1 SV=1
2759	7820	A0A178UFT0	67.45	15	15	8.86E6	3	3	3	N	30360	FSD3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g22860 PE=4 SV=1
2759	7818	A0A1S6Q8C1	67.45	16	16	8.86E6	3	3	3	N	29353	Superoxide dismutase OS=Arabidopsis thaliana OX=3702 GN=FSD3 PE=2 SV=1
2759	7817	A0A178UE22	67.45	22	22	8.86E6	3	3	3	N	21248	Superoxide dismutase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g22860 PE=3 SV=1
2535	9563	A0A178VTC0	67.44	51	51	8.45E6	3	3	3	Y	13387	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g33560 PE=4 SV=1
2535	9564	Q8W455	67.44	51	51	8.45E6	3	3	3	Y	13387	Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g36835 PE=2 SV=1
3152	108248	Q9FUA9	67.33	26	26	3.7E6	2	2	2	Y	19183	PRLI-interacting factor F (Fragment) OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3152	108249	A0A178WLC4	67.33	20	20	3.7E6	2	2	2	Y	24484	PPa1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g00050 PE=3 SV=1
3152	108250	Q93V56	67.33	20	20	3.7E6	2	2	2	Y	24484	Soluble inorganic pyrophosphatase 1 OS=Arabidopsis thaliana OX=3702 GN=PPA1 PE=1 SV=1
3152	108251	O82597	67.33	20	20	3.7E6	2	2	2	Y	24709	Soluble inorganic pyrophosphatase 5 OS=Arabidopsis thaliana OX=3702 GN=PPA5 PE=2 SV=1
3152	108252	A0A178V127	67.33	20	20	3.7E6	2	2	2	Y	24709	PPa5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g01850 PE=3 SV=1
2308	5110	A0A178W2Y8	67.33	19	19	2.25E7	4	4	4	Y	26529	Peptidylprolyl isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g19050 PE=4 SV=1
2308	5111	Q9LDY5	67.33	19	19	2.25E7	4	4	4	Y	26529	Peptidyl-prolyl cis-trans isomerase FKBP17-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FKBP17-2 PE=1 SV=1
2670	3611	C0Z2X0	67.32	9	9	4.07E6	2	2	2	N	40065	AT4G24220 protein OS=Arabidopsis thaliana OX=3702 GN=At4g24220 PE=2 SV=1
2670	3062	Q9STX2	67.32	8	8	4.07E6	2	2	2	N	44230	3-oxo-Delta(4,5)-steroid 5-beta-reductase OS=Arabidopsis thaliana OX=3702 GN=VEP1 PE=1 SV=1
2670	3063	A0A178V158	67.32	8	8	4.07E6	2	2	2	N	44230	VEP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g28070 PE=4 SV=1
2135	3014	B3H684	67.23	16	16	1.73E7	5	4	5	N	41608	Nucleosome assembly protein11 OS=Arabidopsis thaliana OX=3702 GN=NAP1:1 PE=3 SV=1
2135	3015	A0A178UVZ1	67.23	16	16	1.73E7	5	4	5	N	42197	NAP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g30110 PE=3 SV=1
2135	3016	Q9SZI2	67.23	15	15	1.73E7	5	4	5	N	42997	Nucleosome assembly protein 1;1 OS=Arabidopsis thaliana OX=3702 GN=NAP1;1 PE=1 SV=1
2135	3017	A0A178UTQ1	67.23	15	15	1.73E7	5	4	5	N	43587	NAP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g30110 PE=3 SV=1
2890	9692	O49457	67.23	9	9	1.69E6	2	2	2	Y	38191	DNAJ heat shock family protein OS=Arabidopsis thaliana OX=3702 GN=At4g28480 PE=2 SV=1
2890	9693	A0A178V4Q1	67.23	9	9	1.69E6	2	2	2	Y	38191	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g32790 PE=4 SV=1
2113	7104	Q9S9Q9	67.23	5	5	1.29E6	2	2	2	N	73410	BTB/POZ domain-containing protein At1g30440 OS=Arabidopsis thaliana OX=3702 GN=At1g30440 PE=1 SV=2
2113	7105	A0A178WNN1	67.23	5	5	1.29E6	2	2	2	N	73410	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g30870 PE=3 SV=1
2517	108081	Q9LIF6	67.07	27	27	7.07E6	3	3	3	N	21070	Dynein beta chain, ciliary protein OS=Arabidopsis thaliana OX=3702 GN=At3g21400 PE=2 SV=1
2517	108082	A0A384LIA8	67.07	27	27	7.07E6	3	3	3	N	21070	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g22950 PE=4 SV=1
1687	7089	B9DH73	67.06	5	5	2.99E6	2	2	3	N	82931	AT5G06530 protein OS=Arabidopsis thaliana OX=3702 GN=At5g06530 PE=2 SV=1
1687	7090	Q93YS4	67.06	5	5	2.99E6	2	2	3	N	82931	ABC transporter G family member 22 OS=Arabidopsis thaliana OX=3702 GN=ABCG22 PE=1 SV=1
2848	6219	F4IDD6	67.00	8	8	5.83E6	3	3	3	Y	65960	tRNA synthetase beta subunit family protein OS=Arabidopsis thaliana OX=3702 GN=At1g72550 PE=4 SV=1
2848	6220	A0A178WJL7	67.00	8	8	5.83E6	3	3	3	Y	67543	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g66730 PE=4 SV=1
2848	6221	Q9SGE9	67.00	8	8	5.83E6	3	3	3	Y	67543	Phenylalanine--tRNA ligase beta subunit, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At1g72550 PE=2 SV=1
1877	108086	A0A178WFK1	66.97	27	27	2.37E7	3	3	3	N	15455	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g10720 PE=1 SV=1
1877	108087	Q93W05	66.97	27	27	2.37E7	3	3	3	N	15455	At1g10590/F20B24_1 OS=Arabidopsis thaliana OX=3702 GN=At1g10590 PE=1 SV=1
1877	108088	Q9XIJ0	66.97	24	24	2.37E7	3	3	3	N	17122	Nucleic acid-binding, OB-fold-like protein OS=Arabidopsis thaliana OX=3702 GN=At1g10590 PE=1 SV=1
2618	8393	P39697	66.94	17	17	5.18E6	3	3	3	N	23636	40S ribosomal protein S19, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RPS19 PE=1 SV=2
2618	8394	A0A178UHZ5	66.94	17	17	5.18E6	3	3	3	N	23636	RPS19 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g45770 PE=3 SV=1
3146	9429	Q8L9I6	66.92	7	7	5.3E6	2	2	2	N	52015	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3146	9430	Q9FYK3	66.92	7	7	5.3E6	2	2	2	N	52590	F21J9.27 OS=Arabidopsis thaliana OX=3702 GN=At1g24610 PE=4 SV=1
3146	9431	A0A178WFN5	66.92	7	7	5.3E6	2	2	2	N	52590	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g25870 PE=4 SV=1
2260	7100	A0A178UDM9	66.91	7	7	4.54E6	3	3	3	N	63052	Conserved oligomeric Golgi complex subunit 8 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g11710 PE=3 SV=1
2260	7101	Q84K25	66.91	7	7	4.54E6	3	3	3	N	63052	Conserved oligomeric Golgi complex subunit 8 OS=Arabidopsis thaliana OX=3702 GN=At5g11980 PE=2 SV=1
2260	7102	Q8LCN9	66.91	7	7	4.54E6	3	3	3	N	62953	Conserved oligomeric Golgi complex subunit 8 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2260	8832	Q9LYH5	66.91	6	6	4.54E6	3	3	3	N	68579	Conserved oligomeric Golgi complex subunit 8 OS=Arabidopsis thaliana OX=3702 GN=F14F18_150 PE=3 SV=1
2245	7336	Q1JPN1	66.89	15	15	1.75E5	3	3	4	N	51980	Protein arginine methyltransferase NDUFAF7 OS=Arabidopsis thaliana OX=3702 GN=At3g28700 PE=2 SV=1
2245	7337	F4J0D4	66.89	15	15	1.75E5	3	3	4	N	52234	Protein arginine methyltransferase NDUFAF7 OS=Arabidopsis thaliana OX=3702 GN=At3g28700 PE=3 SV=1
2245	7338	A0A178VC13	66.89	15	15	1.75E5	3	3	4	N	52554	Protein arginine methyltransferase NDUFAF7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g31350 PE=3 SV=1
2528	108096	A0A178UPL8	66.81	34	34	1.7E6	3	3	4	Y	23106	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g11410 PE=4 SV=1
2528	108097	Q9LYG2	66.81	34	34	1.7E6	3	3	4	Y	23106	Classical AGP protein OS=Arabidopsis thaliana OX=3702 GN=At5g11680 PE=2 SV=1
3151	11523	Q94A32	66.81	15	15	2.08E7	2	2	2	Y	24767	Protein FATTY ACID EXPORT 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FAX2 PE=2 SV=1
2388	5706	A0A178W2D7	66.80	24	24	7.75E6	4	4	4	N	27762	Phosphomannomutase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g43390 PE=3 SV=1
2388	5707	O80840	66.80	24	24	7.75E6	4	4	4	N	27762	Phosphomannomutase OS=Arabidopsis thaliana OX=3702 GN=PMM PE=1 SV=1
2353	11025	Q9SG90	66.79	13	13	2.99E6	3	3	4	N	42769	Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=T7M13.8 PE=4 SV=1
2353	11026	A0A1I9LRX3	66.79	13	13	2.99E6	3	3	4	N	44294	Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g10840 PE=4 SV=1
2353	11027	Q8GYG6	66.79	12	12	2.99E6	3	3	4	N	46665	Putative alpha/beta hydrolase OS=Arabidopsis thaliana OX=3702 GN=At3g10840/T7M13_8 PE=2 SV=1
2353	11028	A4IJ41	66.79	11	11	2.99E6	3	3	4	N	50886	Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g10840 PE=2 SV=1
2438	9104	A0A178VB23	66.75	5	5	2.68E6	2	2	3	N	73767	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g13220 PE=4 SV=1
2438	9105	Q9LK65	66.75	5	5	2.68E6	2	2	3	N	73753	Putative DUF21 domain-containing protein At3g13070, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CBSDUFCH1 PE=4 SV=1
2248	5662	A0A384LG78	66.72	9	9	1.18E7	3	3	4	N	47158	CAAX prenyl protease OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g01670 PE=3 SV=1
2248	5663	A0A1P8B870	66.72	9	9	1.18E7	3	3	4	N	47158	CAAX prenyl protease OS=Arabidopsis thaliana OX=3702 GN=ATSTE24 PE=3 SV=1
2248	5664	Q8RX88	66.72	9	9	1.18E7	3	3	4	N	48482	CAAX prenyl protease 1 homolog OS=Arabidopsis thaliana OX=3702 GN=FACE1 PE=1 SV=1
1723	6780	A0A178WN81	66.70	33	33	9E7	4	4	6	N	16282	RPS17 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g74690 PE=3 SV=1
1723	6781	P16180	66.70	33	33	9E7	4	4	6	N	16282	30S ribosomal protein S17, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPS17 PE=1 SV=1
2146	4743	A0A178VZA5	66.67	16	16	5.54E6	4	4	4	Y	38200	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g34190 PE=4 SV=1
2146	4744	Q9ZUS6	66.67	16	16	5.54E6	4	4	4	Y	38156	At2g37400 OS=Arabidopsis thaliana OX=3702 GN=At2g37400 PE=2 SV=1
2146	4745	Q8L932	66.67	16	16	5.54E6	4	4	4	Y	38156	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2795	9847	Q9LIN3	66.67	11	11	4.53E6	3	3	3	N	26923	Glycine-rich RNA-binding protein RZ1A OS=Arabidopsis thaliana OX=3702 GN=RZ1A PE=1 SV=1
2795	9848	A0A178VE50	66.67	11	11	4.53E6	3	3	3	N	26937	RZ-1A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g28650 PE=4 SV=1
2795	9846	Q93ZK4	66.67	19	19	4.53E6	3	3	3	N	16471	AT3g26420/F20C19_14 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2267	5424	A0A1P8ATE5	66.67	9	9	3.53E6	2	2	4	N	52771	Carotenoid isomerase OS=Arabidopsis thaliana OX=3702 GN=CRTISO PE=4 SV=1
2267	6169	A0A1P8ATA5	66.67	8	8	3.53E6	2	2	4	N	57722	Carotenoid isomerase OS=Arabidopsis thaliana OX=3702 GN=CRTISO PE=1 SV=1
2267	6170	A0A1P8ATC2	66.67	7	7	3.53E6	2	2	4	N	64612	Carotenoid isomerase OS=Arabidopsis thaliana OX=3702 GN=CRTISO PE=1 SV=1
2267	5425	A0A178WN87	66.67	7	7	3.53E6	2	2	4	N	65428	CRTISO OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g06460 PE=4 SV=1
2267	5426	Q9M9Y8	66.67	7	7	3.53E6	2	2	4	N	65429	Prolycopene isomerase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CRTISO PE=1 SV=2
2257	5919	P57752	66.63	52	52	1.66E7	3	3	4	N	10386	Acyl-CoA-binding domain-containing protein 6 OS=Arabidopsis thaliana OX=3702 GN=ACBP6 PE=1 SV=1
2257	5920	A0A178WJ33	66.63	52	52	1.66E7	3	3	4	N	10386	ACBP6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g32410 PE=4 SV=1
2747	59949	Q9ZRT9	66.61	18	18	7.14E6	3	3	3	N	31312	LEA-like protein OS=Arabidopsis thaliana OX=3702 GN=lea32 PE=2 SV=1
2747	59950	Q84W82	66.61	17	17	7.14E6	3	3	3	N	32560	At3g17520 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2747	59952	A0A178VM91	66.61	17	17	7.14E6	3	3	3	N	32447	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g18480 PE=4 SV=1
2747	59951	F4J573	66.61	17	17	7.14E6	3	3	3	N	32559	Late embryogenesis abundant protein (LEA) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g17520 PE=4 SV=1
2882	8072	A0A1P8B1V1	66.60	20	20	1.12E7	3	3	3	Y	29831	NAD(P)-linked oxidoreductase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=AKR4C8 PE=4 SV=1
2882	6472	O80944	66.60	17	17	1.12E7	3	3	3	Y	34685	Aldo-keto reductase family 4 member C8 OS=Arabidopsis thaliana OX=3702 GN=AKR4C8 PE=1 SV=2
2882	6473	A0A178VZ90	66.60	17	17	1.12E7	3	3	3	Y	34685	AKR4C8 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g34590 PE=4 SV=1
1975	2613	F4IAP5	66.59	4	4	1.45E6	4	3	4	N	149429	Ketose-bisphosphate aldolase class-II family protein OS=Arabidopsis thaliana OX=3702 GN=At1g18270 PE=4 SV=1
1975	2624	Q9LM23	66.59	4	4	1.45E6	4	3	4	N	160220	T10O22.24 OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
1976	7073	Q29Q34	66.58	14	14	9.95E5	3	3	4	Y	35594	At5g19440 OS=Arabidopsis thaliana OX=3702 GN=At5g19440 PE=2 SV=1
1976	7074	A0A178UT60	66.58	14	14	9.95E5	3	3	4	Y	35594	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g19330 PE=4 SV=1
1976	7075	Q8L9G4	66.58	14	14	9.95E5	3	3	4	Y	35624	Cinnamyl-alcohol dehydrogenase-like protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2807	8157	Q0WRA8	66.53	7	7	2.13E7	2	2	2	Y	25146	C-8,7 sterol isomerase OS=Arabidopsis thaliana OX=3702 GN=At1g20050 PE=2 SV=1
2807	8158	A0A384KZV1	66.53	7	7	2.13E7	2	2	2	Y	25146	MAD4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g21020 PE=4 SV=1
2807	8159	O48962	66.53	7	7	2.13E7	2	2	2	Y	25146	Probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Arabidopsis thaliana OX=3702 GN=At1g20050 PE=2 SV=1
3049	108192	P52420	66.43	7	7	5.47E6	2	2	2	N	56473	Phosphoribosylamine--glycine ligase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PUR2 PE=2 SV=2
1833	59714	A0A178WFE3	66.32	13	13	8.65E7	4	4	7	N	28421	GR-RBP5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g68610 PE=4 SV=1
1833	59715	Q9C909	66.32	13	13	8.65E7	4	4	7	N	28728	Glycine-rich RNA-binding protein 5, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RBG5 PE=1 SV=1
2548	108130	Q8VYR0	66.26	10	10	1.74E6	2	2	2	Y	33685	Calcium uniporter protein 5, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g57610 PE=2 SV=1
1766	4694	A0A178W6U0	66.15	15	15	8.85E6	5	5	6	N	57196	CYP71B2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g13500 PE=3 SV=1
1766	4695	O65788	66.15	15	15	8.85E6	5	5	6	N	57140	Cytochrome P450 71B2 OS=Arabidopsis thaliana OX=3702 GN=CYP71B2 PE=2 SV=2
2508	6534	Q9C9Y5	66.10	26	26	1.35E7	4	4	4	Y	20600	Putative elongation factor P (EF-P); 66839-65711 OS=Arabidopsis thaliana OX=3702 GN=F17O14.21 PE=3 SV=1
2508	6535	A0A178VHZ7	66.10	20	20	1.35E7	4	4	4	Y	26212	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g08310 PE=3 SV=1
2508	6536	Q8VZW6	66.10	20	20	1.35E7	4	4	4	Y	26228	Elongation factor P (EF-P) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g08740 PE=1 SV=1
2728	7484	B0ZVS7	65.95	24	24	1.34E7	3	3	3	N	17779	NHL3 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=NHL3 PE=4 SV=1
2728	7485	B0ZVS1	65.95	22	22	1.34E7	3	3	3	N	19333	NHL3 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=NHL3 PE=4 SV=1
2728	7486	B0ZVQ2	65.95	22	22	1.34E7	3	3	3	N	19408	NHL3 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=NHL3 PE=4 SV=1
2728	7487	B0ZVQ4	65.95	22	22	1.34E7	3	3	3	N	19599	NHL3 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=NHL3 PE=4 SV=1
2728	7488	B0ZVZ0	65.95	22	22	1.34E7	3	3	3	N	19636	NHL3 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=NHL3 PE=4 SV=1
2728	7489	B0ZVQ1	65.95	22	22	1.34E7	3	3	3	N	19869	NHL3 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=NHL3 PE=4 SV=1
2728	7491	B0ZVP8	65.95	22	22	1.34E7	3	3	3	N	19891	NHL3 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=NHL3 PE=4 SV=1
2728	7492	Q9FNH6	65.95	16	16	1.34E7	3	3	3	N	25947	NDR1/HIN1-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=NHL3 PE=1 SV=1
2728	7493	A0A178UB58	65.95	16	16	1.34E7	3	3	3	N	25947	NHL3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g05870 PE=4 SV=1
2728	7490	B0ZVY9	65.95	22	22	1.34E7	3	3	3	N	19885	NHL3 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=NHL3 PE=4 SV=1
2753	7088	Q96328	65.88	8	8	4.01E6	3	2	3	Y	66464	Phosphoinositide phosphatase SAC8 OS=Arabidopsis thaliana OX=3702 GN=SAC8 PE=2 SV=1
2753	7066	A0A178VL14	65.88	22	22	4.01E6	3	2	3	Y	24914	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g46200 PE=4 SV=1
2105	6203	A0A178V8I7	65.86	9	9	6.03E6	3	3	3	Y	71682	Peptidylprolyl isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g48410 PE=4 SV=1
2105	6204	Q7DMA9	65.86	9	9	6.03E6	3	3	3	Y	71797	Peptidyl-prolyl cis-trans isomerase PASTICCINO1 OS=Arabidopsis thaliana OX=3702 GN=PAS1 PE=1 SV=2
2935	11574	O23138	65.85	20	20	4.14E7	2	2	2	N	12394	Cytochrome c-1 OS=Arabidopsis thaliana OX=3702 GN=CYTC-1 PE=1 SV=1
2935	11575	A0A178W284	65.85	20	20	4.14E7	2	2	2	N	12394	CYTC-1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g23960 PE=3 SV=1
2666	10120	P52577	65.82	12	12	8.45E6	3	3	3	N	33737	Isoflavone reductase homolog P3 OS=Arabidopsis thaliana OX=3702 GN=At1g75280 PE=2 SV=1
2666	10121	A0A178W6W0	65.82	12	12	8.45E6	3	3	3	N	33737	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g69720 PE=4 SV=1
2091	3659	O64691	65.74	17	17	1.07E7	4	3	4	N	42873	AT2G34560 protein OS=Arabidopsis thaliana OX=3702 GN=CCP1 PE=1 SV=2
2096	5345	Q9SRY4	65.62	9	9	1.61E7	3	3	3	N	50739	Protein LOW PSII ACCUMULATION 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LPA1 PE=1 SV=1
2096	5346	A0A178W6E6	65.62	9	9	1.61E7	3	3	3	N	50723	LPA1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g02110 PE=4 SV=1
2184	7807	Q6NLC1	65.62	6	6	2.41E6	3	3	3	N	80054	ABC transporter D family member 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABCC2 PE=1 SV=1
2184	7808	A0A178WMA2	65.62	6	6	2.41E6	3	3	3	N	80054	ABCD2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g48810 PE=4 SV=1
2401	59800	A0A178VPN9	65.55	12	12	1.54E7	4	4	4	Y	42388	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g15580 PE=4 SV=1
2401	59799	Q9SK74	65.55	12	12	1.54E7	4	4	4	Y	42389	Zinc finger CCCH domain-containing protein 21 OS=Arabidopsis thaliana OX=3702 GN=At2g20280 PE=4 SV=1
2875	6005	F4J1Y2	65.51	4	4	2.06E6	3	2	3	Y	114680	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=CEF PE=4 SV=1
2875	6006	Q9M291	65.51	4	4	2.06E6	3	2	3	Y	117691	Protein transport protein Sec24-like CEF OS=Arabidopsis thaliana OX=3702 GN=CEF PE=2 SV=3
2875	6007	A0A178VC24	65.51	4	4	2.06E6	3	2	3	Y	117787	CEF OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g37950 PE=4 SV=1
2520	4214	Q9SVN5	65.48	6	6	3E6	3	3	3	Y	89854	Methionine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g13780 PE=2 SV=1
1224	8677	O65551	65.43	1	1	1.93E6	2	2	2	Y	326602	Uncharacterized protein AT4g30990 OS=Arabidopsis thaliana OX=3702 GN=F6I18.100 PE=4 SV=1
2868	59301	Q9FE78	65.39	12	12	6.88E6	3	3	3	Y	38801	Eukaryotic translation initiation factor 2 subunit alpha OS=Arabidopsis thaliana OX=3702 GN=EIF2A PE=1 SV=1
2444	6427	Q9ZRD6	65.33	20	20	8.79E6	2	2	3	Y	22544	VAMP-like protein YKT61 OS=Arabidopsis thaliana OX=3702 GN=YKT61 PE=2 SV=1
2444	6428	A0A178UM80	65.33	20	20	8.79E6	2	2	3	Y	22544	YKT61 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g57390 PE=3 SV=1
2444	6456	F4KDI1	65.33	18	18	8.79E6	2	2	3	Y	24906	SNARE-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=YKT61 PE=3 SV=1
1984	59759	Q9FZ84	65.31	23	23	1.19E7	3	2	4	N	15960	Glycine-rich RNA-binding protein 6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RBG6 PE=2 SV=1
1984	59760	A0A178WQQ6	65.31	23	23	1.19E7	3	2	4	N	15960	GR-RBP6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g19550 PE=4 SV=1
3007	7344	A0A178V449	65.25	6	6	7.2E6	2	2	2	Y	68924	RH39 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g10910 PE=4 SV=1
3007	7345	Q56X76	65.25	6	6	7.2E6	2	2	2	Y	68924	DEAD-box ATP-dependent RNA helicase 39 OS=Arabidopsis thaliana OX=3702 GN=RH39 PE=2 SV=2
3254	8900	Q9LS78	65.22	8	8	1.21E6	2	2	2	N	42290	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
3254	8901	A0A384KT89	65.22	8	8	1.21E6	2	2	2	N	44676	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g32040 PE=4 SV=1
3254	8902	F4J1U2	65.22	8	8	1.21E6	2	2	2	N	44676	Glutamate NMDA receptor subunit epsilon-1, putative (DUF3598) OS=Arabidopsis thaliana OX=3702 GN=At3g29185 PE=1 SV=1
2886	8525	Q8LCT2	65.14	13	13	9.53E6	3	2	3	N	29013	At3g55605 OS=Arabidopsis thaliana OX=3702 GN=At3g55605 PE=2 SV=1
2886	8526	A0A384KET4	65.14	13	13	9.53E6	3	2	3	N	29013	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g50220 PE=4 SV=1
2886	8387	Q9M062	65.14	7	7	9.53E6	3	2	3	N	53256	Uncharacterized protein F1I16_10 OS=Arabidopsis thaliana OX=3702 GN=F1I16_10 PE=4 SV=1
2427	3105	A0A178V5I8	65.09	17	17	1.9E7	3	3	4	N	34740	Tic32-IVa OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g27140 PE=4 SV=1
2427	3106	A2RVM0	65.09	17	17	1.9E7	3	3	4	N	34740	Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIC32 PE=2 SV=1
2730	3162	F4JDC2	65.06	7	7	6.37E6	3	3	3	N	72197	Evolutionarily conserved C-terminal region 2 OS=Arabidopsis thaliana OX=3702 GN=ECT2 PE=1 SV=1
2730	3163	F4JDC3	65.06	7	7	6.37E6	3	3	3	N	72373	Evolutionarily conserved C-terminal region 2 OS=Arabidopsis thaliana OX=3702 GN=ECT2 PE=1 SV=1
2730	3164	A0A384L1F9	65.06	7	7	6.37E6	3	3	3	N	72475	ECT2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g13800 PE=1 SV=1
2730	3165	Q9LJE5	65.06	7	7	6.37E6	3	3	3	N	72475	YTH domain-containing protein ECT2 OS=Arabidopsis thaliana OX=3702 GN=ECT2 PE=1 SV=1
2239	6671	A0A178UR99	65.02	32	32	2.73E7	4	4	5	Y	20294	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g04240 PE=4 SV=1
2239	6672	Q9FMC7	65.02	32	32	2.73E7	4	4	5	Y	20294	Nuclear transport factor 2 (NTF2) family protein OS=Arabidopsis thaliana OX=3702 GN=MUK11.15 PE=2 SV=1
2425	9924	F4J7Q0	64.98	28	28	7.23E6	3	3	3	N	25519	Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g24570 PE=3 SV=1
2425	9925	Q0WPS7	64.98	27	27	7.23E6	3	3	3	N	26982	Uncharacterized protein At3g24570 OS=Arabidopsis thaliana OX=3702 GN=At3g24570 PE=2 SV=1
2425	9926	Q9LV46	64.98	27	27	7.23E6	3	3	3	N	26954	Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g24570 PE=3 SV=1
2516	8499	A0A1P8BFA0	64.94	12	12	3.96E5	3	3	3	Y	65116	Beta-D-xylosidase 4 OS=Arabidopsis thaliana OX=3702 GN=XYL4 PE=4 SV=1
2516	8500	A0A1P8BF93	64.94	12	12	3.96E5	3	3	3	Y	67274	Beta-D-xylosidase 4 OS=Arabidopsis thaliana OX=3702 GN=XYL4 PE=4 SV=1
2516	8503	A0A178UTL8	64.94	10	10	3.96E5	3	3	3	Y	84308	XYL4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g64200 PE=4 SV=1
2516	8504	Q9FLG1	64.94	10	10	3.96E5	3	3	3	Y	84308	Beta-D-xylosidase 4 OS=Arabidopsis thaliana OX=3702 GN=BXL4 PE=1 SV=1
2030	59509	A8MRE5	64.90	18	18	1.14E7	2	2	3	N	15409	Translation elongation factor EF1B/ribosomal protein S6 family protein OS=Arabidopsis thaliana OX=3702 GN=At3g18760 PE=4 SV=1
2030	59510	Q9LSA1	64.90	17	17	1.14E7	2	2	3	N	15966	Translation elongation factor EF1B/ribosomal protein S6 family protein OS=Arabidopsis thaliana OX=3702 GN=At3g18760 PE=2 SV=1
2030	59511	A0A384KBE6	64.90	17	17	1.14E7	2	2	3	N	15966	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g19920 PE=4 SV=1
2304	4760	A0A178V5U8	64.89	28	28	1.23E7	4	4	4	N	37224	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g18180 PE=4 SV=1
2304	4761	Q93W28	64.89	28	28	1.23E7	4	4	4	N	37206	Uncharacterized protein At4g15545 OS=Arabidopsis thaliana OX=3702 GN=At4g15545 PE=1 SV=1
2527	6151	Q9ZSD4	64.89	10	10	3.96E6	3	3	4	Y	37957	Syntaxin-121 OS=Arabidopsis thaliana OX=3702 GN=SYP121 PE=1 SV=1
2527	6152	A0A178VIM4	64.89	10	10	3.96E6	3	3	4	Y	37957	SYR1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g11750 PE=3 SV=1
2745	8939	Q84WW5	64.78	18	18	2.03E6	3	2	3	Y	26374	Vesicle-associated protein 1-3 OS=Arabidopsis thaliana OX=3702 GN=PVA13 PE=2 SV=1
2745	8940	A0A178V0H0	64.78	18	18	2.03E6	3	2	3	Y	26374	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g00210 PE=4 SV=1
2519	6263	A8MSA9	64.77	12	12	1.02E7	4	4	4	Y	47726	Signal recognition particle 54 kDa protein OS=Arabidopsis thaliana OX=3702 GN=At1g48900 PE=3 SV=1
2519	6264	C0Z2C1	64.77	11	11	1.02E7	4	4	4	Y	49600	Signal recognition particle 54 kDa protein OS=Arabidopsis thaliana OX=3702 GN=At1g48900 PE=2 SV=1
2519	6265	P49967	64.77	10	10	1.02E7	4	4	4	Y	54782	Signal recognition particle 54 kDa protein 3 OS=Arabidopsis thaliana OX=3702 GN=SRP-54C PE=2 SV=2
2519	6266	A0A178WMZ2	64.77	10	10	1.02E7	4	4	4	Y	54782	Signal recognition particle 54 kDa protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g43010 PE=3 SV=1
2390	9550	Q9FJT9	64.65	5	5	3.63E6	4	4	4	Y	107981	Zinc protease PQQL-like OS=Arabidopsis thaliana OX=3702 GN=At5g56730 PE=1 SV=1
2390	9551	A0A178UKX6	64.65	5	5	3.63E6	4	4	4	Y	113636	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g55930 PE=3 SV=1
2390	9552	A0A2H1ZE93	64.65	5	5	3.63E6	4	4	4	Y	113622	Insulinase (Peptidase family M16) protein OS=Arabidopsis thaliana OX=3702 GN=MIK19.18 PE=1 SV=1
3060	10987	Q945N7	64.65	5	5	1.97E6	2	2	2	N	56717	AT5g04420/T32M21_20 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3060	10988	A0A178US13	64.65	5	5	1.97E6	2	2	2	N	56659	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g03850 PE=1 SV=1
3060	10989	Q9LZ83	64.65	5	5	1.97E6	2	2	2	N	56659	AT5G04420 protein OS=Arabidopsis thaliana OX=3702 GN=T32M21_20 PE=1 SV=1
2278	6879	Q8VY92	64.57	18	18	2.97E7	3	3	3	N	24414	Transmembrane emp24 domain-containing protein p24delta10 OS=Arabidopsis thaliana OX=3702 GN=At1g69460 PE=1 SV=1
2278	6880	A0A178WJ06	64.57	18	18	2.97E7	3	3	3	N	24414	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g63530 PE=3 SV=1
2158	7416	F4JQ95	64.54	12	12	1.06E7	4	4	4	Y	54572	Diacylglycerol kinase 7 OS=Arabidopsis thaliana OX=3702 GN=DGK7 PE=1 SV=1
2158	7417	A0A178UUX1	64.54	12	12	1.06E7	4	4	4	Y	54572	diacylglycerol kinase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g34780 PE=3 SV=1
1973	3752	O65902	64.53	10	10	7.21E6	3	3	4	Y	50970	Cyclase-associated protein 1 OS=Arabidopsis thaliana OX=3702 GN=CAP1 PE=2 SV=1
1973	3753	A0A178UWX1	64.53	10	10	7.21E6	3	3	4	Y	50970	Adenylyl cyclase-associated protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g39460 PE=3 SV=1
1973	3756	A0A1P8B7W9	64.53	8	8	7.21E6	3	3	4	Y	58486	Adenylyl cyclase-associated protein OS=Arabidopsis thaliana OX=3702 GN=CAP1 PE=3 SV=1
2407	2619	A0A178UYA2	64.38	14	14	5.56E6	4	4	4	Y	42163	Pectin acetylesterase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g22830 PE=3 SV=1
2407	2620	Q940J8	64.38	14	14	5.56E6	4	4	4	Y	42125	Pectin acetylesterase 7 OS=Arabidopsis thaliana OX=3702 GN=PAE7 PE=2 SV=1
2407	2711	F4JT64	64.38	11	11	5.56E6	4	4	4	Y	55833	Pectin acetylesterase OS=Arabidopsis thaliana OX=3702 GN=PAE7 PE=3 SV=1
2040	7063	Q8H0T4	64.37	1	1	9.13E5	2	2	2	N	403618	E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana OX=3702 GN=UPL2 PE=1 SV=3
2040	8218	A0A178WME1	64.37	1	1	9.13E5	2	2	2	N	403466	UPL2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g64450 PE=4 SV=1
2040	8904	A0A178WHZ8	64.37	1	1	9.13E5	2	2	2	N	404959	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g50490 PE=4 SV=1
2040	8905	Q8GY23	64.37	1	1	9.13E5	2	2	2	N	405001	E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana OX=3702 GN=UPL1 PE=1 SV=3
2658	5516	O22100	64.34	15	15	7.62E6	3	3	3	N	42583	ATMRK1 OS=Arabidopsis thaliana OX=3702 GN=ATMRK1 PE=2 SV=1
2658	5517	A0A384KC16	64.34	15	15	7.62E6	3	3	3	N	42583	ATMRK1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g57540 PE=4 SV=1
2658	6712	F4J0Y1	64.34	17	17	7.62E6	3	3	3	N	37331	Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=ATMRK1 PE=4 SV=1
2924	8979	Q2HIK0	64.32	22	22	1.21E7	2	2	3	N	21556	At3g27890 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2924	8980	Q9LK88	64.32	22	22	1.21E7	2	2	3	N	21556	NADPH:quinone oxidoreductase OS=Arabidopsis thaliana OX=3702 GN=NQR PE=1 SV=1
2924	8981	A0A384KSW6	64.32	22	22	1.21E7	2	2	3	N	21556	NQR OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g30430 PE=4 SV=1
2542	6433	A0A178U6D3	64.23	18	18	1.22E7	3	2	4	Y	27509	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g41910 PE=1 SV=1
2542	6434	Q9FG81	64.23	18	18	1.22E7	3	2	4	Y	27509	Aluminum induced protein with YGL and LRDR motifs OS=Arabidopsis thaliana OX=3702 GN=MQD19.19 PE=1 SV=1
2775	4509	O81148	64.20	11	11	1.85E7	2	2	2	N	27475	Proteasome subunit alpha type-4-A OS=Arabidopsis thaliana OX=3702 GN=PAC1 PE=1 SV=1
2775	4510	A0A178VJ65	64.20	11	11	1.85E7	2	2	2	N	27475	Proteasome subunit alpha type OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g23780 PE=3 SV=1
2885	11958	A0A178WN09	64.16	19	19	1.33E6	3	3	3	N	31371	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g20720 PE=4 SV=1
2885	11960	Q9FXH3	64.16	19	19	1.33E6	3	3	3	N	31371	ATP-dependent protease La (LON) domain protein OS=Arabidopsis thaliana OX=3702 GN=F6F9.20 PE=2 SV=1
2518	7191	A0A178UXV7	64.12	18	18	6.08E6	3	2	3	N	21873	RABF2B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g23090 PE=4 SV=1
2518	7192	Q9SN68	64.12	18	18	6.08E6	3	2	3	N	21873	Ras-related protein RABF2b OS=Arabidopsis thaliana OX=3702 GN=RABF2B PE=1 SV=1
2541	6769	O80704	64.07	6	6	3.51E6	2	2	2	Y	46248	At1g61990/F8K4_18 OS=Arabidopsis thaliana OX=3702 GN=At1g61990 PE=2 SV=1
2541	6770	A0A178WLM2	64.07	6	6	3.51E6	2	2	2	Y	46515	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g55230 PE=4 SV=1
2212	11413	A0A2P2CLG8	64.03	50	50	6.27E7	3	3	5	Y	7571	ATP synthase subunit 9, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=atp9 PE=3 SV=2
2212	11414	P60112	64.03	44	44	6.27E7	3	3	5	Y	8936	ATP synthase subunit 9, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ATP9 PE=2 SV=2
2657	5677	Q5XVE5	64.02	17	17	4.11E5	3	2	3	N	28974	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2657	5678	A0A178VQQ0	64.02	17	17	4.11E5	3	2	3	N	28973	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g14110 PE=4 SV=1
2657	5679	Q9ZV42	64.02	17	17	4.11E5	3	2	3	N	28973	P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MSF3.15 PE=2 SV=1
2657	5680	Q0WSC4	64.02	17	17	4.11E5	3	2	3	N	28987	Putative signal recognition particle receptor beta subunit OS=Arabidopsis thaliana OX=3702 GN=At2g18770 PE=2 SV=1
2657	5682	A0A1P8AY88	64.02	16	16	4.11E5	3	2	3	N	30225	P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MSF3.15 PE=4 SV=1
1770	3211	A0A178VQK7	64.02	6	6	5.19E6	4	4	4	Y	96646	Protein VACUOLELESS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g34860 PE=3 SV=1
1770	3212	Q93VQ0	64.02	6	6	5.19E6	4	4	4	Y	96632	Protein VACUOLELESS1 OS=Arabidopsis thaliana OX=3702 GN=VCL1 PE=1 SV=1
2782	8661	Q0WWE3	63.99	41	41	4.83E7	2	2	3	Y	7983	Cytochrome b-c1 complex subunit 6 OS=Arabidopsis thaliana OX=3702 GN=At1g15120 PE=1 SV=1
2782	8662	Q8LDP7	63.99	41	41	4.83E7	2	2	3	Y	8013	Cytochrome b-c1 complex subunit 6 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2782	8663	Q9XI58	63.99	28	28	4.83E7	2	2	3	Y	11318	Cytochrome b-c1 complex subunit 6 OS=Arabidopsis thaliana OX=3702 GN=F9L1.5 PE=3 SV=1
2782	8664	F4HXY8	63.99	17	17	4.83E7	2	2	3	Y	19019	Ubiquinol-cytochrome C reductase hinge protein OS=Arabidopsis thaliana OX=3702 GN=At1g15120 PE=1 SV=1
2338	7815	A0A178U6F1	63.99	20	20	5.25E6	3	3	4	Y	29588	DCI1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g41280 PE=3 SV=1
2338	7816	Q9FHR8	63.99	20	20	5.25E6	3	3	4	Y	29920	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=DCI1 PE=2 SV=1
3263	9567	A0A1P8BDW6	63.99	4	4	1.11E6	2	2	2	Y	97811	Peroxisome 1 OS=Arabidopsis thaliana OX=3702 GN=PEX1 PE=4 SV=1
3263	9568	A0A1P8BDY2	63.99	4	4	1.11E6	2	2	2	Y	110380	Peroxisome 1 OS=Arabidopsis thaliana OX=3702 GN=PEX1 PE=4 SV=1
3263	9569	A0A1P8BDW7	63.99	3	3	1.11E6	2	2	2	Y	122904	Peroxisome 1 OS=Arabidopsis thaliana OX=3702 GN=PEX1 PE=4 SV=1
3263	9570	Q9FNP1	63.99	3	3	1.11E6	2	2	2	Y	123844	Peroxisome biogenesis protein 1 OS=Arabidopsis thaliana OX=3702 GN=PEX1 PE=1 SV=2
2509	9658	A0A178WJ04	63.95	17	17	5.39E4	3	2	3	Y	42168	LYP3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g72200 PE=4 SV=1
2509	9659	Q6NPN4	63.95	17	17	5.39E4	3	2	3	Y	44152	LysM domain-containing GPI-anchored protein 3 OS=Arabidopsis thaliana OX=3702 GN=LYM3 PE=1 SV=1
2362	9109	A0A1P8AUK8	63.92	12	12	5.11E6	2	2	3	N	32337	SNARE associated Golgi protein family OS=Arabidopsis thaliana OX=3702 GN=At1g22850 PE=4 SV=1
2362	9110	A0A178WN44	63.92	12	12	5.11E6	2	2	3	N	32184	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g23970 PE=4 SV=1
2362	8745	O23137	63.92	10	10	5.11E6	2	2	3	N	36905	At1g22850/F29G20_19 OS=Arabidopsis thaliana OX=3702 GN=F29G20.19 PE=2 SV=1
2362	8746	A0A178WN24	63.92	10	10	5.11E6	2	2	3	N	36905	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g23970 PE=4 SV=1
2261	9954	A0A178VS90	63.88	14	14	2.91E6	4	2	5	N	31048	ATPADK1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g34050 PE=3 SV=1
2261	9955	Q9ZUU1	63.88	14	14	2.91E6	4	2	5	N	31038	Adenylate kinase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ADK PE=1 SV=1
2939	11322	Q42589	63.75	23	23	3.36E7	3	3	3	Y	11755	Non-specific lipid-transfer protein 1 OS=Arabidopsis thaliana OX=3702 GN=LTP1 PE=2 SV=1
2939	11323	A0A178VZQ3	63.75	23	23	3.36E7	3	3	3	Y	11755	Non-specific lipid-transfer protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g35400 PE=3 SV=1
2309	4926	Q9SZX4	63.68	9	9	2.04E6	3	3	3	Y	81078	Brefeldin A-sensitive Golgi protein-like OS=Arabidopsis thaliana OX=3702 GN=F6I7.50 PE=4 SV=1
2898	10522	A0A1P8BG97	63.61	11	11	1.9E6	2	2	2	N	39408	CCR4-NOT transcription complex subunit OS=Arabidopsis thaliana OX=3702 GN=At5g18420 PE=4 SV=1
2898	10523	F4JWN4	63.61	8	8	1.9E6	2	2	2	N	50075	CCR4-NOT transcription complex subunit OS=Arabidopsis thaliana OX=3702 GN=At5g18420 PE=4 SV=1
2898	10524	Q8L846	63.61	8	8	1.9E6	2	2	2	N	50245	Uncharacterized protein At5g18420 OS=Arabidopsis thaliana OX=3702 GN=At5g18420 PE=2 SV=1
2898	10525	B4F7Q4	63.61	8	8	1.9E6	2	2	2	N	50318	At5g18420 OS=Arabidopsis thaliana OX=3702 GN=At5g18420 PE=2 SV=1
2898	10526	A0A178UGT7	63.61	8	8	1.9E6	2	2	2	N	50342	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g18210 PE=4 SV=1
2898	10527	B4F7N8	63.61	8	8	1.9E6	2	2	2	N	50446	At5g18420 OS=Arabidopsis thaliana OX=3702 GN=At5g18420 PE=2 SV=1
2898	10528	A0A178UGV6	63.61	8	8	1.9E6	2	2	2	N	50470	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g18210 PE=4 SV=1
2269	8490	Q9LM93	63.53	11	11	3.2E6	2	2	2	Y	27676	Dolichol-phosphate mannosyltransferase subunit 1 OS=Arabidopsis thaliana OX=3702 GN=DPMS1 PE=1 SV=1
2269	8491	A0A178WDF9	63.53	11	11	3.2E6	2	2	2	Y	27676	Dolichol-phosphate mannosyltransferase subunit 1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g21550 PE=3 SV=1
2738	10164	A0A384KE42	63.46	41	41	8.33E6	3	3	3	N	11823	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g57100 PE=3 SV=1
2738	10165	Q9LZI4	63.46	41	41	8.33E6	3	3	3	N	11823	At3g62810 OS=Arabidopsis thaliana OX=3702 GN=F26K9_240 PE=2 SV=1
2926	9380	A0A178V151	63.41	13	13	1.15E7	2	2	3	N	26653	Pyridoxal phosphate homeostasis protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g31010 PE=3 SV=1
2926	9381	Q94JS1	63.41	13	13	1.15E7	2	2	3	N	26639	Pyridoxal phosphate homeostasis protein OS=Arabidopsis thaliana OX=3702 GN=At4g26860 PE=1 SV=1
2926	9382	F4JVS4	63.41	13	13	1.15E7	2	2	3	N	27780	Pyridoxal phosphate homeostasis protein OS=Arabidopsis thaliana OX=3702 GN=At4g26860 PE=1 SV=1
2926	9383	Q9SZ26	63.41	12	12	1.15E7	2	2	3	N	28989	Pyridoxal phosphate homeostasis protein OS=Arabidopsis thaliana OX=3702 GN=F10M23.200 PE=3 SV=1
2621	6238	O82279	63.40	8	8	6.84E6	2	2	2	N	38610	Protein CONSERVED ONLY IN THE GREEN LINEAGE 160, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CGL160 PE=1 SV=1
2621	6239	A0A178VTF2	63.40	8	8	6.84E6	2	2	2	N	38610	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g27190 PE=1 SV=1
2769	108146	A0A178WCK2	63.36	11	11	1.71E7	2	2	2	N	39038	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g06510 PE=4 SV=1
2769	108147	Q8RXL8	63.36	11	11	1.71E7	2	2	2	N	39038	UDP-xylose transporter 3 OS=Arabidopsis thaliana OX=3702 GN=UXT3 PE=1 SV=1
1359	5396	A0A178VCC1	63.34	62	62	2.03E7	6	3	8	N	17806	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g28700 PE=4 SV=1
1359	5397	Q8L942	63.34	62	62	2.03E7	6	3	8	N	17806	Major latex protein, putative OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2417	6384	Q6NMI3	63.28	6	6	4.78E6	3	3	3	Y	75792	Conserved oligomeric Golgi complex subunit 6 OS=Arabidopsis thaliana OX=3702 GN=At1g31780 PE=1 SV=1
2417	6385	A0A178WML0	63.28	6	6	4.78E6	3	3	3	Y	75841	Conserved oligomeric Golgi complex subunit 6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g32370 PE=3 SV=1
2417	6390	Q9C6R8	63.28	6	6	4.78E6	3	3	3	Y	78837	Conserved oligomeric Golgi complex subunit 6 OS=Arabidopsis thaliana OX=3702 GN=F5M6.21 PE=3 SV=1
2373	10409	A0A178USI0	63.25	42	42	9.03E7	4	4	4	Y	7371	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g09790 PE=3 SV=1
2373	10410	Q9SR73	63.25	42	42	9.03E7	4	4	4	Y	7371	40S ribosomal protein S28-1 OS=Arabidopsis thaliana OX=3702 GN=RPS28A PE=3 SV=1
2864	9218	O04098	63.20	8	8	7.47E6	3	3	3	N	66817	Receptor-kinase isolog, 5' partial; 115640-113643 OS=Arabidopsis thaliana OX=3702 GN=T19D16.21 PE=4 SV=1
2864	9219	Q56ZA8	63.20	8	8	7.47E6	3	3	3	N	72724	Receptor-kinase isolog OS=Arabidopsis thaliana OX=3702 GN=At1g10860 PE=2 SV=1
2864	9220	Q940B9	63.20	8	8	7.47E6	3	3	3	N	72738	Leucine-rich repeat protein kinase family protein OS=Arabidopsis thaliana OX=3702 GN=At1g10850 PE=2 SV=1
2864	9221	A0A178WAS3	63.20	8	8	7.47E6	3	3	3	N	72738	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g11050 PE=4 SV=1
2864	9222	Q8RWP2	63.20	8	8	7.47E6	3	3	3	N	72706	Receptor-kinase isolog OS=Arabidopsis thaliana OX=3702 GN=At1g10850 PE=2 SV=1
3059	9302	Q9M1J1	63.20	29	29	8.79E6	2	2	2	Y	18698	Mitochondrial fission 1 protein A OS=Arabidopsis thaliana OX=3702 GN=FIS1A PE=1 SV=1
2533	60194	P15459	63.15	28	28	2.2E7	4	3	4	Y	18762	2S seed storage protein 3 OS=Arabidopsis thaliana OX=3702 GN=AT2S3 PE=1 SV=1
2533	60195	A0A178UUE6	63.15	28	28	2.2E7	4	3	4	Y	18762	SESA3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g31310 PE=4 SV=1
2451	7434	Q9M0E2	63.12	22	22	3.22E7	2	2	3	N	15911	60S ribosomal protein L28-2 OS=Arabidopsis thaliana OX=3702 GN=RPL28C PE=2 SV=1
2451	7435	A0A178UVV8	63.12	22	22	3.22E7	2	2	3	N	15911	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g33790 PE=4 SV=1
3020	4522	Q9SW33	63.08	15	15	5.17E6	2	2	2	N	24695	Thylakoid lumenal 17.9 kDa protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At4g24930 PE=1 SV=1
3020	4523	A0A178UT74	63.08	15	15	5.17E6	2	2	2	N	24808	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g28810 PE=4 SV=1
2680	5684	A0A178UM00	63.04	6	6	1.18E7	2	2	2	N	52211	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g57420 PE=3 SV=1
2680	5685	Q93Z08	63.04	6	6	1.18E7	2	2	2	N	52211	Glucan endo-1,3-beta-glucosidase 6 OS=Arabidopsis thaliana OX=3702 GN=At5g58090 PE=2 SV=2
2742	59610	Q9FHM7	63.02	13	13	5.95E6	3	3	3	N	32378	Hypersensitive-induced response protein 4 OS=Arabidopsis thaliana OX=3702 GN=HIR4 PE=1 SV=1
2742	59611	A0A178UM06	63.02	13	13	5.95E6	3	3	3	N	32378	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g50390 PE=4 SV=1
2513	8124	Q56WK7	62.97	12	12	7.63E5	4	2	4	N	41679	Glucose-6-phosphate 1-dehydrogenase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At5g35790 PE=2 SV=1
2513	8125	A0A178UCB6	62.97	10	10	7.63E5	4	2	4	N	50000	Glucose-6-phosphate 1-dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g33080 PE=3 SV=1
2513	8126	Q43727	62.97	8	8	7.63E5	4	2	4	N	65428	Glucose-6-phosphate 1-dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=G6PD1 PE=1 SV=2
2513	8127	A0A178UEB2	62.97	8	8	7.63E5	4	2	4	N	65532	Glucose-6-phosphate 1-dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g33080 PE=3 SV=1
2194	7027	F4I083	62.96	22	22	2.54E7	3	3	4	Y	25035	Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein OS=Arabidopsis thaliana OX=3702 GN=LTPG6 PE=4 SV=1
2194	7028	F4I082	62.96	22	22	2.54E7	3	3	4	Y	25308	Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein OS=Arabidopsis thaliana OX=3702 GN=LTPG6 PE=4 SV=1
2194	7024	Q8LEX2	62.96	29	29	2.54E7	3	3	4	Y	18304	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2194	7025	Q9C896	62.96	27	27	2.54E7	3	3	4	Y	20126	At1g55260/F7A10_16 OS=Arabidopsis thaliana OX=3702 GN=F7A10.16 PE=2 SV=1
2194	7026	A0A178W5X2	62.96	27	27	2.54E7	3	3	4	Y	20126	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g49790 PE=4 SV=1
2515	5829	Q43307	62.95	14	14	7.58E6	3	3	3	Y	50421	Glycerol-3-phosphate acyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ATS1 PE=2 SV=2
2515	5830	A0A178WCW7	62.95	14	14	7.58E6	3	3	3	Y	50448	Glycerol-3-phosphate acyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g32940 PE=3 SV=1
1981	8817	A0A178UYB8	62.93	11	11	3.44E6	3	3	4	N	40834	SUFE1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g30580 PE=4 SV=1
1981	8818	Q84W65	62.93	11	11	3.44E6	3	3	4	N	40834	SufE-like protein 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SUFE1 PE=1 SV=2
2462	11973	A0A178VDT3	62.88	16	16	3.03E7	4	4	4	N	21951	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g50660 PE=4 SV=1
2462	11974	Q9LY44	62.88	16	16	3.03E7	4	4	4	N	21921	Transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=F27K19_190 PE=2 SV=1
2854	9574	Q9SL43	62.82	19	19	3.34E6	3	3	3	N	28928	Peptide methionine sulfoxide reductase A5 OS=Arabidopsis thaliana OX=3702 GN=MSRA5 PE=2 SV=1
2854	9575	A0A178W246	62.82	19	19	3.34E6	3	3	3	N	28928	MSRA5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g13350 PE=3 SV=1
2754	108120	A0A1P8B7Z0	62.80	15	15	3.04E6	3	3	3	N	42983	Phosphatidylserine decarboxylase 1 OS=Arabidopsis thaliana OX=3702 GN=PSD1 PE=4 SV=1
2754	108121	Q84V22	62.80	13	13	3.04E6	3	3	3	N	50560	Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PSD1 PE=2 SV=1
2754	108122	A0A178V4B5	62.80	13	13	3.04E6	3	3	3	N	50618	Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g19660 PE=3 SV=1
3255	8609	A0A178UGT4	62.76	5	5	1.33E6	2	2	2	N	81651	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g18000 PE=4 SV=1
3255	8610	A0A1P8B9Q7	62.76	5	5	1.33E6	2	2	2	N	89983	Transcription regulator NOT2/NOT3/NOT5 family protein OS=Arabidopsis thaliana OX=3702 GN=MRG7.19 PE=1 SV=1
3255	8611	F4JWJ6	62.76	5	5	1.33E6	2	2	2	N	92952	Transcription regulator NOT2/NOT3/NOT5 family protein OS=Arabidopsis thaliana OX=3702 GN=MRG7.19 PE=1 SV=1
3255	8612	Q94JY7	62.76	5	5	1.33E6	2	2	2	N	93053	Uncharacterized protein At5g18230 OS=Arabidopsis thaliana OX=3702 GN=MRG7.18 PE=2 SV=1
3255	8613	F4JWJ7	62.76	4	4	1.33E6	2	2	2	N	93253	Transcription regulator NOT2/NOT3/NOT5 family protein OS=Arabidopsis thaliana OX=3702 GN=MRG7.19 PE=1 SV=1
3255	8614	A0A1P8B9R0	62.76	4	4	1.33E6	2	2	2	N	95625	Transcription regulator NOT2/NOT3/NOT5 family protein OS=Arabidopsis thaliana OX=3702 GN=MRG7.19 PE=1 SV=1
3255	8615	Q9FK48	62.76	4	4	1.33E6	2	2	2	N	98092	Similarity to transcription regulator OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2773	6599	Q9SCX9	62.70	7	7	6.41E6	2	2	2	N	43792	Glycerol-3-phosphate dehydrogenase [NAD(+)] 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DHAPRD PE=1 SV=1
2773	8147	A0A178ULC3	62.70	7	7	6.41E6	2	2	2	N	43705	Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g38330 PE=3 SV=1
2350	8865	B9DGU9	62.69	6	6	2.96E7	2	2	2	N	44391	AT5G59250 protein (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At5g59250 PE=2 SV=1
2350	8931	A0A178UN85	62.69	4	4	2.96E7	2	2	2	N	59829	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g58640 PE=3 SV=1
2350	8932	Q0WWW9	62.69	4	4	2.96E7	2	2	2	N	59829	D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g59250 PE=1 SV=2
2189	3474	A8R7K9	62.68	4	4	1.23E6	2	2	2	Y	89405	Vacuolar protein sorting-associated protein 35C OS=Arabidopsis thaliana OX=3702 GN=VPS35C PE=2 SV=1
2189	3475	A0A178VKA9	62.68	4	4	1.23E6	2	2	2	Y	89433	Vacuolar protein sorting-associated protein 35 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g45580 PE=3 SV=1
2625	8711	Q944A6	62.62	9	9	2.38E5	2	2	2	N	53466	Sucrose nonfermenting 4-like protein OS=Arabidopsis thaliana OX=3702 GN=SNF4 PE=1 SV=1
2625	8712	A0A178W6I0	62.62	9	9	2.38E5	2	2	2	N	53466	SNF4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g08840 PE=4 SV=1
2625	8713	A0A178W7G4	62.62	9	9	2.38E5	2	2	2	N	54714	SNF4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g08840 PE=4 SV=1
2859	108107	A0A178W1W5	62.52	29	29	1.15E7	3	3	3	N	21237	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g32550 PE=4 SV=1
2859	108108	Q9SJ60	62.52	29	29	1.15E7	3	3	3	N	21238	Mal d 1-associated protein OS=Arabidopsis thaliana OX=3702 GN=At2g35900 PE=2 SV=1
2552	7872	Q9SK86	62.46	7	7	4.12E6	2	2	3	N	42529	Alcohol dehydrogenase-like 1 OS=Arabidopsis thaliana OX=3702 GN=At1g22430 PE=2 SV=1
1840	5029	A0A178VZ49	62.46	6	6	1.03E7	4	4	4	N	108981	26S proteasome non-ATPase regulatory subunit 1 homolog OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g29090 PE=3 SV=1
1840	5030	O48844	62.46	6	6	1.03E7	4	4	4	N	108977	26S proteasome non-ATPase regulatory subunit 1 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPN2A PE=1 SV=1
2193	59405	W8Q3D1	62.44	4	4	6.52E6	2	2	3	Y	84986	Glycosyltransferase (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT2G32540 PE=2 SV=1
2193	59404	O80891	62.44	4	4	6.52E6	2	2	3	Y	84986	Cellulose synthase-like protein B4 OS=Arabidopsis thaliana OX=3702 GN=CSLB4 PE=3 SV=1
2193	59406	A0A178VX93	62.44	4	4	6.52E6	2	2	3	Y	84956	CSLB04 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g28880 PE=3 SV=1
2770	6346	O04212	62.43	6	6	5.97E6	2	2	2	Y	60919	Putative ABC1 protein At2g40090 OS=Arabidopsis thaliana OX=3702 GN=At2g40090 PE=2 SV=2
2770	6347	Q67ZT0	62.43	6	6	5.97E6	2	2	2	Y	60919	ABC transporter like protein OS=Arabidopsis thaliana OX=3702 GN=At2g40090 PE=2 SV=1
2195	6317	Q9SIE3	62.41	16	16	5.98E7	3	3	5	N	24242	At2g22230/T26C19.11 OS=Arabidopsis thaliana OX=3702 GN=At2g22230 PE=2 SV=2
2195	6318	A0A178W084	62.41	16	16	5.98E7	3	3	5	N	24302	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g17780 PE=3 SV=1
2346	59676	F4HXZ3	62.38	16	16	1.92E7	3	3	4	Y	29753	FAD/NAD(P)-binding oxidoreductase OS=Arabidopsis thaliana OX=3702 GN=At1g15140 PE=4 SV=1
2346	59617	A0A178WAY6	62.38	15	15	1.92E7	3	3	4	Y	31924	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g15830 PE=4 SV=1
2346	59616	Q9XI55	62.38	15	15	1.92E7	3	3	4	Y	31924	F9L1.8 protein OS=Arabidopsis thaliana OX=3702 GN=At1g15140 PE=2 SV=1
2558	8190	Q547D7	62.32	9	9	4.25E6	2	2	2	N	46355	Phosphorybosyl anthranilate transferase 1 OS=Arabidopsis thaliana OX=3702 PE=3 SV=1
2558	8191	A0A178U8D1	62.32	9	9	4.25E6	2	2	2	N	46355	TRP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g17690 PE=3 SV=1
2558	6830	Q02166	62.32	9	9	4.25E6	2	2	2	N	46520	Anthranilate phosphoribosyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PAT1 PE=2 SV=1
2067	3366	A0A178VDJ4	62.23	18	18	1.1E7	3	3	3	Y	38389	UXS5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g40260 PE=4 SV=1
2067	3367	Q9SN95	62.23	18	18	1.1E7	3	3	3	Y	38389	UDP-glucuronic acid decarboxylase 5 OS=Arabidopsis thaliana OX=3702 GN=UXS5 PE=2 SV=1
2547	8656	Q9MBH2	62.18	18	18	9.98E6	2	2	3	Y	19465	Protein AIG2 B OS=Arabidopsis thaliana OX=3702 GN=AIG2B PE=2 SV=1
2174	4891	Q9M084	62.13	9	9	2.66E6	3	3	3	Y	62918	Aspartate--tRNA ligase 2, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=IBI1 PE=1 SV=1
2174	4892	A0A178V0N3	62.13	9	9	2.66E6	3	3	3	Y	62918	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g35720 PE=3 SV=1
1876	7571	A0A384LFU6	62.09	16	16	6.17E6	3	3	4	N	27627	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g04720 PE=4 SV=1
1876	7572	Q9M0V5	62.09	16	16	6.17E6	3	3	4	N	27627	At4g05400 OS=Arabidopsis thaliana OX=3702 GN=At4g05400 PE=2 SV=1
2457	9331	Q94K97	61.89	12	12	6.17E6	2	2	3	N	34857	30S ribosomal protein OS=Arabidopsis thaliana OX=3702 GN=At5g24490 PE=1 SV=1
2457	9332	A0A178UCE0	61.89	12	12	6.17E6	2	2	3	N	34857	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g24330 PE=1 SV=1
2457	9333	Q9FLV3	61.89	10	10	6.17E6	2	2	3	N	41516	Similarity to ribosomal protein 30S subunit OS=Arabidopsis thaliana OX=3702 PE=3 SV=1
2674	3069	A0A178UUC1	61.88	16	16	2.21E7	2	2	2	Y	24795	NdhM OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g43240 PE=4 SV=1
2674	3070	Q2V2S7	61.88	16	16	2.21E7	2	2	2	Y	24795	NAD(P)H-quinone oxidoreductase subunit M, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhM PE=2 SV=1
2794	108254	Q8LCN8	61.84	8	8	2.35E6	2	2	3	N	55825	Cytochrome P450-like protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2794	108255	Q9SZT7	61.84	8	8	2.35E6	2	2	3	N	56198	Cytochrome P450, family 81, subfamily D, polypeptide 8 OS=Arabidopsis thaliana OX=3702 GN=''cytochrome P450 PE=2 SV=1
2563	59415	Q9FM67	61.82	19	19	4.39E6	2	2	4	Y	23652	Protein TIC 20-v, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIC20-V PE=2 SV=1
2563	59414	A0A178URN8	61.82	19	19	4.39E6	2	2	4	Y	23652	Tic20-V OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g54870 PE=4 SV=1
2663	5120	Q8GZQ3	61.72	3	3	4.68E6	2	2	2	N	99566	Polyribonucleotide nucleotidyltransferase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PNP1 PE=1 SV=1
2663	5121	A0A178VFS9	61.72	3	3	4.68E6	2	2	2	N	102973	RIF10 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g03080 PE=3 SV=1
2930	9726	A0A1B1W4W7	61.59	31	31	1.81E7	2	2	3	N	13473	Ribosomal protein S12 OS=Arabidopsis thaliana OX=3702 GN=rps12 PE=3 SV=1
2930	9727	P62126	61.59	31	31	1.81E7	2	2	3	N	13764	30S ribosomal protein S12, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rps12-A PE=2 SV=2
2805	9484	A0A178WCE4	61.57	21	21	5.07E7	2	2	3	N	17829	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g39020 PE=4 SV=1
2805	9485	Q9C7S3	61.57	21	21	5.07E7	2	2	3	N	17829	Inner membrane localized protein OS=Arabidopsis thaliana OX=3702 GN=At1g42960 PE=2 SV=1
2925	6926	A0A178U7Y0	61.55	3	3	4.41E6	2	2	3	N	103663	RBOHD OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g46420 PE=4 SV=1
2925	6928	Q9FIJ0	61.55	3	3	4.41E6	2	2	3	N	103909	Respiratory burst oxidase homolog protein D OS=Arabidopsis thaliana OX=3702 GN=RBOHD PE=1 SV=1
3256	9580	A0A178UC04	61.54	18	18	1.97E7	2	2	2	N	18977	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g44450 PE=1 SV=1
3256	9581	Q9FNM0	61.54	18	18	1.97E7	2	2	2	N	18977	28 kDa heat/acid-stable phosphoprotein-like protein OS=Arabidopsis thaliana OX=3702 GN=MCL19.6 PE=1 SV=1
2555	6644	A0A178W5Y9	61.48	17	17	5.94E6	2	2	3	N	22157	PQL2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g14690 PE=4 SV=1
2555	6645	Q9XI73	61.48	17	17	5.94E6	2	2	3	N	22157	Photosynthetic NDH subunit of lumenal location 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PNSL2 PE=1 SV=1
3257	7654	Q9FNC9	61.44	22	22	3.14E7	2	2	2	N	10378	Mitochondrial import receptor subunit TOM9-2 OS=Arabidopsis thaliana OX=3702 GN=TOM9-2 PE=1 SV=3
3257	7655	A0A178UKM7	61.44	22	22	3.14E7	2	2	2	N	10378	TOM9-2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g42070 PE=4 SV=1
1653	5139	Q38931	61.41	7	7	1.89E7	4	3	4	Y	61453	Peptidyl-prolyl cis-trans isomerase FKBP62 OS=Arabidopsis thaliana OX=3702 GN=FKBP62 PE=1 SV=2
1653	5140	A0A178VH19	61.41	7	7	1.89E7	4	3	4	Y	61453	Peptidylprolyl isomerase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g27250 PE=4 SV=1
1653	5141	B3H746	61.41	6	6	1.89E7	4	3	4	Y	62912	Peptidylprolyl isomerase OS=Arabidopsis thaliana OX=3702 GN=ROF1 PE=1 SV=1
2869	4758	Q8GWB7	61.37	8	8	6.17E6	3	3	3	N	60011	Inositol phosphorylceramide glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=IPUT1 PE=1 SV=1
2869	4759	A0A178USM2	61.37	8	8	6.17E6	3	3	3	N	60011	Hexosyltransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g18280 PE=3 SV=1
2692	108256	P16972	61.35	54	54	8.61E6	2	2	3	Y	15539	Ferredoxin-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FD2 PE=1 SV=1
2692	108257	A0A178W2W5	61.35	54	54	8.61E6	2	2	3	Y	15539	Ferredoxin OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g54040 PE=3 SV=1
3262	7457	A0A178U907	61.28	20	20	4.03E6	2	2	2	N	20516	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g58220 PE=4 SV=1
3262	7458	A0A178UAQ1	61.28	18	18	4.03E6	2	2	2	N	22723	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g58220 PE=4 SV=1
3262	7459	Q9LUX9	61.28	18	18	4.03E6	2	2	2	N	22723	Probable NAD(P)H dehydrogenase (quinone) FQR1-like 3 OS=Arabidopsis thaliana OX=3702 GN=At5g58800 PE=2 SV=1
2539	5550	A0A178UMQ8	61.25	7	7	5.22E6	2	2	2	Y	41770	SQD2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g00230 PE=4 SV=1
2539	5580	Q8S4F6	61.25	5	5	5.22E6	2	2	2	Y	56630	Sulfoquinovosyl transferase SQD2 OS=Arabidopsis thaliana OX=3702 GN=SQD2 PE=1 SV=1
2530	16375	Q945Q4	61.23	19	19	8.14E6	3	3	4	Y	39697	At2g16800/T24I21.21 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2530	108101	Q8LCZ2	61.23	19	19	8.14E6	3	3	4	Y	39687	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2530	108102	A0A178VZ21	61.23	19	19	8.14E6	3	3	4	Y	39723	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g11880 PE=4 SV=1
2530	108103	Q9SLD9	61.23	19	19	8.14E6	3	3	4	Y	39687	Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g16800 PE=4 SV=1
3258	9229	A0A178W250	61.20	13	13	7.59E5	2	2	2	N	27767	Pyridoxal phosphate homeostasis protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g12310 PE=1 SV=1
3258	9230	O65386	61.20	13	13	7.59E5	2	2	2	N	27767	Pyridoxal phosphate homeostasis protein OS=Arabidopsis thaliana OX=3702 GN=At1g11930 PE=1 SV=1
3258	9231	Q944L8	61.20	13	13	7.59E5	2	2	2	N	28008	Pyridoxal phosphate homeostasis protein OS=Arabidopsis thaliana OX=3702 GN=At1g11930 PE=1 SV=1
3279	108283	Q9LIC6	61.18	23	23	1.07E8	2	2	2	N	21116	PRA1 family protein F3 OS=Arabidopsis thaliana OX=3702 GN=PRA1F3 PE=1 SV=1
3279	108284	A0A178VJ14	61.18	23	23	1.07E8	2	2	2	N	21100	PRA1 family protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g14130 PE=3 SV=1
1968	9339	Q9M1A3	60.99	41	41	9.61E6	4	4	6	Y	13701	At3g59650 OS=Arabidopsis thaliana OX=3702 GN=T16L24.200 PE=2 SV=1
1968	9340	A0A384KLB8	60.99	41	41	9.61E6	4	4	6	Y	13701	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g54060 PE=4 SV=1
1968	8952	F4J9E4	60.99	34	34	9.61E6	4	4	6	Y	16643	Mitochondrial ribosomal protein L51/S25/CI-B8 family protein OS=Arabidopsis thaliana OX=3702 GN=At3g59650 PE=4 SV=1
3071	7823	Q9M1Z0	60.86	6	6	2.43E6	2	2	2	Y	50687	Allyl alcohol dehydrogenase-like protein OS=Arabidopsis thaliana OX=3702 GN=F24G16.110 PE=4 SV=1
3071	7821	A0A384LHS0	60.86	29	29	2.43E6	2	2	2	Y	10500	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g54240 PE=4 SV=1
3071	7822	Q8VZ93	60.86	29	29	2.43E6	2	2	2	Y	10500	Allyl alcohol dehydrogenase-like protein OS=Arabidopsis thaliana OX=3702 GN=F24G16.11 PE=2 SV=1
2917	8418	Q9XIA4	60.83	6	6	2.21E6	2	2	2	Y	59393	Cytochrome c biogenesis protein CCS1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CCS1 PE=1 SV=1
2917	8419	A0A178WB96	60.83	6	6	2.21E6	2	2	2	Y	59540	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g43540 PE=3 SV=1
2540	7752	Q9SVU4	60.74	14	14	7.34E5	2	2	2	N	30977	Tetraspanin-20 OS=Arabidopsis thaliana OX=3702 GN=TOM2AH1 PE=1 SV=1
2540	7753	F4JM26	60.74	12	12	7.34E5	2	2	2	N	36235	Tetraspanin family protein OS=Arabidopsis thaliana OX=3702 GN=At4g28770 PE=4 SV=1
2789	9095	A0A178WG43	60.66	9	9	9.45E6	2	2	2	Y	39387	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g72740 PE=4 SV=1
2789	9096	Q8LBV4	60.66	9	9	9.45E6	2	2	2	Y	39387	Uncharacterized methyltransferase At1g78140, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g78140 PE=1 SV=1
3045	8323	A0A178W5M1	60.63	3	3	2.35E6	2	2	2	Y	82417	DNA ligase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g07910 PE=3 SV=1
3045	8320	Q42572	60.63	3	3	2.35E6	2	2	2	Y	87740	DNA ligase 1 OS=Arabidopsis thaliana OX=3702 GN=LIG1 PE=2 SV=2
2306	59288	Q9FHY6	60.48	12	12	1.19E7	3	3	3	Y	39332	GAMM1 protein-like OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2306	59331	Q94A80	60.48	12	12	1.19E7	3	3	3	Y	39300	AT5g41970/MJC20_7 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2306	59289	A0A178UP13	60.48	11	11	1.19E7	3	3	3	Y	42168	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g39780 PE=4 SV=1
2306	59290	F4K000	60.48	11	11	1.19E7	3	3	3	Y	42299	Metal-dependent protein hydrolase OS=Arabidopsis thaliana OX=3702 GN=MJC20.7 PE=1 SV=1
2028	8012	O22860	60.44	57	57	3.39E7	3	3	3	Y	8122	60S ribosomal protein L38 OS=Arabidopsis thaliana OX=3702 GN=RPL38A PE=3 SV=1
2028	8013	A0A178VC46	60.44	57	57	3.39E7	3	3	3	Y	8122	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g53960 PE=3 SV=1
3260	9532	Q9C6M1	60.44	15	15	2.75E6	2	2	2	N	24809	GDT1-like protein 4 OS=Arabidopsis thaliana OX=3702 GN=At1g25520 PE=2 SV=1
3260	9533	A0A178WM18	60.44	15	15	2.75E6	2	2	2	N	24809	GDT1 family protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g26320 PE=3 SV=1
2180	9345	A0A1I9LRK5	60.41	14	14	2.76E7	3	3	4	Y	26099	DnaJ (DUF3353) OS=Arabidopsis thaliana OX=3702 GN=At3g51140 PE=1 SV=1
2180	9346	Q9SD32	60.41	13	13	2.76E7	3	3	4	Y	27987	Uncharacterized protein F24M12.180 OS=Arabidopsis thaliana OX=3702 GN=F24M12.180 PE=4 SV=1
2180	9347	Q94C78	60.41	11	11	2.76E7	3	3	4	Y	31536	DnaJ (DUF3353) OS=Arabidopsis thaliana OX=3702 GN=At3g51140 PE=1 SV=1
2180	9348	A0A178VJN6	60.41	11	11	2.76E7	3	3	4	Y	31564	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g45420 PE=4 SV=1
3259	8537	F4HX19	60.36	7	7	9.23E6	2	2	2	Y	46630	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=At1g61900 PE=4 SV=1
3259	8538	Q8GUI4	60.36	7	7	9.23E6	2	2	2	Y	47028	Uncharacterized GPI-anchored protein At1g61900 OS=Arabidopsis thaliana OX=3702 GN=At1g61900 PE=2 SV=1
3259	8539	A0A178W389	60.36	7	7	9.23E6	2	2	2	Y	50380	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g55150 PE=4 SV=1
2406	4255	Q9LZ72	60.34	14	14	7.26E6	4	4	4	N	52613	3-ketoacyl-CoA synthase 19 OS=Arabidopsis thaliana OX=3702 GN=KCS19 PE=2 SV=1
2406	4256	A0A178UE05	60.34	14	14	7.26E6	4	4	4	N	52579	3-ketoacyl-CoA synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g03960 PE=3 SV=1
2441	8270	A0A178UY62	60.19	10	10	7.84E6	2	2	3	N	43714	RP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g24550 PE=3 SV=1
2441	8271	O49562	60.19	10	10	7.84E6	2	2	3	N	43684	Pyruvate, phosphate dikinase regulatory protein 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RP1 PE=1 SV=1
2176	108078	Q9ZQE5	60.18	10	10	1.29E7	4	4	4	Y	65614	Pentatricopeptide repeat-containing protein At2g15690, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PCMP-H66 PE=1 SV=2
2176	108079	A0A178VY80	60.18	10	10	1.29E7	4	4	4	Y	66712	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g10840 PE=3 SV=1
2932	6018	A0A178WDU8	60.16	22	22	8.41E6	2	2	3	N	16742	PCR2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g15550 PE=4 SV=1
2932	6019	Q9LQU4	60.16	22	22	8.41E6	2	2	3	N	16742	Protein PLANT CADMIUM RESISTANCE 2 OS=Arabidopsis thaliana OX=3702 GN=PCR2 PE=1 SV=1
2797	60214	A0A178UJ02	60.12	7	7	1.18E7	2	2	2	Y	56371	NRAMP4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g67410 PE=3 SV=1
2797	60213	Q9FN18	60.12	7	7	1.18E7	2	2	2	Y	56385	Metal transporter Nramp4 OS=Arabidopsis thaliana OX=3702 GN=NRAMP4 PE=2 SV=1
2620	59942	F4HWC3	60.04	4	4	3.17E6	3	3	3	Y	150160	Calponin-like domain protein OS=Arabidopsis thaliana OX=3702 GN=At1g20970 PE=1 SV=1
2620	59943	A0A178WH88	60.04	4	4	3.17E6	3	3	3	Y	150216	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g22040 PE=4 SV=1
2620	59944	Q9SYP0	60.04	4	4	3.17E6	3	3	3	Y	165240	F9H16.4 protein OS=Arabidopsis thaliana OX=3702 GN=F9H16.4 PE=4 SV=4
2736	6787	A0A178VNA0	59.99	13	13	3.9E6	3	3	3	N	41586	DJ1D OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g01990 PE=4 SV=1
2902	8493	Q9S7I3	59.95	22	22	1.41E7	2	2	2	Y	11938	Non-specific lipid-transfer protein 2 OS=Arabidopsis thaliana OX=3702 GN=LTP2 PE=3 SV=1
2902	8494	A0A178W063	59.95	22	22	1.41E7	2	2	2	Y	11938	Non-specific lipid-transfer protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g35390 PE=3 SV=1
2897	10002	Q8W486	59.92	6	6	3.55E6	2	2	2	N	59043	O-fucosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=OFUT1 PE=2 SV=1
2897	10003	A0A178W9Z2	59.92	6	6	3.55E6	2	2	2	N	59043	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g04240 PE=4 SV=1
3154	7509	Q9SGW3	59.92	12	12	2.89E6	2	2	2	N	30706	26S proteasome non-ATPase regulatory subunit 8 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPN12A PE=1 SV=1
3154	7510	A0A178WH62	59.92	12	12	2.89E6	2	2	2	N	30706	RPN12a OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g58020 PE=4 SV=1
3176	9268	Q9ZQC2	59.92	4	4	2.99E5	2	2	2	N	106536	Putative receptor-like protein kinase OS=Arabidopsis thaliana OX=3702 GN=At2g37050 PE=4 SV=1
2941	10052	Q570W1	59.91	22	22	9.75E6	2	2	3	Y	14442	AT5G64816 protein OS=Arabidopsis thaliana OX=3702 GN=At5g64816 PE=2 SV=1
2941	10053	Q8L8Q8	59.91	22	22	9.75E6	2	2	3	Y	14442	Uncharacterized protein At5g64816 OS=Arabidopsis thaliana OX=3702 GN=At5g64816 PE=2 SV=1
2941	10054	A0A384K8L2	59.91	22	22	9.75E6	2	2	3	Y	14442	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g64500 PE=4 SV=1
2737	7032	A0A178VEI7	59.89	10	10	8.39E7	3	3	3	N	27926	AIR12 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g07350 PE=4 SV=1
2737	7799	Q94BT2	59.89	11	11	8.39E7	3	3	3	N	25592	Auxin-induced in root cultures protein 12 OS=Arabidopsis thaliana OX=3702 GN=AIR12 PE=1 SV=3
3261	7286	A0A178WBV6	59.84	7	7	1.26E6	2	2	2	N	54547	SUT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g23830 PE=4 SV=1
3261	7287	Q39231	59.84	7	7	1.26E6	2	2	2	N	54547	Sucrose transport protein SUC2 OS=Arabidopsis thaliana OX=3702 GN=SUC2 PE=1 SV=2
2404	4838	A0A178V5H7	59.84	13	13	4.29E6	4	4	4	Y	41893	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g39590 PE=4 SV=1
2404	4839	Q9M169	59.84	13	13	4.29E6	4	4	4	Y	41909	Hydrolase family protein / HAD-superfamily protein OS=Arabidopsis thaliana OX=3702 GN=T6D9_70 PE=2 SV=1
2286	3225	Q9C940	59.59	3	3	2.63E6	2	2	2	N	116742	Uncharacterized protein F14G24.5 OS=Arabidopsis thaliana OX=3702 GN=F14G24.5 PE=4 SV=1
2286	3233	A0A178WME6	59.59	2	2	2.63E6	2	2	2	N	119958	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g47080 PE=1 SV=1
2286	3234	F4IEK8	59.59	2	2	2.63E6	2	2	2	N	119958	PII, uridylyltransferase (DUF2921) OS=Arabidopsis thaliana OX=3702 GN=At1g52780 PE=1 SV=1
2286	3235	Q0WPB8	59.59	2	2	2.63E6	2	2	2	N	119959	Uncharacterized protein At1g52780 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1724	4542	Q8S9J9	59.47	8	8	2.3E6	3	3	3	N	49363	At1g14000/F7A19_9 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
1724	4543	Q9XI87	59.47	8	8	2.3E6	3	3	3	N	49335	At1g14000 OS=Arabidopsis thaliana OX=3702 GN=VH1-interacting kinase PE=2 SV=1
1724	4544	A0A178W4T8	59.47	8	8	2.3E6	3	3	3	N	49335	VIK OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g14520 PE=3 SV=1
1724	4547	Q9LMF8	59.47	8	8	2.3E6	3	3	3	N	50171	F16A14.22 OS=Arabidopsis thaliana OX=3702 PE=3 SV=1
2365	6424	A0A178WG12	59.36	12	12	7.16E6	2	2	3	Y	25601	SIRANBP OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g06770 PE=4 SV=1
2365	6425	Q9LMK7	59.36	12	12	7.16E6	2	2	3	Y	25601	Ran-binding protein 1 homolog a OS=Arabidopsis thaliana OX=3702 GN=RANBP1A PE=1 SV=1
2331	59397	A0A178VZN3	59.34	13	13	1.01E7	4	4	4	N	37121	Sulfotransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g02720 PE=3 SV=1
2331	59398	P52839	59.34	13	13	1.01E7	4	4	4	N	37139	Cytosolic sulfotransferase 12 OS=Arabidopsis thaliana OX=3702 GN=SOT12 PE=1 SV=2
2106	3575	A0A178UQH9	59.34	5	5	5.15E6	4	4	4	Y	124523	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g06620 PE=4 SV=1
2106	3576	Q8RX56	59.34	5	5	5.15E6	4	4	4	Y	124523	Protein unc-13 homolog OS=Arabidopsis thaliana OX=3702 GN=PATROL1 PE=2 SV=1
2106	3584	A0A178UQT3	59.34	5	5	5.15E6	4	4	4	Y	127858	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g06620 PE=4 SV=1
2443	7447	Q8LDQ8	59.25	41	41	1.9E7	2	2	3	N	7756	At5g24165 OS=Arabidopsis thaliana OX=3702 GN=At5g24165 PE=2 SV=1
3008	7467	C0Z3I1	59.19	8	8	4.07E6	2	2	2	Y	49002	AT3G13560 protein OS=Arabidopsis thaliana OX=3702 GN=At3g13560 PE=2 SV=1
3008	7468	A0A178V8S5	59.19	7	7	4.07E6	2	2	2	Y	54400	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g13900 PE=3 SV=1
3008	7469	Q94CD8	59.19	7	7	4.07E6	2	2	2	Y	54416	Glucan endo-1,3-beta-glucosidase 4 OS=Arabidopsis thaliana OX=3702 GN=At3g13560 PE=2 SV=1
2933	5808	A0A2H1ZEH9	59.07	16	16	1.09E7	2	2	3	N	17482	Cysteine proteinase inhibitor OS=Arabidopsis thaliana OX=3702 GN=CYSB PE=1 SV=1
2933	5809	A0A178VK31	59.07	16	16	1.09E7	2	2	3	N	17649	Cysteine proteinase inhibitor OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g12510 PE=3 SV=1
2933	5264	A0A178VLG4	59.07	13	13	1.09E7	2	2	3	N	22477	Cysteine proteinase inhibitor OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g12510 PE=3 SV=1
2933	5278	Q8H0X6	59.07	11	11	1.09E7	2	2	3	N	26294	Cysteine proteinase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=CYS6 PE=1 SV=2
2372	10193	A0A178WDD9	59.05	11	11	8.81E5	3	3	4	N	27334	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g40570 PE=4 SV=1
2372	10194	Q9LPD7	59.05	11	11	8.81E5	3	3	4	N	27715	T12C22.21 protein OS=Arabidopsis thaliana OX=3702 GN=At1g44920 PE=2 SV=1
2776	8839	A0A1I9LNQ7	58.87	10	10	5.72E6	2	2	2	Y	36458	Regulator of chromosome condensation (RCC1) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g02510 PE=4 SV=1
2776	8840	A0A178VFH0	58.87	8	8	5.72E6	2	2	2	Y	42471	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g01730 PE=4 SV=1
2776	8841	Q0WSJ9	58.87	8	8	5.72E6	2	2	2	Y	42501	Regulator of chromosome condensation (RCC1) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g02510 PE=2 SV=1
2865	9823	A0A178VRS5	58.85	16	16	1.07E7	3	3	3	N	23159	PRA1 family protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g37460 PE=3 SV=1
2865	9824	Q9SIY7	58.85	16	16	1.07E7	3	3	3	N	23159	PRA1 family protein B2 OS=Arabidopsis thaliana OX=3702 GN=PRA1B2 PE=1 SV=1
3149	59549	A0A1I9LNL4	58.80	19	19	5.26E6	2	2	2	N	19754	NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g01980 PE=4 SV=1
3149	59554	Q93ZF0	58.80	17	17	5.26E6	2	2	2	N	23202	AT3g01980/F28J7_36 OS=Arabidopsis thaliana OX=3702 GN=At3g01980 PE=2 SV=1
3149	59558	Q8L9W5	58.80	13	13	5.26E6	2	2	2	N	29210	Putative dehydrogenase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3149	59559	A0A384LJ22	58.80	13	13	5.26E6	2	2	2	N	29196	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g01120 PE=4 SV=1
3149	59556	B9DG09	58.80	13	13	5.26E6	2	2	2	N	29224	AT3G01980 protein OS=Arabidopsis thaliana OX=3702 GN=At3g01980 PE=2 SV=1
3149	59557	Q9SG99	58.80	13	13	5.26E6	2	2	2	N	29196	NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g01980 PE=4 SV=1
3149	59560	Q96307	58.80	12	12	5.26E6	2	2	2	N	31511	AT.I.24-3 protein (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT.I.24-3 PE=4 SV=1
3149	59561	Q9SGI2	58.80	12	12	5.26E6	2	2	2	N	32645	F28J7.36 protein OS=Arabidopsis thaliana OX=3702 GN=F28J7.36 PE=4 SV=1
3149	59555	A0A1I9LNL3	58.80	14	14	5.26E6	2	2	2	N	26549	NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g01980 PE=4 SV=1
3148	7625	Q9C7N5	58.72	10	10	5.25E5	2	2	2	N	40142	GDSL esterase/lipase At1g29660 OS=Arabidopsis thaliana OX=3702 GN=At1g29660 PE=1 SV=1
3148	7626	A0A178W3W2	58.72	10	10	5.25E5	2	2	2	N	40143	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g30020 PE=3 SV=1
2748	6777	Q9FR37	58.69	14	14	5.7E6	3	3	3	Y	45056	Amidase 1 OS=Arabidopsis thaliana OX=3702 GN=AMI1 PE=1 SV=1
2748	6778	A0A178WIS5	58.69	14	14	5.7E6	3	3	3	Y	45056	TOC64-I OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g08800 PE=4 SV=1
2866	5027	A0A178VIW0	58.63	18	18	4.58E6	3	3	3	N	33243	TSA1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g49130 PE=3 SV=1
2866	5028	Q42529	58.63	18	18	4.58E6	3	3	3	N	33200	Tryptophan synthase alpha chain, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TSA1 PE=1 SV=1
1685	4768	Q56XR7	58.44	14	14	1.34E7	3	3	3	N	29011	Rhodanese-like domain-containing protein 4A, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=STR4A PE=2 SV=1
2270	8721	Q9LHN3	58.37	5	5	0E0	2	2	2	Y	84274	AT3g18860/MCB22_3 OS=Arabidopsis thaliana OX=3702 GN=At3g18860 PE=2 SV=1
2270	8722	F4J9W8	58.37	5	5	0E0	2	2	2	Y	84300	Transducin family protein / WD-40 repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At3g18860 PE=4 SV=1
3131	108205	A0A178VQY4	58.32	7	7	4.32E6	2	2	2	N	55580	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g24550 PE=4 SV=1
3131	108206	Q9SK09	58.32	7	7	4.32E6	2	2	2	N	55705	Vicilin-like seed storage protein At2g28490 OS=Arabidopsis thaliana OX=3702 GN=At2g28490 PE=2 SV=1
2264	7312	Q8RXM5	58.29	26	26	4.65E6	3	3	5	Y	30572	Tryptophan RNA-binding attenuator protein-like protein OS=Arabidopsis thaliana OX=3702 GN=MQL5.28 PE=2 SV=1
2264	7313	A0A178UJL8	58.29	26	26	4.65E6	3	3	5	Y	30572	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g45870 PE=4 SV=1
2880	4798	A0A178UPE2	58.27	8	8	1.09E6	3	3	3	Y	65527	SNX2a OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g57810 PE=4 SV=1
2880	4799	Q8L5Z7	58.27	8	8	1.09E6	3	3	3	Y	65527	Sorting nexin 2A OS=Arabidopsis thaliana OX=3702 GN=SNX2A PE=1 SV=1
3147	108245	Q8LAL0	58.26	14	14	3.71E6	2	2	2	Y	30771	Protein SCO1 homolog 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HCC2 PE=2 SV=1
3147	108246	A0A178V000	58.26	14	14	3.71E6	2	2	2	Y	30771	HCC2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g45120 PE=4 SV=1
2874	12384	Q9T0K6	58.15	8	8	4.18E6	3	3	3	N	64935	Uncharacterized protein AT4g13350 OS=Arabidopsis thaliana OX=3702 GN=At4g13350 PE=4 SV=1
2874	12385	Q8W4K6	58.15	8	8	4.18E6	3	3	3	N	65027	At4g13350 OS=Arabidopsis thaliana OX=3702 GN=NIG PE=1 SV=1
2874	12386	A0A178V2M7	58.15	8	8	4.18E6	3	3	3	N	65027	NIG OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g15140 PE=1 SV=1
2762	10046	A0A384LLQ1	58.07	7	7	1.58E5	2	2	2	Y	82197	LRS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g04570 PE=1 SV=1
1924	6790	Q9LFW2	58.02	8	8	2.02E7	2	2	3	N	38062	Putative mitochondrial carrier protein OS=Arabidopsis thaliana OX=3702 GN=F14F8_20 PE=3 SV=1
2785	6420	F4K2Y3	58.02	4	4	3.17E6	2	2	2	N	81306	Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAB16.20 PE=1 SV=1
2741	6793	Q9SW96	57.97	7	7	6.62E6	3	3	3	Y	63783	Asparagine--tRNA ligase, cytoplasmic 1 OS=Arabidopsis thaliana OX=3702 GN=SYNC1 PE=1 SV=1
2741	6794	A0A178UI63	57.97	7	7	6.62E6	3	3	3	Y	63797	SYNC1 ARATH OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g55880 PE=3 SV=1
2740	3345	A0A178WJ50	57.95	4	4	4.64E6	3	3	3	Y	160013	NUP155 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g15530 PE=4 SV=1
2740	3346	F4HXV6	57.95	4	4	4.64E6	3	3	3	Y	160013	Nuclear pore complex protein NUP155 OS=Arabidopsis thaliana OX=3702 GN=NUP155 PE=1 SV=1
2345	6840	Q9ASQ2	57.88	15	15	5.34E6	3	3	3	N	34363	Transcription factor MAMYB OS=Arabidopsis thaliana OX=3702 GN=MAMYB PE=1 SV=1
2410	4156	A0A178UFX8	57.87	13	13	1.82E7	3	3	3	N	30476	Proteasome subunit alpha type OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g40700 PE=3 SV=1
2410	4157	P34066	57.87	13	13	1.82E7	3	3	3	N	30476	Proteasome subunit alpha type-1-A OS=Arabidopsis thaliana OX=3702 GN=PAF1 PE=1 SV=3
2410	7909	A0A178W3Q0	57.87	13	13	1.82E7	3	3	3	N	30396	Proteasome subunit alpha type OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g41200 PE=3 SV=1
2410	7910	O23712	57.87	13	13	1.82E7	3	3	3	N	30410	Proteasome subunit alpha type-1-B OS=Arabidopsis thaliana OX=3702 GN=PAF2 PE=1 SV=2
3299	108299	Q9C9B5	57.85	27	27	6.91E6	2	2	2	N	17082	At1g73940/F2P9_19 OS=Arabidopsis thaliana OX=3702 GN=At1g73940 PE=2 SV=1
3299	108300	A0A178W7B5	57.85	27	27	6.91E6	2	2	2	N	17082	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g68230 PE=4 SV=1
3300	16495	Q9CAK8	57.82	15	15	3.2E6	2	2	2	N	24812	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ISPF PE=1 SV=1
3300	16496	A0A178W7L9	57.82	15	15	3.2E6	2	2	2	N	24828	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g57420 PE=3 SV=1
2904	10218	A0A178UPX9	57.79	6	6	6.51E6	2	2	2	N	46831	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g08990 PE=4 SV=1
2904	10219	Q94B59	57.79	6	6	6.51E6	2	2	2	N	46809	Pentatricopeptide repeat-containing protein At5g09450, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g09450 PE=1 SV=1
3062	9637	Q9FRL3	57.78	5	5	1.01E7	2	2	2	N	52901	Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana OX=3702 GN=At1g75220 PE=1 SV=1
3062	9638	A0A178WMP1	57.78	5	5	1.01E7	2	2	2	N	52873	ERDL6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g69650 PE=3 SV=1
3270	108265	P33487	57.66	16	16	9.07E6	2	2	2	Y	22044	Auxin-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=ERABP1 PE=1 SV=1
2899	9776	Q9M085	57.66	8	8	2.54E6	2	2	2	Y	46084	AT4G31170 protein OS=Arabidopsis thaliana OX=3702 GN=At4g31170 PE=2 SV=1
2899	9777	A0A384L4R2	57.66	8	8	2.54E6	2	2	2	Y	46084	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g35710 PE=4 SV=1
2414	108089	A0A178VTR1	57.64	10	10	1.15E7	3	3	3	N	46698	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g32530 PE=4 SV=1
2414	108090	Q9SJ62	57.64	10	10	1.15E7	3	3	3	N	46697	Protein WVD2-like 4 OS=Arabidopsis thaliana OX=3702 GN=WDL4 PE=1 SV=2
2888	59898	A0A178WF52	57.59	9	9	3.68E7	2	2	2	Y	26059	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g33360 PE=4 SV=1
2888	59899	Q9C7Y2	57.59	9	9	3.68E7	2	2	2	Y	26024	Multiple organellar RNA editing factor 5, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MORF5 PE=1 SV=1
2771	6937	A0A384L0V1	57.58	6	6	6.58E6	2	2	2	N	53449	ERO2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g35870 PE=4 SV=1
2771	6938	Q501C9	57.58	6	6	6.58E6	2	2	2	N	53449	At2g38960 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2771	6939	Q7X9I4	57.58	6	6	6.58E6	2	2	2	N	53449	Endoplasmic reticulum oxidoreductin-2 OS=Arabidopsis thaliana OX=3702 GN=AERO2 PE=1 SV=1
2771	6940	Q56Y10	57.58	6	6	6.58E6	2	2	2	N	53449	Uncharacterized protein At2g38960 OS=Arabidopsis thaliana OX=3702 GN=At2g38960 PE=2 SV=1
2771	6941	F4IU11	57.58	6	6	6.58E6	2	2	2	N	54180	Endoplasmic reticulum oxidoreductins 2 OS=Arabidopsis thaliana OX=3702 GN=ERO2 PE=4 SV=1
2771	6942	F4IU09	57.58	6	6	6.58E6	2	2	2	N	54459	Endoplasmic reticulum oxidoreductins 2 OS=Arabidopsis thaliana OX=3702 GN=ERO2 PE=4 SV=1
2796	8150	A0A178VCA7	57.52	10	10	1.56E7	2	2	3	N	36931	NAP7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g10520 PE=4 SV=1
2796	8151	Q9CAF5	57.52	10	10	1.56E7	2	2	3	N	36931	ABC transporter I family member 6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABCI6 PE=1 SV=1
2894	3863	P42804	57.44	6	6	4.75E6	2	2	2	Y	59515	Glutamyl-tRNA reductase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HEMA1 PE=1 SV=2
2684	8710	Q9SHU7	57.39	10	10	2.41E7	2	2	2	N	31276	Protein TIC 21, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIC21 PE=1 SV=1
2551	5917	Q42191	57.37	7	7	5.08E6	2	2	2	N	47860	Mitochondrial inner membrane protein OXA1 OS=Arabidopsis thaliana OX=3702 GN=OXA1 PE=2 SV=2
2551	5918	A0A178UA29	57.37	7	7	5.08E6	2	2	2	N	47860	OXA1AT OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g61540 PE=3 SV=1
2570	8409	A0A1P8AU99	57.37	12	12	6.1E5	3	2	3	N	29451	Rhodanese homologue 2 OS=Arabidopsis thaliana OX=3702 GN=RDH2 PE=4 SV=1
2570	8422	A0A1P8AU81	57.37	11	11	6.1E5	3	2	3	N	32146	Rhodanese homologue 2 OS=Arabidopsis thaliana OX=3702 GN=RDH2 PE=4 SV=1
2570	8437	A0A178W5B2	57.37	10	10	6.1E5	3	2	3	N	34717	Sulfurtransferase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g17240 PE=4 SV=1
2570	8443	Q24JL3	57.37	9	9	6.1E5	3	2	3	N	37412	Thiosulfate/3-mercaptopyruvate sulfurtransferase 2 OS=Arabidopsis thaliana OX=3702 GN=STR2 PE=1 SV=1
2755	6713	Q9LUC9	57.33	9	9	4.8E6	3	2	3	N	58138	Cytochrome P450 72A11 OS=Arabidopsis thaliana OX=3702 GN=CYP72A11 PE=2 SV=1
2755	6714	A0A178V9F5	57.33	9	9	4.8E6	3	2	3	N	58116	CYP72A11 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g15280 PE=4 SV=1
2656	3239	Q9SA18	57.29	5	5	7.39E6	3	3	3	Y	99404	Bifunctional aspartokinase/homoserine dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AKHSDH1 PE=1 SV=1
2656	4230	A0A178WJ13	57.29	5	5	7.39E6	3	3	3	Y	99637	AK-HSDH I OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g31850 PE=4 SV=1
2884	11692	Q94C53	57.25	12	12	2.16E6	3	3	3	Y	34019	DDRGK domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=At4g27120 PE=2 SV=1
2884	11693	A0A178UZS7	57.25	12	12	2.16E6	3	3	3	Y	34019	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g31270 PE=4 SV=1
2446	11547	A0A178U8A3	57.23	14	14	1.32E7	2	2	3	N	26645	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_ATUG01840 PE=4 SV=1
2446	11548	Q9LHC4	57.23	13	13	1.32E7	2	2	3	N	27432	6,7-dimethyl-8-ribityllumazine synthase OS=Arabidopsis thaliana OX=3702 GN=At3g32930 PE=1 SV=1
2760	5430	A0A178WIG2	57.12	4	4	1.04E6	2	2	2	N	108354	GC5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g74670 PE=4 SV=1
2760	5431	Q0WVL7	57.12	4	4	1.04E6	2	2	2	N	108354	Golgin candidate 5 OS=Arabidopsis thaliana OX=3702 GN=GC5 PE=1 SV=1
2760	5432	A0A1P8AQY7	57.12	4	4	1.04E6	2	2	2	N	109756	Golgin Putative 5 OS=Arabidopsis thaliana OX=3702 GN=GC5 PE=1 SV=1
2760	5433	F4HQB9	57.12	4	4	1.04E6	2	2	2	N	110726	Golgin Putative 5 OS=Arabidopsis thaliana OX=3702 GN=GC5 PE=1 SV=1
1977	8380	Q681K2	57.06	17	17	2.45E7	3	3	4	Y	19949	Embryo-specific protein ATS3A OS=Arabidopsis thaliana OX=3702 GN=ATS3A PE=1 SV=1
1977	8381	A0A178VX80	57.06	17	17	2.45E7	3	3	4	Y	19949	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g38730 PE=4 SV=1
2514	4783	F4KCT5	57.03	12	12	5.18E6	4	4	4	Y	45726	Carboxypeptidase OS=Arabidopsis thaliana OX=3702 GN=SCPL34 PE=3 SV=1
2514	4784	A0A1P8BEA9	57.03	12	12	5.18E6	4	4	4	Y	45733	Carboxypeptidase OS=Arabidopsis thaliana OX=3702 GN=SCPL34 PE=3 SV=1
2514	4785	A0A178UEQ5	57.03	10	10	5.18E6	4	4	4	Y	56354	Carboxypeptidase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g22750 PE=3 SV=1
2514	4786	Q0WPR4	57.03	10	10	5.18E6	4	4	4	Y	56329	Serine carboxypeptidase-like 34 OS=Arabidopsis thaliana OX=3702 GN=SCPL34 PE=2 SV=2
2704	7396	A8MS48	56.91	16	16	2.15E7	2	2	3	N	17858	Low-density receptor-like protein OS=Arabidopsis thaliana OX=3702 GN=MTG13.11 PE=4 SV=1
2704	7413	Q8W480	56.91	15	15	2.15E7	2	2	3	N	18187	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2704	7397	A0A178U7E8	56.91	15	15	2.15E7	2	2	3	N	18177	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g16300 PE=4 SV=1
2704	7398	Q8H0X5	56.91	15	15	2.15E7	2	2	3	N	18177	Low-density receptor-like protein OS=Arabidopsis thaliana OX=3702 GN=MTG13.11 PE=2 SV=1
2704	7414	Q9C5U9	56.91	15	15	2.15E7	2	2	3	N	19372	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2297	6917	Q9C8N0	56.80	11	11	9.44E6	2	2	2	N	30607	K+-H+ exchange-like protein OS=Arabidopsis thaliana OX=3702 GN=F22G10.1 PE=2 SV=1
2297	6918	Q6NQN0	56.80	11	11	9.44E6	2	2	2	N	30617	At1g53760 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2297	6919	A0A178WHB2	56.80	11	11	9.44E6	2	2	2	N	30576	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g48190 PE=4 SV=1
2244	7183	A0A2P2CLE9	56.77	6	6	4.58E7	3	3	3	N	54168	NADH dehydrogenase subunit 2 OS=Arabidopsis thaliana OX=3702 GN=nad2 PE=3 SV=2
2244	7184	O05000	56.77	6	6	4.58E7	3	3	3	N	55450	NADH-ubiquinone oxidoreductase chain 2 OS=Arabidopsis thaliana OX=3702 GN=ND2 PE=2 SV=2
3155	9398	Q9XH48	56.71	40	40	8.38E6	2	2	2	Y	9412	Mitochondrial import inner membrane translocase subunit TIM13 OS=Arabidopsis thaliana OX=3702 GN=TIM13 PE=1 SV=2
3155	9399	A0A178WLR5	56.71	40	40	8.38E6	2	2	2	Y	9412	TIM13 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g54800 PE=3 SV=1
2241	6248	Q9SJB9	56.66	34	34	1.85E7	4	4	5	Y	16638	Nucleic acid-binding, OB-fold-like protein OS=Arabidopsis thaliana OX=3702 GN=At2g04520 PE=2 SV=1
2241	6249	A0A178VW73	56.66	34	34	1.85E7	4	4	5	Y	16638	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g03670 PE=3 SV=1
2241	7685	Q93VF1	56.66	34	34	1.85E7	4	4	5	Y	16624	At2g04520/T1O3.7 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2937	8414	F4I0N7	56.53	25	25	6.04E6	3	3	3	Y	10646	GAST1 protein homolog 1 OS=Arabidopsis thaliana OX=3702 GN=GASA1 PE=4 SV=1
2937	8415	P46689	56.53	24	24	6.04E6	3	3	3	Y	10745	Gibberellin-regulated protein 1 OS=Arabidopsis thaliana OX=3702 GN=GASA1 PE=2 SV=2
2937	8416	A0A178W4S5	56.53	24	24	6.04E6	3	3	3	Y	10745	GASA1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g70200 PE=4 SV=1
2937	8417	A0A178W6H5	56.53	19	19	6.04E6	3	3	3	Y	14501	GASA1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g70200 PE=4 SV=1
3274	9191	Q96282	56.48	4	4	6.43E6	2	2	2	Y	85232	Chloride channel protein CLC-c OS=Arabidopsis thaliana OX=3702 GN=CLC-C PE=1 SV=1
3274	9192	A0A178UHL0	56.48	4	4	6.43E6	2	2	2	Y	85260	CLC-C OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g48730 PE=3 SV=1
2665	7928	A0A1P8AQY1	56.44	8	8	8.97E5	2	2	2	N	53039	Pentatricopeptide repeat (PPR) superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g64430 PE=4 SV=1
2665	7929	Q9SGX1	56.44	8	8	8.97E5	2	2	2	N	57179	F1N19.1 OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2665	7930	Q9C7W6	56.44	7	7	8.97E5	2	2	2	N	60082	Uncharacterized protein F15H21.10 OS=Arabidopsis thaliana OX=3702 GN=F15H21.10 PE=4 SV=1
2665	7931	Q8VYZ8	56.44	7	7	8.97E5	2	2	2	N	61622	Pentatricopeptide repeat (PPR) superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g64430 PE=2 SV=1
2258	7195	Q9LXA8	56.40	6	6	8.47E5	4	4	4	Y	87185	Probable beta-D-xylosidase 6 OS=Arabidopsis thaliana OX=3702 GN=BXL6 PE=2 SV=1
2258	8708	A0A178U815	56.40	6	6	8.47E5	4	4	4	Y	87141	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g10220 PE=4 SV=1
3153	7898	Q9LYB4	56.34	13	13	4.61E6	2	2	2	N	19327	Probable glutathione peroxidase 5 OS=Arabidopsis thaliana OX=3702 GN=GPX5 PE=1 SV=1
3153	7903	A0A178VDY2	56.34	1	1	4.61E6	2	2	2	N	169823	Glutathione peroxidase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g57360 PE=3 SV=1
2927	60167	Q9SL05	56.33	19	19	2.96E7	2	2	3	Y	14293	Protein PROTON GRADIENT REGULATION 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGR5 PE=1 SV=1
2927	60168	A0A178VUF3	56.33	19	19	2.96E7	2	2	3	Y	14293	PGR5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g04690 PE=4 SV=1
3061	9540	Q9SKM7	56.25	33	33	1.17E7	2	2	2	N	9786	At2g28430/T1B3.5 OS=Arabidopsis thaliana OX=3702 GN=At2g28430 PE=2 SV=1
3061	9541	A0A178VQW6	56.25	33	33	1.17E7	2	2	2	N	9786	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g24480 PE=4 SV=1
3375	11799	A0A178UA91	56.23	25	25	3.74E7	2	2	2	N	7341	RPS28 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g63740 PE=3 SV=1
3375	11800	P34789	56.23	25	25	3.74E7	2	2	2	N	7341	40S ribosomal protein S28-2 OS=Arabidopsis thaliana OX=3702 GN=RPS28C PE=3 SV=1
2765	6401	A0A1I9LTP8	56.19	25	25	2.51E6	2	2	2	N	15599	Cyanase OS=Arabidopsis thaliana OX=3702 GN=CYN PE=4 SV=1
2765	59292	A0A178VD28	56.19	21	21	2.51E6	2	2	2	N	18592	Cyanate hydratase OS=Arabidopsis thaliana OX=3702 GN=CYN PE=3 SV=1
2765	59402	Q8LDF0	56.19	21	21	2.51E6	2	2	2	N	18560	Cyanate hydratase OS=Arabidopsis thaliana OX=3702 GN=CYN PE=2 SV=1
2765	59293	O22683	56.19	21	21	2.51E6	2	2	2	N	18592	Cyanate hydratase OS=Arabidopsis thaliana OX=3702 GN=CYN PE=2 SV=1
3150	10175	Q94JQ7	56.18	20	20	2.22E6	2	2	2	N	16887	At1g07830/F24B9_7 OS=Arabidopsis thaliana OX=3702 GN=At1g07830 PE=1 SV=1
3150	10176	A0A178WKQ3	56.18	20	20	2.22E6	2	2	2	N	16897	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g07530 PE=4 SV=1
3150	10177	Q9LQQ5	56.18	16	16	2.22E6	2	2	2	N	21425	F24B9.7 protein OS=Arabidopsis thaliana OX=3702 GN=F24B9.7 PE=4 SV=1
3268	7664	Q0WSE0	56.16	14	14	1.86E6	2	2	2	Y	22053	Uncharacterized protein At3g06035 OS=Arabidopsis thaliana OX=3702 GN=At3g06035 PE=2 SV=1
3268	7665	A0A384KMG2	56.16	14	14	1.86E6	2	2	2	Y	22053	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g05730 PE=4 SV=1
3268	7666	Q84MC0	56.16	14	14	1.86E6	2	2	2	Y	22053	Uncharacterized GPI-anchored protein At3g06035 OS=Arabidopsis thaliana OX=3702 GN=At3g06035 PE=2 SV=1
2893	6379	A0A178UCJ4	56.13	4	4	2.47E6	2	2	2	Y	76717	Acetyl-coenzyme A synthetase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g33780 PE=3 SV=1
2893	6380	A0A178UC31	56.13	4	4	2.47E6	2	2	2	Y	81873	Acetyl-coenzyme A synthetase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g33780 PE=3 SV=1
2893	6381	B9DGD6	56.13	4	4	2.47E6	2	2	2	Y	81889	Acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal OS=Arabidopsis thaliana OX=3702 GN=ACS PE=1 SV=1
2347	108098	Q8L7U0	56.09	10	10	5.33E6	3	3	3	N	35789	AT3g03330/T21P5_25 OS=Arabidopsis thaliana OX=3702 GN=At3g03330 PE=2 SV=1
2347	108099	A0A384L1S2	56.09	10	10	5.33E6	3	3	3	N	35789	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g02690 PE=4 SV=1
2347	108100	Q9SRN7	56.09	10	10	5.33E6	3	3	3	N	37637	T21P5.25 protein OS=Arabidopsis thaliana OX=3702 GN=T21P5.25 PE=4 SV=1
3264	8873	F4JFR2	56.08	14	14	2.69E7	2	2	2	N	25719	Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=FLU PE=4 SV=1
3264	8874	A0A178VAG9	56.08	10	10	2.69E7	2	2	2	N	34587	FLU OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g14640 PE=4 SV=1
3264	8875	Q940U6	56.08	10	10	2.69E7	2	2	2	N	34587	Protein FLUORESCENT IN BLUE LIGHT, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FLU PE=1 SV=1
3264	8876	F4JFR1	56.08	10	10	2.69E7	2	2	2	N	34686	Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=FLU PE=4 SV=1
2606	7174	O81062	56.08	9	9	1.39E7	2	2	3	N	38339	Signal peptide peptidase OS=Arabidopsis thaliana OX=3702 GN=SPP PE=2 SV=1
2606	7175	A0A178VY21	56.08	9	9	1.39E7	2	2	3	N	38339	SPP OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g02090 PE=4 SV=1
3307	108313	Q9FGC2	56.07	4	4	2.82E6	2	2	2	N	81453	DNA helicase-like OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
3307	108314	F4K1G7	56.07	3	3	2.82E6	2	2	2	N	105048	P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MEE13.8 PE=4 SV=1
3307	108315	A0A178UJD5	56.07	3	3	2.82E6	2	2	2	N	104973	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g33380 PE=4 SV=1
1880	59593	A0A178VX92	55.95	3	3	6.58E6	3	2	4	N	110995	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g39070 PE=3 SV=1
1880	59594	O22941	55.95	3	3	6.58E6	3	2	4	N	110995	Insulin-degrading enzyme-like 1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=PXM16 PE=2 SV=1
2073	8732	A0A1P8ASM3	55.91	7	7	8.79E4	2	2	2	N	49470	RING/U-box superfamily protein OS=Arabidopsis thaliana OX=3702 GN=Hrd1B PE=4 SV=1
2073	8738	A0A178WKT8	55.91	7	7	8.79E4	2	2	2	N	52155	Hrd1B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g58650 PE=4 SV=1
2073	8735	Q6NPT7	55.91	7	7	8.79E4	2	2	2	N	52127	ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana OX=3702 GN=HRD1B PE=2 SV=1
2538	7768	Q9LZX6	55.88	12	12	1.1E7	3	3	4	N	40620	4-hydroxy-tetrahydrodipicolinate synthase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DHDPS1 PE=2 SV=2
2538	7769	A0A178V8R0	55.88	12	12	1.1E7	3	3	4	N	40649	DHDPS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g55250 PE=3 SV=1
2036	10341	O82209	55.88	15	15	6.35E7	2	2	5	N	13847	Copia-like retroelement pol polyprotein OS=Arabidopsis thaliana OX=3702 GN=At2g19680 PE=2 SV=1
2036	10342	A0A178VVR9	55.88	15	15	6.35E7	2	2	5	N	13833	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g15020 PE=4 SV=1
2877	6139	Q9ASV6	55.78	25	25	2.38E7	3	3	3	N	21826	30S ribosomal protein S20, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPS20 PE=2 SV=1
2877	6140	A0A178VMN1	55.78	25	25	2.38E7	3	3	3	N	21826	PRPS20 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g15850 PE=3 SV=1
2315	5596	Q93ZN2	55.75	9	9	1.24E7	2	2	4	N	37925	Probable aldo-keto reductase 4 OS=Arabidopsis thaliana OX=3702 GN=At1g60710 PE=2 SV=1
3265	9529	Q39096	55.73	18	18	5.76E6	2	2	2	N	18411	Protein EARLY RESPONSIVE TO DEHYDRATION 15 OS=Arabidopsis thaliana OX=3702 GN=ERD15 PE=1 SV=1
3265	9530	A0A178VWR6	55.73	18	18	5.76E6	2	2	2	N	18411	LSR1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g38650 PE=4 SV=1
2940	13056	Q941A0	55.69	25	25	7.46E6	2	2	3	N	16841	Succinate dehydrogenase subunit 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SDH4 PE=1 SV=1
2940	13057	A0A178VQB2	55.69	25	25	7.46E6	2	2	3	N	16841	SDH4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g44150 PE=4 SV=1
2861	108109	A0A178WCP3	55.65	21	21	3.05E6	3	3	3	Y	31291	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g19410 PE=4 SV=1
2861	108110	Q1G3U6	55.65	21	21	3.05E6	3	3	3	Y	31291	Plant cysteine oxidase 3 OS=Arabidopsis thaliana OX=3702 GN=PCO3 PE=1 SV=1
2624	8556	A0A178VC39	55.61	6	6	6.22E6	2	2	2	N	71408	Mitochondrial Rho GTPase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g57430 PE=3 SV=1
2624	8557	F4J0W4	55.61	6	6	6.22E6	2	2	2	N	71408	Mitochondrial Rho GTPase 2 OS=Arabidopsis thaliana OX=3702 GN=MIRO2 PE=2 SV=1
2801	8341	A0A178V2P2	55.60	12	12	9.33E6	2	2	3	N	41317	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g19000 PE=3 SV=1
2801	8342	Q9SUL1	55.60	12	12	9.33E6	2	2	3	N	41264	Probable cysteine protease RD19C OS=Arabidopsis thaliana OX=3702 GN=RD19C PE=2 SV=1
2739	108105	A0A178VEJ2	55.56	18	18	1.26E6	3	3	3	N	35083	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g09910 PE=4 SV=1
2739	108106	Q9SR77	55.56	18	18	1.26E6	3	3	3	N	35035	Heme-binding-like protein At3g10130, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g10130 PE=1 SV=1
1917	4061	A0A384L3S6	55.48	5	5	1.19E7	4	4	4	Y	103403	Coatomer subunit beta' OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g16770 PE=3 SV=1
2870	7963	A0A178V2Y0	55.48	12	12	1.67E7	3	3	3	Y	40401	LTO1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g40860 PE=4 SV=1
2870	7964	Q8L540	55.48	12	12	1.67E7	3	3	3	Y	40401	Thiol-disulfide oxidoreductase LTO1 OS=Arabidopsis thaliana OX=3702 GN=LTO1 PE=1 SV=1
2870	7967	A0A1P8B950	55.48	12	12	1.67E7	3	3	3	Y	41288	NAD(P)H dehydrogenase (Quinone)s OS=Arabidopsis thaliana OX=3702 GN=LTO1 PE=4 SV=1
3159	6693	A0A178UAB0	55.41	7	7	2.34E6	2	2	2	N	76132	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g49160 PE=4 SV=1
3159	5549	Q945N1	55.41	7	7	2.34E6	2	2	2	N	76143	AT5g50310/MXI22_1 OS=Arabidopsis thaliana OX=3702 GN=MXI22.1 PE=2 SV=1
2355	5354	Q9FZ48	55.38	20	20	9.18E5	2	2	2	N	17220	Ubiquitin-conjugating enzyme E2 36 OS=Arabidopsis thaliana OX=3702 GN=UBC36 PE=1 SV=1
2778	6828	A0A178UN62	55.36	10	10	1.1E7	2	2	2	Y	24438	NdhU OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g21200 PE=4 SV=1
2778	6829	Q84VQ4	55.36	10	10	1.1E7	2	2	2	Y	24438	NAD(P)H-quinone oxidoreductase subunit U, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhU PE=1 SV=1
3009	7826	P55034	55.34	7	7	1.63E7	2	2	2	Y	40757	26S proteasome non-ATPase regulatory subunit 4 homolog OS=Arabidopsis thaliana OX=3702 GN=RPN10 PE=1 SV=1
3009	7827	A0A178V4I4	55.34	7	7	1.63E7	2	2	2	Y	40757	RPN10 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g43970 PE=4 SV=1
2559	8977	A0A178VUN5	55.34	9	9	6.34E6	2	2	3	N	40848	Emb1381 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g27560 PE=4 SV=1
2559	9066	F4IQS9	55.34	6	6	6.34E6	2	2	3	N	64382	Embryo defective 1381 OS=Arabidopsis thaliana OX=3702 GN=emb1381 PE=4 SV=1
2559	9067	A0A178VSV6	55.34	6	6	6.34E6	2	2	3	N	64382	Emb1381 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g27560 PE=4 SV=1
2051	3153	A0A178W376	55.24	9	9	8.83E6	4	4	4	Y	102858	Nitrate reductase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g37760 PE=3 SV=1
2051	3154	Q0WUE2	55.24	9	9	8.83E6	4	4	4	Y	102786	Nitrate reductase OS=Arabidopsis thaliana OX=3702 GN=At1g37130 PE=2 SV=1
2051	3155	Q94C76	55.24	9	9	8.83E6	4	4	4	Y	102920	Nitrate reductase OS=Arabidopsis thaliana OX=3702 GN=At1g37130 PE=2 SV=1
2051	3156	P11035	55.24	9	9	8.83E6	4	4	4	Y	102844	Nitrate reductase [NADH] 2 OS=Arabidopsis thaliana OX=3702 GN=NIA2 PE=1 SV=1
2051	3157	Q0WLH2	55.24	9	9	8.83E6	4	4	4	Y	102844	Nitrate reductase OS=Arabidopsis thaliana OX=3702 GN=At1g37130 PE=2 SV=1
3267	108261	A0A178VJB0	55.23	5	5	5.91E6	2	2	2	Y	109178	BAM2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g43820 PE=3 SV=1
3267	7404	Q9M2Z1	55.23	5	5	5.91E6	2	2	2	Y	109244	Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana OX=3702 GN=BAM2 PE=1 SV=1
3267	108262	A0A178UM62	55.23	5	5	5.91E6	2	2	2	Y	109203	BAM1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g65580 PE=3 SV=1
3267	108263	O49545	55.23	5	5	5.91E6	2	2	2	Y	109203	Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana OX=3702 GN=BAM1 PE=1 SV=1
2681	108177	Q39165	55.17	12	12	1.41E7	2	2	3	Y	21279	Oleosin 21.2 kDa OS=Arabidopsis thaliana OX=3702 GN=At5g40420 PE=2 SV=1
2681	108178	A0A178UA73	55.17	12	12	1.41E7	2	2	3	Y	21279	OLEO2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g38150 PE=4 SV=1
2437	7368	Q8GUL8	55.15	22	22	6.64E6	3	3	4	Y	20511	Uncharacterized GPI-anchored protein At5g19230 OS=Arabidopsis thaliana OX=3702 GN=At5g19230 PE=2 SV=1
3160	6131	Q8VY12	55.14	8	8	4.16E6	2	2	2	N	47169	Glycosyl hydrolase family 17 protein OS=Arabidopsis thaliana OX=3702 GN=MJB21.9 PE=2 SV=1
2360	9139	Q6ZY51	55.09	3	3	1.87E6	2	2	2	Y	131322	Phosphoglucan, water dikinase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GWD3 PE=1 SV=1
2360	9140	A0A178UG93	55.09	3	3	1.87E6	2	2	2	Y	131322	PWD OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g26400 PE=4 SV=1
2272	108170	A0A178UPZ4	55.02	3	3	9.12E5	2	2	2	Y	85180	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g45410 PE=4 SV=1
2272	108171	Q9FJR9	55.02	3	3	9.12E5	2	2	2	Y	85180	Nuclear intron maturase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NMAT2 PE=1 SV=1
2635	5350	F4I9A1	54.98	2	2	4.08E6	2	2	3	N	202119	TGN-related, localized SYP41 interacting protein OS=Arabidopsis thaliana OX=3702 GN=TNO1 PE=1 SV=1
2635	6573	F4I9A2	54.98	2	2	4.08E6	2	2	3	N	193589	TGN-related, localized SYP41 interacting protein OS=Arabidopsis thaliana OX=3702 GN=TNO1 PE=1 SV=1
2635	5351	Q9FYL7	54.98	2	2	4.08E6	2	2	3	N	208602	F21J9.12 OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2635	6574	F1BCU1	54.98	2	2	4.08E6	2	2	3	N	197607	TGN-localized SYP41-interacting protein OS=Arabidopsis thaliana OX=3702 GN=TNO1 PE=2 SV=1
2635	5347	A0A178VZM8	54.98	2	2	4.08E6	2	2	3	N	197489	TNO1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g25730 PE=4 SV=1
3266	11801	A0A178W075	54.97	28	28	5.26E6	2	2	2	Y	12655	EDA3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g31420 PE=4 SV=1
3266	11802	O64750	54.97	18	18	5.26E6	2	2	2	Y	19943	Protein PHOTOSYSTEM I ASSEMBLY 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSA2 PE=1 SV=1
2506	2714	O65220	54.88	17	17	2.87E7	4	4	4	Y	30505	Peptidyl-prolyl cis-trans isomerase CYP28, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CYP28 PE=1 SV=1
2506	2715	A0A1P8B9P2	54.88	17	17	2.87E7	4	4	4	Y	31386	Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein OS=Arabidopsis thaliana OX=3702 GN=At5g35100 PE=4 SV=1
2506	2716	A0A384LLJ4	54.88	17	17	2.87E7	4	4	4	Y	31386	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g31220 PE=4 SV=1
2678	108158	A0A1P8B6K2	54.74	2	2	9.92E5	2	2	2	N	151208	Modifier of snc1 OS=Arabidopsis thaliana OX=3702 GN=MOS1 PE=1 SV=1
2678	108159	Q9SB63	54.74	2	2	9.92E5	2	2	2	N	153687	Protein MODIFIER OF SNC1 1 OS=Arabidopsis thaliana OX=3702 GN=MOS1 PE=1 SV=2
2678	108160	A0A178V4V5	54.74	2	2	9.92E5	2	2	2	N	153564	MOS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g28560 PE=4 SV=1
2678	108161	A0A1P8B6K1	54.74	2	2	9.92E5	2	2	2	N	153774	Modifier of snc1 OS=Arabidopsis thaliana OX=3702 GN=MOS1 PE=1 SV=1
2452	6562	A0A178VTR9	54.68	13	13	1.8E7	2	2	3	Y	21915	RSZ22a OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g20260 PE=4 SV=1
2452	6563	Q9SJA6	54.68	13	13	1.8E7	2	2	3	Y	21915	Serine/arginine-rich splicing factor RSZ22A OS=Arabidopsis thaliana OX=3702 GN=RSZ22A PE=1 SV=1
3178	59997	F4J5M5	54.68	16	16	5.09E6	2	2	2	N	18319	High mobility group B1 OS=Arabidopsis thaliana OX=3702 GN=HMGB1 PE=1 SV=1
3178	59998	O49595	54.68	15	15	5.09E6	2	2	2	N	20265	High mobility group B protein 1 OS=Arabidopsis thaliana OX=3702 GN=HMGB1 PE=1 SV=1
2872	108112	A0A178U6M3	54.67	10	10	3.01E5	3	3	3	N	54629	RUS6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g48660 PE=4 SV=1
2872	108113	Q93YU2	54.67	10	10	3.01E5	3	3	3	N	54629	Protein root UVB sensitive 6 OS=Arabidopsis thaliana OX=3702 GN=RUS6 PE=2 SV=1
2928	9495	P92965	54.50	8	8	1.13E7	2	2	3	Y	40319	Serine/arginine-rich splicing factor RS40 OS=Arabidopsis thaliana OX=3702 GN=RS40 PE=1 SV=2
2928	7514	A0A178UPU3	54.50	8	8	1.13E7	2	2	3	Y	41282	RS41 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g50910 PE=4 SV=1
2928	7515	P92966	54.50	8	8	1.13E7	2	2	3	Y	41282	Serine/arginine-rich splicing factor RS41 OS=Arabidopsis thaliana OX=3702 GN=RS41 PE=1 SV=2
2021	6305	A0A178UEY6	54.50	16	16	3.09E6	4	3	5	Y	28292	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g05560 PE=4 SV=1
2021	6306	Q9LHT0	54.50	16	16	3.09E6	4	3	5	Y	28292	Tropinone reductase homolog At5g06060 OS=Arabidopsis thaliana OX=3702 GN=At5g06060 PE=2 SV=1
2732	3337	Q9LS26	54.30	8	8	3.17E6	3	2	3	N	54973	Serine/threonine-protein kinase BSK2 OS=Arabidopsis thaliana OX=3702 GN=BSK2 PE=1 SV=1
2732	3340	A0A178UM21	54.30	8	8	3.17E6	3	2	3	N	54959	BSK2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g45030 PE=4 SV=1
3282	10247	Q9LVQ8	54.27	7	7	1.04E7	2	2	2	Y	43873	Probable protein phosphatase 2C 80 OS=Arabidopsis thaliana OX=3702 GN=At5g66720 PE=2 SV=1
3282	10248	A0A178UQN8	54.27	7	7	1.04E7	2	2	2	Y	43873	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g66720 PE=4 SV=1
3269	8095	A0A178VPU7	54.26	6	6	4.43E6	2	2	2	N	54702	PP5.2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g40210 PE=4 SV=1
3269	8096	A0A1P8AY87	54.26	6	6	4.43E6	2	2	2	N	60227	Protein phosphatase 5.2 OS=Arabidopsis thaliana OX=3702 GN=PP5.2 PE=4 SV=1
3269	8097	Q84XU2	54.26	6	6	4.43E6	2	2	2	N	60283	Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana OX=3702 GN=PAPP5 PE=1 SV=1
2749	12380	Q680M5	54.18	17	17	7.44E6	3	3	3	Y	28295	mRNA, partial cds, clone: RAFL22-45-J20 (Fragment) OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2749	12381	A0A178W0A1	54.18	15	15	7.44E6	3	3	3	Y	31672	EMB2799 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g35990 PE=4 SV=1
2749	12382	Q67YQ9	54.18	13	13	7.44E6	3	3	3	Y	38211	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2749	12383	Q8VZB1	54.18	13	13	7.44E6	3	3	3	Y	38210	NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=EMB2799 PE=1 SV=1
2465	8343	Q0WLA8	54.16	61	61	2.24E7	2	2	3	N	8265	TOM7-like protein OS=Arabidopsis thaliana OX=3702 GN=At5g41685 PE=2 SV=1
2465	8344	Q9ASY8	54.16	61	61	2.24E7	2	2	3	N	8265	Mitochondrial import receptor subunit TOM7-1 OS=Arabidopsis thaliana OX=3702 GN=TOM7-1 PE=1 SV=1
2757	59540	A0A178VRG6	54.15	14	14	2.83E6	3	3	3	N	45586	Diphosphomevalonate decarboxylase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g35580 PE=3 SV=1
2757	59539	O23722	54.15	14	14	2.83E6	3	3	3	N	45586	Diphosphomevalonate decarboxylase MVD1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=MVD1 PE=1 SV=1
3158	59506	Q8LEX4	54.13	9	9	5.4E6	2	2	2	N	30206	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3158	59505	A0A178V0W4	54.13	9	9	5.4E6	2	2	2	N	30156	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g11620 PE=4 SV=1
3158	59674	Q9SV86	54.13	9	9	5.4E6	2	2	2	N	29780	Uncharacterized protein AT4g10360 OS=Arabidopsis thaliana OX=3702 GN=F24G24.160 PE=4 SV=1
3158	59507	Q93ZA9	54.13	9	9	5.4E6	2	2	2	N	30207	AT4G10360 protein OS=Arabidopsis thaliana OX=3702 GN=At4g10360 PE=2 SV=1
3163	9734	O65448	54.05	22	22	4.99E6	2	2	2	N	15455	At4g22000 OS=Arabidopsis thaliana OX=3702 GN=At4g22000 PE=2 SV=1
3163	9735	A0A178UX97	54.05	22	22	4.99E6	2	2	2	N	15455	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g25530 PE=4 SV=1
2371	8568	Q8LE97	53.88	11	11	1.18E7	2	2	4	N	33249	50S ribosomal protein L4 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2371	8569	Q8VY61	53.88	11	11	1.18E7	2	2	4	N	33263	50S ribosomal protein L4 OS=Arabidopsis thaliana OX=3702 GN=At2g20060 PE=2 SV=1
2661	59580	A0A178VB36	53.88	6	6	8.54E6	3	3	3	N	59919	MTO1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g00140 PE=3 SV=1
2661	59581	P55217	53.88	6	6	8.54E6	3	3	3	N	59919	Cystathionine gamma-synthase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CGS1 PE=1 SV=3
2752	108118	Q84JZ6	53.80	27	27	9.8E6	3	3	3	Y	27558	Multiple organellar RNA editing factor 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MORF3 PE=1 SV=1
2752	108119	A0A178VJ70	53.80	27	27	9.8E6	3	3	3	Y	27558	MORF3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g06680 PE=4 SV=1
2862	6850	A0A384KUI9	53.79	16	16	2.16E7	3	3	3	Y	21458	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g11880 PE=1 SV=1
2862	6851	F4J8J7	53.79	16	16	2.16E7	3	3	3	Y	21458	Adenine nucleotide alpha hydrolases-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g11930 PE=1 SV=1
2862	6852	Q8L9C2	53.79	16	16	2.16E7	3	3	3	Y	21385	Ethylene-responsive protein, putative OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2862	6853	A0A384KK41	53.79	16	16	2.16E7	3	3	3	Y	21529	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g11880 PE=1 SV=1
2862	6854	Q9SF06	53.79	16	16	2.16E7	3	3	3	Y	21529	AT3g11930/MEC18.3 OS=Arabidopsis thaliana OX=3702 GN=F26K24.22 PE=1 SV=1
2862	6855	F4J7I5	53.79	16	16	2.16E7	3	3	3	Y	21600	Adenine nucleotide alpha hydrolases-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g11930 PE=1 SV=1
2862	6856	B9DG73	53.79	14	14	2.16E7	3	3	3	Y	24758	AT3G11930 protein OS=Arabidopsis thaliana OX=3702 GN=At3g11930 PE=1 SV=1
2879	7500	A0A178UPY0	53.62	18	18	1.88E6	3	3	3	N	24384	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g48950 PE=4 SV=1
2879	7501	Q8W485	53.62	18	18	1.88E6	3	3	3	N	24430	Uncharacterized protein At5g50100, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g50100 PE=1 SV=1
3054	9127	A0A1P8AZ84	53.61	2	2	9.94E5	2	2	2	N	136145	p-glycoprotein 6 OS=Arabidopsis thaliana OX=3702 GN=ABCB6 PE=1 SV=1
3054	9128	A0A178VUH1	53.61	2	2	9.94E5	2	2	2	N	142617	PGP6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g36420 PE=4 SV=1
3054	9129	Q8LPT1	53.61	2	2	9.94E5	2	2	2	N	155876	ABC transporter B family member 6 OS=Arabidopsis thaliana OX=3702 GN=ABCB6 PE=1 SV=2
3054	9130	A0A178VRG5	53.61	2	2	9.94E5	2	2	2	N	155920	PGP6 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g36420 PE=4 SV=1
3054	9132	Q9M3B9	53.61	2	2	9.94E5	2	2	2	N	155154	ABC transporter B family member 20 OS=Arabidopsis thaliana OX=3702 GN=ABCB20 PE=1 SV=1
3054	9133	A0A178V7G9	53.61	2	2	9.94E5	2	2	2	N	155176	PGP20 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g49910 PE=4 SV=1
1983	59689	Q9SZV4	53.55	21	21	2.76E8	3	3	6	N	10439	AT4g30010/F6G3_40 OS=Arabidopsis thaliana OX=3702 GN=At4g30010 PE=2 SV=1
1983	59690	A0A178UYP5	53.55	21	21	2.76E8	3	3	6	N	10439	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g34410 PE=4 SV=1
2568	9177	Q9T070	53.49	31	31	2.78E7	2	2	4	N	11235	Cytochrome c oxidase subunit 6a, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COX6A PE=3 SV=1
2568	9178	A0A178V2F3	53.49	31	31	2.78E7	2	2	4	N	11207	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g43100 PE=4 SV=1
2992	8481	A0A178VYR3	53.43	22	22	4.45E6	2	2	2	N	15049	CPN10 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g42220 PE=4 SV=1
2992	8482	O80504	53.43	22	22	4.45E6	2	2	2	N	15049	10 kDa chaperonin 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CPN10-2 PE=2 SV=1
2201	8606	F4J5J9	53.43	8	8	6.19E6	2	2	2	N	39485	Cysteine proteinases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g45310 PE=3 SV=1
2201	8607	Q8RWQ9	53.43	8	8	6.19E6	2	2	2	N	39542	Thiol protease aleurain-like OS=Arabidopsis thaliana OX=3702 GN=At3g45310 PE=2 SV=1
2428	11144	Q9LFS3	53.35	8	8	1.41E7	2	2	2	N	30127	3-oxo-5-alpha-steroid 4-dehydrogenase family protein OS=Arabidopsis thaliana OX=3702 GN=At5g16010 PE=2 SV=1
2428	11143	A0A178U7B8	53.35	8	8	1.41E7	2	2	2	N	30189	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g15570 PE=4 SV=1
2746	8399	Q93VE6	53.31	36	36	2.25E7	3	3	3	N	19908	AT5g10780/T30N20_50 OS=Arabidopsis thaliana OX=3702 GN=At5g10780 PE=2 SV=1
3128	4893	A0A384LIF6	53.13	9	9	2.75E6	2	2	2	N	38462	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g44530 PE=4 SV=1
3128	4894	Q9T024	53.13	9	9	2.75E6	2	2	2	N	38462	AT4g39150/T22F8_50 OS=Arabidopsis thaliana OX=3702 GN=At4g39150 PE=2 SV=1
2423	7860	Q84WW2	53.12	11	11	1.16E7	2	2	2	N	35645	6-phosphogluconolactonase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGL3 PE=1 SV=1
2423	7859	A0A178UCQ0	53.12	11	11	1.16E7	2	2	2	N	35645	Probable 6-phosphogluconolactonase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g24240 PE=3 SV=1
2881	6817	Q9ZR07	52.94	21	21	5.12E6	3	3	3	Y	21430	Frataxin, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FH PE=1 SV=2
2881	6818	A0A178V3B4	52.94	21	21	5.12E6	3	3	3	Y	21430	FH OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g04030 PE=4 SV=1
3177	10173	Q8H1Z0	52.91	4	4	1.7E6	2	2	2	N	72289	Very-long-chain aldehyde decarbonylase CER3 OS=Arabidopsis thaliana OX=3702 GN=CER3 PE=1 SV=1
3177	10174	A0A178UEJ5	52.91	4	4	1.7E6	2	2	2	N	72289	YRE OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g57080 PE=3 SV=1
2630	9071	A0A1I9LN64	52.75	10	10	7.93E6	2	2	3	N	36457	Putative eukaryotic LigT OS=Arabidopsis thaliana OX=3702 GN=At3g16230 PE=4 SV=1
2630	9072	B9DH47	52.75	9	9	7.93E6	2	2	3	N	41276	AT3G16230 protein (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At3g16230 PE=2 SV=1
2630	9073	A0A1I9LN58	52.75	9	9	7.93E6	2	2	3	N	40964	Putative eukaryotic LigT OS=Arabidopsis thaliana OX=3702 GN=At3g16230 PE=4 SV=1
2630	9074	A0A1I9LN59	52.75	8	8	7.93E6	2	2	3	N	41629	Putative eukaryotic LigT OS=Arabidopsis thaliana OX=3702 GN=At3g16230 PE=4 SV=1
2630	9075	A0A1I9LN63	52.75	8	8	7.93E6	2	2	3	N	45395	Putative eukaryotic LigT OS=Arabidopsis thaliana OX=3702 GN=At3g16230 PE=4 SV=1
2630	9076	Q9LU22	52.75	8	8	7.93E6	2	2	3	N	47304	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2630	9077	F4J1H2	52.75	7	7	7.93E6	2	2	3	N	50079	Putative eukaryotic LigT OS=Arabidopsis thaliana OX=3702 GN=At3g16230 PE=4 SV=1
2630	9078	A0A384KSP6	52.75	7	7	7.93E6	2	2	3	N	50079	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g17050 PE=4 SV=1
2529	6886	Q8LBB2	52.53	13	13	4.59E5	3	3	3	Y	47423	SNF1-related protein kinase regulatory subunit gamma-1 OS=Arabidopsis thaliana OX=3702 GN=KING1 PE=1 SV=2
3275	7383	A0A1P8B644	52.39	11	11	3.64E6	2	2	2	N	26332	DEGP protease 5 OS=Arabidopsis thaliana OX=3702 GN=DEG5 PE=4 SV=1
3275	7384	A0A1P8B643	52.39	10	10	3.64E6	2	2	2	N	28760	DEGP protease 5 OS=Arabidopsis thaliana OX=3702 GN=DEG5 PE=4 SV=1
3275	7320	A0A178V353	52.39	8	8	3.64E6	2	2	2	N	34894	HHOA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g21570 PE=4 SV=1
3275	7385	Q9SEL7	52.39	8	8	3.64E6	2	2	2	N	34923	Protease Do-like 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DEGP5 PE=1 SV=3
2069	4627	Q84TE3	52.35	16	16	1.58E7	4	4	4	N	36493	At2g03510 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2069	4629	A0A178VUW7	52.35	14	14	1.58E7	4	4	4	N	40626	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g02510 PE=4 SV=1
2069	4630	Q9ZQ87	52.35	14	14	1.58E7	4	4	4	N	40596	Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g03510 PE=2 SV=2
2069	4628	Q0WU28	52.35	15	15	1.58E7	4	4	4	N	38960	Uncharacterized protein At2g03510 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=At2g03510 PE=2 SV=1
3271	9224	Q9C658	52.33	7	7	3.28E6	2	2	2	N	64370	Protein decapping 5 OS=Arabidopsis thaliana OX=3702 GN=DCP5 PE=1 SV=1
3167	6298	A0A178W1C1	52.30	8	8	2.76E6	2	2	2	N	39230	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g38230 PE=4 SV=1
3167	6299	Q0WPT7	52.30	8	8	2.76E6	2	2	2	N	39230	Uncharacterized methyltransferase At2g41040, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g41040 PE=1 SV=1
3115	4825	A0A178W5Z5	52.14	7	7	4.95E6	2	2	2	Y	47859	PDIL2-2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g04330 PE=3 SV=1
3115	4826	Q9MAU6	52.14	7	7	4.95E6	2	2	2	Y	48403	Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-2 PE=2 SV=2
2359	6905	A0A178WA43	52.04	6	6	1.28E7	2	2	3	N	43542	ATAAPT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g14040 PE=3 SV=1
2359	6906	O82567	52.04	6	6	1.28E7	2	2	3	N	43542	Choline/ethanolaminephosphotransferase 1 OS=Arabidopsis thaliana OX=3702 GN=AAPT1 PE=1 SV=1
2929	9576	A0A178VIF6	52.02	10	10	3.49E7	2	2	3	N	24282	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g24610 PE=3 SV=1
2929	9577	Q9LIL4	52.02	10	10	3.49E7	2	2	3	N	24282	Transmembrane emp24 domain-containing protein p24beta3 OS=Arabidopsis thaliana OX=3702 GN=At3g22845 PE=2 SV=1
2914	8194	O81716	51.88	7	7	2.44E6	2	2	2	N	39354	Probable protein phosphatase 2C 21 OS=Arabidopsis thaliana OX=3702 GN=PPC4-2 PE=1 SV=1
2914	9004	A0A178VSP0	51.88	7	7	2.44E6	2	2	2	N	39340	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g20780 PE=3 SV=1
2298	8553	A0A178V815	51.85	5	5	2.96E6	2	2	2	N	39020	UDP-Arabinofuranose Transporter 3 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=AT4G32390.1 PE=2 SV=1
2298	8554	Q9SUV2	51.85	5	5	2.96E6	2	2	2	N	39020	Probable sugar phosphate/phosphate translocator At4g32390 OS=Arabidopsis thaliana OX=3702 GN=At4g32390 PE=3 SV=1
2298	8555	A0A384KJ93	51.85	5	5	2.96E6	2	2	2	N	39020	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g37160 PE=4 SV=1
2931	9490	Q0WRM1	51.83	40	40	4.01E7	2	2	3	N	9339	Uncharacterized protein At2g29530 OS=Arabidopsis thaliana OX=3702 GN=At2g29530 PE=2 SV=1
2931	9491	A0A384L021	51.83	40	40	4.01E7	2	2	3	N	9339	TIM10 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g25610 PE=4 SV=1
2931	9492	Q9ZW33	51.83	40	40	4.01E7	2	2	3	N	9339	Mitochondrial import inner membrane translocase subunit TIM10 OS=Arabidopsis thaliana OX=3702 GN=TIM10 PE=1 SV=1
2931	9493	F4IKQ3	51.83	31	31	4.01E7	2	2	3	N	12252	Tim10/DDP family zinc finger protein OS=Arabidopsis thaliana OX=3702 GN=TIM10 PE=1 SV=1
2430	8300	A0A178URX3	51.77	14	14	4.46E6	3	3	4	Y	42729	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g48850 PE=4 SV=1
2430	8301	Q9FGB1	51.77	14	14	4.46E6	3	3	4	Y	42729	Protein kinase OS=Arabidopsis thaliana OX=3702 GN=MPF21.1 PE=4 SV=1
2430	8302	Q8LES3	51.77	14	14	4.46E6	3	3	4	Y	42733	Protein kinase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2693	6464	Q9LQK0	51.61	7	7	4.41E6	2	2	3	N	44639	Developmentally-regulated G-protein 1 OS=Arabidopsis thaliana OX=3702 GN=DRG1 PE=1 SV=1
2693	9479	A0A178W3F4	51.61	7	7	4.41E6	2	2	3	N	44824	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g66840 PE=4 SV=1
2693	6465	A0A178W426	51.61	7	7	4.41E6	2	2	3	N	44639	DRG1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g18360 PE=4 SV=1
2693	9480	Q9CAI1	51.61	7	7	4.41E6	2	2	3	N	44803	Developmentally-regulated G-protein 2 OS=Arabidopsis thaliana OX=3702 GN=DRG2 PE=2 SV=1
2693	9478	A0A1P8AMQ3	51.61	8	8	4.41E6	2	2	3	N	36182	p-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g72660 PE=4 SV=1
3164	108272	A0A1P8BG13	51.60	11	11	2.33E6	2	2	2	N	44499	Regulator of chromosome condensation (RCC1) family protein OS=Arabidopsis thaliana OX=3702 GN=At5g11580 PE=4 SV=1
3164	10608	A0A178UAK3	51.60	11	11	2.33E6	2	2	2	N	44511	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g11310 PE=4 SV=1
3164	108273	Q9LYD4	51.60	8	8	2.33E6	2	2	2	N	59099	Uncharacterized protein F15N18_170 OS=Arabidopsis thaliana OX=3702 GN=F15N18_170 PE=4 SV=1
3164	108274	A0A178UDD4	51.60	8	8	2.33E6	2	2	2	N	60555	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g11310 PE=4 SV=1
3164	108275	Q8LCD8	51.60	8	8	2.33E6	2	2	2	N	60659	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3164	108276	Q93Z10	51.60	8	8	2.33E6	2	2	2	N	60543	AT5g11580/F15N18_170 OS=Arabidopsis thaliana OX=3702 GN=At5g11580 PE=2 SV=1
3156	59620	Q9FN15	51.58	13	13	1.14E7	2	2	2	Y	36114	Protein CONSERVED IN THE GREEN LINEAGE AND DIATOMS 27, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CGLD27 PE=2 SV=1
3156	59621	A0A178U8H8	51.58	12	12	1.14E7	2	2	2	Y	39545	CGLD27 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g67450 PE=4 SV=1
3156	59619	A0A178UAF3	51.58	40	40	1.14E7	2	2	2	Y	12007	CGLD27 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g67450 PE=4 SV=1
2905	8221	A0A178V0L9	51.58	40	40	1.7E7	2	2	2	N	8606	ATOZI1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g01090 PE=4 SV=1
2905	8222	Q38842	51.58	40	40	1.7E7	2	2	2	N	8606	AT0ZI1 protein OS=Arabidopsis thaliana OX=3702 GN=ATOZI1 PE=2 SV=1
3213	11930	P49689	51.54	18	18	1E8	2	2	2	N	6887	40S ribosomal protein S30 OS=Arabidopsis thaliana OX=3702 GN=RPS30A PE=3 SV=3
3213	11931	A0A178V0S4	51.54	18	18	1E8	2	2	2	N	6887	40S ribosomal protein S30 OS=Arabidopsis thaliana OX=3702 GN=At4g29390 PE=2 SV=1
3213	11932	A0A384L8A2	51.54	18	18	1E8	2	2	2	N	6887	40S ribosomal protein S30 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g33770 PE=3 SV=1
3046	59733	Q84K16	51.52	6	6	1.61E6	2	2	2	N	96469	AP-1 complex subunit gamma-1 OS=Arabidopsis thaliana OX=3702 GN=GAMMA-ADR PE=1 SV=1
2573	10682	Q9S709	51.51	6	6	1.1E7	2	2	3	N	34572	Splicing factor U2af small subunit A OS=Arabidopsis thaliana OX=3702 GN=U2AF35A PE=1 SV=1
2573	10683	A0A178W2Y4	51.51	6	6	1.1E7	2	2	3	N	34572	ATU2AF35A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g28030 PE=4 SV=1
3175	9656	A0A178W4T4	51.46	5	5	1.73E6	2	2	2	N	56686	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g61420 PE=4 SV=1
3175	6705	F4HTM3	51.46	3	3	1.73E6	2	2	2	N	97634	Mannosyl-oligosaccharide glucosidase GCS1 OS=Arabidopsis thaliana OX=3702 GN=GCS1 PE=1 SV=1
3272	9789	A8MQG9	51.34	11	11	2.47E7	2	2	2	N	23731	3-oxo-5-alpha-steroid 4-dehydrogenase (DUF1295) OS=Arabidopsis thaliana OX=3702 GN=At1g73650 PE=4 SV=1
3272	9790	B3H655	51.34	11	11	2.47E7	2	2	2	N	25086	3-oxo-5-alpha-steroid 4-dehydrogenase (DUF1295) OS=Arabidopsis thaliana OX=3702 GN=At1g73650 PE=4 SV=1
3272	9791	Q940M8	51.34	8	8	2.47E7	2	2	2	N	32960	3-oxo-5-alpha-steroid 4-dehydrogenase (DUF1295) OS=Arabidopsis thaliana OX=3702 GN=At1g73650 PE=2 SV=1
3272	9792	A0A178W5X3	51.34	8	8	2.47E7	2	2	2	N	32946	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g67900 PE=4 SV=1
3272	9793	B9DFE9	51.34	8	8	2.47E7	2	2	2	N	33059	3-oxo-5-alpha-steroid 4-dehydrogenase (DUF1295) OS=Arabidopsis thaliana OX=3702 GN=At1g73650 PE=2 SV=1
3272	9794	Q8LEY8	51.34	8	8	2.47E7	2	2	2	N	33144	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3272	9795	A0A178W1Y5	51.34	8	8	2.47E7	2	2	2	N	33045	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g67900 PE=4 SV=1
3272	9796	A0A178W471	51.34	8	8	2.47E7	2	2	2	N	34301	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g67900 PE=4 SV=1
3272	9797	F4HRY1	51.34	8	8	2.47E7	2	2	2	N	34417	3-oxo-5-alpha-steroid 4-dehydrogenase (DUF1295) OS=Arabidopsis thaliana OX=3702 GN=At1g73650 PE=4 SV=1
3291	4474	B7ZWR6	51.31	6	6	1.44E6	2	2	2	N	60757	Outer envelope protein 61 OS=Arabidopsis thaliana OX=3702 GN=OEP61 PE=1 SV=1
3291	4475	A0A178UNB9	51.31	6	6	1.44E6	2	2	2	N	60757	TPR7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g21330 PE=4 SV=1
2317	8763	Q8VZ99	51.17	13	13	1.01E8	3	3	3	Y	21529	Germin-like protein OS=Arabidopsis thaliana OX=3702 GN=At1g72610 PE=2 SV=1
2317	8764	A0A384L3S4	51.17	13	13	1.01E8	3	3	3	Y	21559	GLP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g66780 PE=3 SV=1
2317	8765	Q549N9	51.17	13	13	1.01E8	3	3	3	Y	21559	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2317	8766	P94040	51.17	13	13	1.01E8	3	3	3	Y	21559	Germin-like protein subfamily 3 member 1 OS=Arabidopsis thaliana OX=3702 GN=GLP1 PE=1 SV=1
3066	8260	P61845	51.15	29	29	1.84E8	2	2	2	N	10789	50S ribosomal protein L23, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rpl23-A PE=3 SV=1
3066	8261	A0A1B1W4Y6	51.15	29	29	1.84E8	2	2	2	N	10789	50S ribosomal protein L23, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rpl23 PE=3 SV=1
3179	5840	Q8GUG7	51.06	3	3	3.67E6	2	2	2	Y	87429	DEAD-box ATP-dependent RNA helicase 50 OS=Arabidopsis thaliana OX=3702 GN=RH50 PE=2 SV=2
3179	5841	A0A178V8Q3	51.06	3	3	3.67E6	2	2	2	Y	87429	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g06860 PE=4 SV=1
2123	7810	A0A178VCW6	51.04	4	4	1.05E6	2	2	2	N	75706	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g01710 PE=4 SV=1
2123	7811	Q9M891	51.04	4	4	1.05E6	2	2	2	N	75706	Pentatricopeptide repeat-containing protein At3g02490, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g02490 PE=2 SV=1
2750	108114	F4K5E7	51.03	5	5	2.68E6	3	3	3	N	104048	Alpha-mannosidase OS=Arabidopsis thaliana OX=3702 GN=MAC12.38 PE=3 SV=1
2750	13052	A0A178UJ51	51.03	4	4	2.68E6	3	3	3	N	115917	Alpha-mannosidase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g13430 PE=3 SV=1
2750	13053	Q8LPJ3	51.03	4	4	2.68E6	3	3	3	N	115902	Probable alpha-mannosidase At5g13980 OS=Arabidopsis thaliana OX=3702 GN=At5g13980 PE=2 SV=1
2799	8164	A0A1P8B8V4	51.02	9	9	2.38E6	2	2	3	N	53995	ENTH/VHS/GAT family protein OS=Arabidopsis thaliana OX=3702 GN=At4g32760 PE=4 SV=1
2799	8168	Q8L860	51.02	6	6	2.38E6	2	2	3	N	72963	TOM1-like protein 9 OS=Arabidopsis thaliana OX=3702 GN=TOL9 PE=1 SV=1
2799	8169	A0A178UYI3	51.02	6	6	2.38E6	2	2	3	N	72993	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g37570 PE=4 SV=1
2799	8170	A0A178UYR5	51.02	6	6	2.38E6	2	2	3	N	73122	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g37570 PE=4 SV=1
2799	8171	F4JV51	51.02	6	6	2.38E6	2	2	3	N	73092	ENTH/VHS/GAT family protein OS=Arabidopsis thaliana OX=3702 GN=At4g32760 PE=4 SV=1
2198	108134	A0A384L859	50.98	12	12	1.24E7	2	2	2	N	24214	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g19740 PE=1 SV=1
2198	108135	Q9LII1	50.98	12	12	1.24E7	2	2	2	N	24214	Nucleic acid-binding, OB-fold-like protein OS=Arabidopsis thaliana OX=3702 GN=At3g18580 PE=1 SV=1
2772	6896	A0A178ULP7	50.90	3	3	1.45E6	2	2	2	N	93618	Protein ROOT HAIR DEFECTIVE 3 homolog OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g43400 PE=3 SV=1
2772	6897	Q9FKE9	50.90	3	3	1.45E6	2	2	2	N	93570	Protein ROOT HAIR DEFECTIVE 3 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=At5g45160 PE=2 SV=1
3298	8099	A0A178USY5	50.77	9	9	1E7	2	2	2	Y	46551	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g00110 PE=4 SV=1
3298	7143	Q93ZN5	50.77	9	9	1E7	2	2	2	Y	46551	AT4g00090/F6N15_8 OS=Arabidopsis thaliana OX=3702 GN=At4g00090 PE=2 SV=1
3298	7144	O81310	50.77	8	8	1E7	2	2	2	Y	49608	F6N15.8 protein OS=Arabidopsis thaliana OX=3702 GN=F6N15.8 PE=4 SV=1
2622	5876	F4I9G7	50.67	14	14	4.12E6	2	2	2	Y	20218	TLR4 regulator/MIR-interacting MSAP protein OS=Arabidopsis thaliana OX=3702 GN=At1g42480 PE=4 SV=1
2622	5895	Q9C8E9	50.67	11	11	4.12E6	2	2	2	Y	26130	Uncharacterized protein T8D8.4 OS=Arabidopsis thaliana OX=3702 GN=T8D8.4 PE=4 SV=1
3284	9809	A0A384LJ84	50.54	12	12	4.56E6	2	2	2	Y	24722	RANBP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g57960 PE=4 SV=1
3284	9810	P92985	50.54	12	12	4.56E6	2	2	2	Y	24722	Ran-binding protein 1 homolog c OS=Arabidopsis thaliana OX=3702 GN=RANBP1C PE=2 SV=1
3284	9811	Q1WWI2	50.54	12	12	4.56E6	2	2	2	Y	24722	At5g58590 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2577	9819	Q9SN96	50.41	20	20	2.9E7	2	2	4	N	6585	AT3g46430/F18L15_150 OS=Arabidopsis thaliana OX=3702 GN=F18L15.150 PE=2 SV=1
2577	9820	A0A384KW84	50.41	20	20	2.9E7	2	2	4	N	6585	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g40250 PE=4 SV=1
3067	1850	A0A178VM62	50.24	5	5	2.2E6	2	2	2	Y	93673	Beta-galactosidase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g14160 PE=3 SV=1
3067	1851	Q9SCW1	50.24	5	5	2.2E6	2	2	2	Y	93659	Beta-galactosidase 1 OS=Arabidopsis thaliana OX=3702 GN=BGAL1 PE=2 SV=1
2435	9812	Q5XEN3	50.13	20	20	6.55E6	3	3	4	Y	22671	ATPase complex subunit OS=Arabidopsis thaliana OX=3702 GN=At1g08220 PE=2 SV=1
2435	9813	Q0WRX7	50.13	15	15	6.55E6	3	3	4	Y	31058	ATPase complex subunit OS=Arabidopsis thaliana OX=3702 GN=At1g08220 PE=2 SV=1
2435	9814	Q9SGD8	50.13	13	13	6.55E6	3	3	4	Y	36626	T23G18.8 OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2671	6577	A0A178W9T2	50.01	4	4	0E0	2	2	2	N	108294	Calcium-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g10190 PE=3 SV=1
2671	4557	Q9SY55	50.01	4	4	0E0	2	2	2	N	109060	Calcium-transporting ATPase 3, endoplasmic reticulum-type OS=Arabidopsis thaliana OX=3702 GN=ECA3 PE=2 SV=3
2354	7122	Q9XEA1	49.99	3	3	5.34E6	2	2	2	N	87607	Protein OSCA1 OS=Arabidopsis thaliana OX=3702 GN=OSCA1 PE=1 SV=1
2354	108123	A0A178UVC9	49.99	3	3	5.34E6	2	2	2	N	87593	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g06090 PE=4 SV=1
3126	7166	A0A178VJT9	49.93	12	12	1.89E7	2	2	2	N	23481	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g48640 PE=3 SV=1
3126	7167	Q9M385	49.93	12	12	1.89E7	2	2	2	N	23481	50S ribosomal protein L17, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPL17 PE=2 SV=1
3013	10329	A0A178VI97	49.80	13	13	2.08E6	2	2	2	Y	40908	CEP3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g42470 PE=3 SV=1
3013	10330	Q9STL5	49.80	13	13	2.08E6	2	2	2	Y	40971	KDEL-tailed cysteine endopeptidase CEP3 OS=Arabidopsis thaliana OX=3702 GN=CEP3 PE=2 SV=1
2934	9595	A0A178V7K4	49.68	7	7	5.12E7	2	2	3	N	41780	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g15650 PE=4 SV=1
2934	9596	Q9LKA4	49.68	7	7	5.12E7	2	2	3	N	41780	UBP1-associated protein 2C OS=Arabidopsis thaliana OX=3702 GN=UBA2C PE=2 SV=1
2985	3905	A0A1P8B868	49.65	1	1	6.71E5	2	2	2	N	279826	Nucleoporin OS=Arabidopsis thaliana OX=3702 GN=At4g31570 PE=4 SV=1
2985	3865	A0A1P8B866	49.65	1	1	6.71E5	2	2	2	N	300908	Nucleoporin OS=Arabidopsis thaliana OX=3702 GN=At4g31570 PE=4 SV=1
2985	3867	Q9SB74	49.65	1	1	6.71E5	2	2	2	N	304053	Uncharacterized protein AT4g31570 OS=Arabidopsis thaliana OX=3702 GN=F28M20.240 PE=4 SV=1
2985	3868	A0A1P8B863	49.65	1	1	6.71E5	2	2	2	N	304572	Nucleoporin OS=Arabidopsis thaliana OX=3702 GN=At4g31570 PE=4 SV=1
2985	3871	A0A1P8B875	49.65	1	1	6.71E5	2	2	2	N	305117	Nucleoporin OS=Arabidopsis thaliana OX=3702 GN=At4g31570 PE=4 SV=1
2985	3872	A0A1P8B864	49.65	1	1	6.71E5	2	2	2	N	305368	Nucleoporin OS=Arabidopsis thaliana OX=3702 GN=At4g31570 PE=4 SV=1
2985	3873	F4JSP7	49.65	1	1	6.71E5	2	2	2	N	305912	Nucleoporin OS=Arabidopsis thaliana OX=3702 GN=At4g31570 PE=4 SV=1
2985	3869	A0A178UTM4	49.65	1	1	6.71E5	2	2	2	N	304464	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g36160 PE=4 SV=1
2985	3870	A0A178UUX3	49.65	1	1	6.71E5	2	2	2	N	305009	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g36160 PE=4 SV=1
3137	7051	A0A1R7T3B5	49.65	17	17	2.77E6	2	2	2	N	33394	IAA-leucine resistant (ILR)-like 1 OS=Arabidopsis thaliana OX=3702 GN=ILL1 PE=4 SV=1
3137	6889	Q67YZ8	49.65	12	12	2.77E6	2	2	2	N	47692	At5g56650 OS=Arabidopsis thaliana OX=3702 GN=At5g56650 PE=2 SV=1
3137	6890	P54969	49.65	12	12	2.77E6	2	2	2	N	47692	IAA-amino acid hydrolase ILR1-like 1 OS=Arabidopsis thaliana OX=3702 GN=ILL1 PE=1 SV=1
3137	108266	A0A178UF52	49.65	13	13	2.77E6	2	2	2	N	42204	ILL1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g55850 PE=4 SV=1
3173	9213	A0A178W0S3	49.61	2	2	2.14E6	2	2	2	N	134814	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g33540 PE=4 SV=1
3173	6308	A0A1P8B1Y3	49.61	1	1	2.14E6	2	2	2	N	164591	ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=SGR6 PE=4 SV=1
3173	6444	A0A178W090	49.61	1	1	2.14E6	2	2	2	N	187853	ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=SGR6 PE=4 SV=1
3173	6445	A0A384LIW2	49.61	1	1	2.14E6	2	2	2	N	187853	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g33540 PE=4 SV=1
3173	6457	F4IP13	49.61	1	1	2.14E6	2	2	2	N	189422	Protein SHOOT GRAVITROPISM 6 OS=Arabidopsis thaliana OX=3702 GN=SGR6 PE=2 SV=1
3162	108267	A0A1P8AM09	49.54	14	14	9.09E6	2	2	2	N	33145	Rho termination factor OS=Arabidopsis thaliana OX=3702 GN=RHON1 PE=1 SV=1
3162	108268	Q94K75	49.54	10	10	9.09E6	2	2	2	N	44530	Rho-N domain-containing protein 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RHON1 PE=1 SV=1
3162	108269	A0A178WBK4	49.54	10	10	9.09E6	2	2	2	N	44497	RHON1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g05760 PE=4 SV=1
3162	108270	A0A1P8AM12	49.54	10	10	9.09E6	2	2	2	N	44998	Rho termination factor OS=Arabidopsis thaliana OX=3702 GN=RHON1 PE=1 SV=1
2664	7548	A0A1I9LQD4	49.50	9	9	8.05E6	3	3	3	N	48085	Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana OX=3702 GN=CPK32 PE=1 SV=1
2664	7551	A0A178VB71	49.50	7	7	8.05E6	3	3	3	N	60936	CPK32 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g52100 PE=4 SV=1
2664	7552	Q6NLQ6	49.50	7	7	8.05E6	3	3	3	N	60936	Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana OX=3702 GN=CPK32 PE=1 SV=1
3064	7471	A0A178VKB6	49.49	24	24	1.53E7	2	2	2	N	12184	HS1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g18120 PE=4 SV=1
3064	7472	Q9LUV2	49.49	24	24	1.53E7	2	2	2	N	12184	Stress-response A/B barrel domain-containing protein HS1 OS=Arabidopsis thaliana OX=3702 GN=HS1 PE=1 SV=1
2546	108128	A0A178UQI4	49.31	5	5	5.24E5	2	2	2	Y	60358	CRY3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g24750 PE=4 SV=1
2546	108129	Q84KJ5	49.31	4	4	5.24E5	2	2	2	Y	64983	Cryptochrome DASH, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CRYD PE=1 SV=2
3063	5457	F4JYC0	49.31	8	8	2.45E6	2	2	2	N	64913	Adenylate kinase family protein OS=Arabidopsis thaliana OX=3702 GN=At5g35170 PE=3 SV=1
3063	5458	Q8VYL1	49.31	7	7	2.45E6	2	2	2	N	65738	Adenylate kinase 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g35170 PE=1 SV=1
2447	7845	A0A178WH46	49.22	17	17	2E6	2	2	2	N	29647	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g06840 PE=3 SV=1
2447	7846	Q9LML3	49.22	17	17	2E6	2	2	2	N	29619	F10K1.8 protein OS=Arabidopsis thaliana OX=3702 GN=At1g07210 PE=1 SV=1
3285	10378	A0A1P8AWW7	49.12	12	12	1.12E7	2	2	2	Y	18906	PLAC8 family protein OS=Arabidopsis thaliana OX=3702 GN=At1g63830 PE=4 SV=1
3285	9993	A0A1P8AWU3	49.12	11	11	1.12E7	2	2	2	Y	20251	PLAC8 family protein OS=Arabidopsis thaliana OX=3702 GN=At1g63830 PE=4 SV=1
3285	8294	Q9CAJ7	49.12	9	9	1.12E7	2	2	2	Y	25667	PLAC8 family protein OS=Arabidopsis thaliana OX=3702 GN=At1g63830 PE=2 SV=1
3285	8295	A0A178W3H8	49.12	9	9	1.12E7	2	2	2	Y	25667	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g57260 PE=4 SV=1
3286	5743	A0A178VR05	49.00	9	9	1.54E6	2	2	2	N	40337	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g21220 PE=3 SV=1
3286	5744	Q9SKK4	49.00	9	9	1.54E6	2	2	2	N	40351	Probable 2-oxoacid dependent dioxygenase OS=Arabidopsis thaliana OX=3702 GN=GSL-OH PE=2 SV=1
2891	7215	A0A178WNM1	48.97	12	12	4.65E6	2	2	2	N	31182	ATP-dependent Clp protease proteolytic subunit OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g12820 PE=3 SV=1
2891	7216	Q9XJ36	48.97	12	12	4.65E6	2	2	2	N	31209	ATP-dependent Clp protease proteolytic subunit-related protein 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPR2 PE=1 SV=1
3278	108281	Q9CA19	48.87	16	16	7.76E6	2	2	2	N	17272	Small ribosomal subunit protein S13, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RPS13 PE=2 SV=1
3278	108282	A0A178WJD6	48.87	16	16	7.76E6	2	2	2	N	17272	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g72330 PE=3 SV=1
3161	59873	A0A178WQK9	48.85	13	13	2.88E7	2	2	2	N	22761	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g58010 PE=3 SV=1
3161	59874	Q8VY91	48.85	13	13	2.88E7	2	2	2	N	22761	30S ribosomal protein S6 alpha, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPS6 PE=2 SV=1
3161	59876	A0A1P8AV66	48.85	12	12	2.88E7	2	2	2	N	25460	Translation elongation factor EF1B/ribosomal protein S6 family protein OS=Arabidopsis thaliana OX=3702 GN=At1g64510 PE=3 SV=1
3171	6695	F4I3B3	48.75	6	6	9.75E5	2	2	2	Y	48483	Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana OX=3702 GN=RBP47A PE=2 SV=1
3171	6696	A0A178WAQ6	48.75	6	6	9.75E5	2	2	2	Y	48456	RBP47A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g43770 PE=4 SV=1
3289	10296	O22825	48.65	46	46	6.95E6	2	2	2	N	7138	At2g43780/F18O19.11 OS=Arabidopsis thaliana OX=3702 GN=At2g43780 PE=2 SV=1
3289	10297	A0A384KBR4	48.65	46	46	6.95E6	2	2	2	N	7138	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g41300 PE=4 SV=1
3289	10298	A0A1P8AZ61	48.65	33	33	6.95E6	2	2	2	N	10283	Cytochrome oxidase assembly protein OS=Arabidopsis thaliana OX=3702 GN=At2g43780 PE=4 SV=1
3138	108230	A0A384KKH5	48.62	19	19	2.84E6	2	2	2	N	19103	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g12390 PE=4 SV=1
3138	108231	Q9LHH1	48.62	19	19	2.84E6	2	2	2	N	19103	50S ribosomal protein L10 OS=Arabidopsis thaliana OX=3702 GN=T2E22.37 PE=2 SV=1
3122	19074	Q940Y8	48.56	5	5	6.93E5	2	2	2	Y	76772	Kinesin-like protein KIN-13B OS=Arabidopsis thaliana OX=3702 GN=KIN13B PE=1 SV=1
3122	19075	A0A178V575	48.56	5	5	6.93E5	2	2	2	Y	76772	Kinesin-like protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g16860 PE=3 SV=1
2564	9722	A0A178UNK6	48.52	12	12	1.06E8	2	2	4	Y	19435	ENODL17 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g14880 PE=4 SV=1
2564	9723	Q39131	48.52	12	12	1.06E8	2	2	4	Y	19435	Lamin-like protein OS=Arabidopsis thaliana OX=3702 GN=At5g15350 PE=2 SV=1
2984	3718	Q9LT06	48.48	6	6	2.95E6	2	2	2	N	67558	Gb\|AAC97420.1 OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
2984	3719	Q8VZJ5	48.48	6	6	2.95E6	2	2	2	N	68609	AT5g08500/MAH20_6 OS=Arabidopsis thaliana OX=3702 GN=At5g23575 PE=2 SV=1
2984	4437	A0A178UL69	48.48	6	6	2.95E6	2	2	2	N	68664	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g23160 PE=4 SV=1
3180	7997	Q8LDH6	48.29	16	16	4.84E6	2	2	2	Y	27018	Putative thaumatin OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3180	7998	A0A178VVA0	48.29	16	16	4.84E6	2	2	2	Y	27018	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g24890 PE=4 SV=1
3180	7999	Q9ZV34	48.29	16	16	4.84E6	2	2	2	Y	27018	At2g28790 OS=Arabidopsis thaliana OX=3702 GN=CBP1 PE=2 SV=1
3180	8000	A0A1P8B068	48.29	14	14	4.84E6	2	2	2	Y	30183	Pathogenesis-related thaumatin superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g28790 PE=4 SV=1
2896	6516	F4HST2	48.25	9	9	6.95E6	2	2	2	N	29443	Dehydrin family protein OS=Arabidopsis thaliana OX=3702 GN=ERD10 PE=1 SV=1
2896	6525	A0A178W8S5	48.25	9	9	6.95E6	2	2	2	N	29557	LTI45 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g21400 PE=3 SV=1
2896	6517	P42759	48.25	9	9	6.95E6	2	2	2	N	29548	Dehydrin ERD10 OS=Arabidopsis thaliana OX=3702 GN=ERD10 PE=1 SV=1
2936	10230	A0A178UL13	48.17	14	14	4.94E7	2	2	3	N	15784	COPT5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g20630 PE=4 SV=1
2936	10231	Q93VM8	48.17	14	14	4.94E7	2	2	3	N	15784	Copper transporter 5 OS=Arabidopsis thaliana OX=3702 GN=COPT5 PE=1 SV=1
2806	108312	F4JML5	48.14	12	12	1.16E7	2	2	3	N	32788	Probable enoyl-CoA hydratase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g16800 PE=2 SV=1
2525	5318	Q9SEL6	48.14	23	23	8.22E6	3	3	3	Y	24951	Vesicle transport v-SNARE 11 OS=Arabidopsis thaliana OX=3702 GN=VTI11 PE=1 SV=2
2525	5319	A0A178URQ0	48.14	23	23	8.22E6	3	3	3	Y	24889	ZIG1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g36940 PE=4 SV=1
2756	10388	Q9STY0	47.96	18	18	1.53E7	3	3	3	Y	25598	Peroxisomal membrane protein 11B OS=Arabidopsis thaliana OX=3702 GN=PEX11B PE=1 SV=1
3290	6240	A0A178VMI2	47.91	9	9	3.64E5	2	2	2	Y	35570	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g31060 PE=4 SV=1
3290	6241	Q8L970	47.91	9	9	3.64E5	2	2	2	Y	35570	Probable prolyl 4-hydroxylase 7 OS=Arabidopsis thaliana OX=3702 GN=P4H7 PE=2 SV=1
3290	7597	F4J0A6	47.91	8	8	3.64E5	2	2	2	Y	36358	Oxoglutarate/iron-dependent oxygenase OS=Arabidopsis thaliana OX=3702 GN=At3g28480 PE=4 SV=1
2804	11980	A0A178UBS9	47.74	57	57	2.99E7	2	2	3	Y	9113	40S ribosomal protein S21 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g27660 PE=3 SV=1
2804	11981	A0A178VG46	47.74	57	57	2.99E7	2	2	3	Y	9074	40S ribosomal protein S21 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g48260 PE=3 SV=1
2804	11982	Q3E902	47.74	57	57	2.99E7	2	2	3	Y	9113	40S ribosomal protein S21-2 OS=Arabidopsis thaliana OX=3702 GN=RPS21C PE=1 SV=2
2804	11983	Q9M337	47.74	57	57	2.99E7	2	2	3	Y	9074	40S ribosomal protein S21-1 OS=Arabidopsis thaliana OX=3702 GN=RPS21B PE=1 SV=1
3296	59636	A0A1P8BCT8	47.73	28	28	1.84E7	2	2	2	N	15386	ADP-ribosylation factor-like A1A OS=Arabidopsis thaliana OX=3702 GN=ARLA1A PE=4 SV=1
3296	59637	A0A178UDT7	47.73	23	23	1.84E7	2	2	2	N	18207	ATARLA1A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g34820 PE=3 SV=1
3296	59638	Q8W4C8	47.73	21	21	1.84E7	2	2	2	N	20573	ADP-ribosylation factor-like protein 8c OS=Arabidopsis thaliana OX=3702 GN=ARL8C PE=2 SV=1
3293	9736	A0A1P8AX49	47.71	25	25	7E6	2	2	2	N	15065	Cytochrome B5 isoform B OS=Arabidopsis thaliana OX=3702 GN=CB5-B PE=3 SV=1
3293	7828	O48845	47.71	25	25	7E6	2	2	2	N	15016	Cytochrome b5 isoform B OS=Arabidopsis thaliana OX=3702 GN=CYTB5-B PE=1 SV=1
3293	7829	A0A178VXM5	47.71	25	25	7E6	2	2	2	N	15016	CYTB5-D OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g29080 PE=3 SV=1
3065	5554	Q9SF45	47.32	7	7	2.77E5	2	2	2	N	52259	FAD/NAD(P)-binding oxidoreductase family protein OS=Arabidopsis thaliana OX=3702 GN=F11F8_15 PE=2 SV=1
3065	5555	A0A384LAN5	47.32	7	7	2.77E5	2	2	2	N	52259	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g09230 PE=4 SV=1
3127	8957	Q941B5	47.30	7	7	1.35E6	2	2	2	N	37532	Proline iminopeptidase OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3127	8958	F4IFH2	47.30	7	7	1.35E6	2	2	2	N	37433	Proline iminopeptidase OS=Arabidopsis thaliana OX=3702 GN=PIP PE=3 SV=1
3127	8973	A0A1P8B2D9	47.30	6	6	1.35E6	2	2	2	N	42953	Proline iminopeptidase OS=Arabidopsis thaliana OX=3702 GN=PIP PE=3 SV=1
3127	8974	P93732	47.30	6	6	1.35E6	2	2	2	N	43059	Proline iminopeptidase OS=Arabidopsis thaliana OX=3702 GN=PIP PE=2 SV=3
3181	5810	A0A178UIH6	47.12	9	9	2.6E6	2	2	2	N	34043	SOS4 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g35020 PE=4 SV=1
3181	5811	Q8W1X2	47.12	9	9	2.6E6	2	2	2	N	34043	Pyridoxal kinase OS=Arabidopsis thaliana OX=3702 GN=PK PE=1 SV=2
3181	6849	F4K8N1	47.12	9	9	2.6E6	2	2	2	N	35058	PfkB-like carbohydrate kinase family protein OS=Arabidopsis thaliana OX=3702 GN=SOS4 PE=1 SV=1
2908	108154	F4JFU7	47.11	5	5	1.85E6	2	2	2	N	73704	STRUBBELIG-receptor family 7 OS=Arabidopsis thaliana OX=3702 GN=SRF7 PE=1 SV=1
2908	108155	A0A384LCJ9	47.11	4	4	1.85E6	2	2	2	N	77635	SRF7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g14930 PE=4 SV=1
2908	108156	Q9LUL4	47.11	4	4	1.85E6	2	2	2	N	77635	Protein STRUBBELIG-RECEPTOR FAMILY 7 OS=Arabidopsis thaliana OX=3702 GN=SRF7 PE=1 SV=1
2908	108157	B5X583	47.11	4	4	1.85E6	2	2	2	N	77635	At3g14350 OS=Arabidopsis thaliana OX=3702 GN=LRR-RLK PE=2 SV=1
2889	6029	O80925	47.04	5	5	6.97E6	2	2	2	N	49252	ADP-ribosylation factor GTPase-activating protein AGD7 OS=Arabidopsis thaliana OX=3702 GN=AGD7 PE=1 SV=1
2889	6030	A0A178VYR1	47.04	5	5	6.97E6	2	2	2	N	49252	ASP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g34350 PE=4 SV=1
3170	4800	O23365	47.03	5	5	1.53E5	2	2	2	Y	65175	Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CYP97B3 PE=1 SV=2
3170	4801	A0A178V2Z2	47.03	5	5	1.53E5	2	2	2	Y	65175	CYP97B3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g17540 PE=3 SV=1
2675	3915	Q1JPL7	46.86	5	5	4.16E6	2	2	2	N	61687	Pectinesterase/pectinesterase inhibitor 18 OS=Arabidopsis thaliana OX=3702 GN=PME18 PE=1 SV=3
2675	3917	A0A178WFS7	46.86	5	5	4.16E6	2	2	2	N	61667	Pectinesterase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g11890 PE=3 SV=1
2675	3916	A0A1P8ARX5	46.86	4	4	4.16E6	2	2	2	N	64065	Pectinesterase OS=Arabidopsis thaliana OX=3702 GN=PMEPCRA PE=3 SV=1
3172	8506	F4HX50	46.84	8	8	6.09E5	2	2	2	N	49927	5'adenylylphosphosulfate reductase 2 OS=Arabidopsis thaliana OX=3702 GN=APR2 PE=4 SV=1
3172	8508	A0A178WC29	46.84	8	8	6.09E5	2	2	2	N	50715	PRH43 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g55420 PE=4 SV=1
3172	8509	P92981	46.84	8	8	6.09E5	2	2	2	N	50656	5'-adenylylsulfate reductase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APR2 PE=1 SV=2
3166	9115	A0A1P8AT08	46.75	3	3	5.05E5	2	2	2	N	164605	Multidrug resistance-associated protein 5 OS=Arabidopsis thaliana OX=3702 GN=ABCC5 PE=4 SV=1
3166	9125	A0A178WGC2	46.75	3	3	5.05E5	2	2	2	N	168574	MRP5 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g03410 PE=4 SV=1
2458	10343	Q9STR3	46.64	14	14	4.48E7	2	2	3	Y	13869	Copia-like retroelement pol polyprotein OS=Arabidopsis thaliana OX=3702 GN=At4g26210 PE=2 SV=1
2458	10344	A0A178V5J1	46.64	14	14	4.48E7	2	2	3	Y	13869	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g30220 PE=4 SV=1
3297	4315	A0A178VDA0	46.58	4	4	2.21E6	2	2	2	N	65497	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g29880 PE=1 SV=1
3297	4316	Q8GUM4	46.58	4	4	2.21E6	2	2	2	N	65497	Uncharacterized membrane protein At3g27390 OS=Arabidopsis thaliana OX=3702 GN=At3g27390 PE=1 SV=2
3292	11364	A0A178UVJ7	46.57	10	10	8.98E6	2	2	2	N	24065	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g36040 PE=3 SV=1
3292	11365	Q9SV23	46.57	10	10	8.98E6	2	2	2	N	24065	AT4g31460/F3L17_30 OS=Arabidopsis thaliana OX=3702 GN=At4g31460 PE=2 SV=1
3010	4582	O81852	46.54	3	3	1.44E6	2	2	2	N	100250	Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AKHSDH2 PE=1 SV=1
3010	4583	Q0WRP9	46.54	3	3	1.44E6	2	2	2	N	100250	Aspartate kinase-homoserine dehydrogenase-like protein OS=Arabidopsis thaliana OX=3702 GN=At4g19710 PE=2 SV=1
3010	4584	A0A178V4Q7	46.54	3	3	1.44E6	2	2	2	N	100298	AK-HSDH II OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g23170 PE=4 SV=1
3276	108277	P15457	46.31	14	14	2.39E6	2	2	2	Y	19014	2S seed storage protein 1 OS=Arabidopsis thaliana OX=3702 GN=AT2S1 PE=1 SV=1
3276	108278	A0A178UXL9	46.31	14	14	2.39E6	2	2	2	Y	19014	SESA1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g31290 PE=4 SV=1
2607	108198	A0A178VDC1	46.12	5	5	8.56E5	2	2	2	N	71604	PUM24 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g17680 PE=4 SV=1
2607	108199	Q9LRZ3	46.12	5	5	8.56E5	2	2	2	N	71604	Pumilio homolog 24 OS=Arabidopsis thaliana OX=3702 GN=APUM24 PE=1 SV=1
2668	6362	A0A178U8E1	45.87	9	9	1.17E7	2	2	2	N	27294	Proteasome subunit alpha type OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g32760 PE=3 SV=1
2668	6363	O81146	45.87	9	9	1.17E7	2	2	2	N	27294	Proteasome subunit alpha type-6-A OS=Arabidopsis thaliana OX=3702 GN=PAA1 PE=1 SV=2
3165	6684	Q0WW84	45.86	7	7	3.83E6	2	2	2	Y	48119	Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana OX=3702 GN=RBP47B PE=2 SV=1
3165	6685	A0A178VAC7	45.86	7	7	3.83E6	2	2	2	Y	48119	RBP47B OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g20320 PE=4 SV=1
3277	108279	O80703	45.85	9	9	7.03E5	2	2	2	Y	47237	At1g61980 OS=Arabidopsis thaliana OX=3702 GN=At1g61980 PE=2 SV=1
3277	108280	A0A178WFG8	45.85	9	9	7.03E5	2	2	2	Y	47201	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g55220 PE=4 SV=1
3053	14766	Q9LK73	45.78	8	8	4.53E6	2	2	2	N	51205	UDP-glycosyltransferase 88A1 OS=Arabidopsis thaliana OX=3702 GN=UGT88A1 PE=2 SV=1
2669	5620	Q9ZWC4	45.76	11	11	4.62E6	2	2	2	N	31096	At1g04040/F21M11_2 OS=Arabidopsis thaliana OX=3702 GN=F21M11.2 PE=2 SV=1
2669	5621	A0A178WEF3	45.76	11	11	4.62E6	2	2	2	N	31096	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g03340 PE=4 SV=1
2907	6510	A0A178V7J2	45.76	3	3	9.19E5	2	2	2	N	90104	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g07660 PE=4 SV=1
2907	6511	Q0WUY5	45.76	3	3	9.19E5	2	2	2	N	90076	Flocculation protein (DUF1296) OS=Arabidopsis thaliana OX=3702 GN=At3g07660 PE=1 SV=1
3295	108295	A0A178WHE4	45.70	7	7	5.38E6	2	2	2	N	37037	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g14840 PE=4 SV=1
3295	108296	Q8LAZ5	45.70	7	7	5.38E6	2	2	2	N	37037	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3295	108297	F4HUI0	45.70	7	7	5.38E6	2	2	2	N	38552	CAAX amino terminal protease family protein OS=Arabidopsis thaliana OX=3702 GN=At1g14270 PE=4 SV=1
3295	108298	Q9M9T5	45.70	7	7	5.38E6	2	2	2	N	38911	F14L17.3 protein OS=Arabidopsis thaliana OX=3702 GN=F14L17.3 PE=4 SV=1
3113	9719	Q9SSR2	45.53	13	13	2.25E7	2	2	2	N	20022	Signal peptidase I OS=Arabidopsis thaliana OX=3702 GN=At1g52600 PE=2 SV=1
3113	9720	Q570X6	45.53	13	13	2.25E7	2	2	2	N	20008	Signal peptidase I OS=Arabidopsis thaliana OX=3702 GN=At1g52600 PE=2 SV=1
3113	9721	A0A178W7C4	45.53	13	13	2.25E7	2	2	2	N	20022	Signal peptidase I OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g46890 PE=3 SV=1
3303	8884	A0A1P8B231	45.46	4	4	2.5E6	2	2	2	N	77920	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=At2g22795 PE=4 SV=1
3303	8885	A0A1P8B209	45.46	4	4	2.5E6	2	2	2	N	79570	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=At2g22795 PE=4 SV=1
3303	8886	F4IKG5	45.46	3	3	2.5E6	2	2	2	N	82005	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=At2g22795 PE=4 SV=1
3303	8887	A0A178VU66	45.46	3	3	2.5E6	2	2	2	N	81874	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g18380 PE=4 SV=1
3168	6837	Q9FLK9	45.20	6	6	1.44E7	2	2	2	N	36796	Cf-5 disease resistance protein-like OS=Arabidopsis thaliana OX=3702 GN=MFB13.23 PE=2 SV=1
3168	6838	A0A178UJF1	45.20	6	6	1.44E7	2	2	2	N	36796	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g60700 PE=4 SV=1
3168	6839	F4K217	45.20	6	6	1.44E7	2	2	2	N	38313	Leucine-rich repeat (LRR) family protein OS=Arabidopsis thaliana OX=3702 GN=MFB13.23 PE=4 SV=1
3141	108234	A1L4Y2	45.01	7	7	1.41E6	2	2	2	Y	42908	Alcohol dehydrogenase-like 3 OS=Arabidopsis thaliana OX=3702 GN=At1g32780 PE=2 SV=1
3141	108235	A0A178W8E9	45.01	7	7	1.41E6	2	2	2	Y	42908	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g33520 PE=3 SV=1
2434	4936	Q941A7	44.99	7	7	2.11E6	2	2	2	Y	32479	AT4g20760/F21C20_110 OS=Arabidopsis thaliana OX=3702 GN=At4g20750 PE=2 SV=1
2434	4937	A0A178URE6	44.99	7	7	2.11E6	2	2	2	Y	32507	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g24080 PE=3 SV=1
2434	4939	A0A1P8B7H4	44.99	6	6	2.11E6	2	2	2	Y	34770	NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g20750 PE=3 SV=1
2268	108143	P93043	44.86	2	2	4.33E6	2	2	2	Y	110278	Vacuolar protein sorting-associated protein 41 homolog OS=Arabidopsis thaliana OX=3702 GN=VPS41 PE=1 SV=3
2268	108144	A0A178W6H2	44.86	2	2	4.33E6	2	2	2	Y	110422	Vacuolar protein sorting-associated protein 41 homolog OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g07990 PE=3 SV=1
3308	9420	A0A178VLD5	44.49	12	12	8.57E5	2	2	2	N	29331	TON1A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g49540 PE=4 SV=1
3308	7614	Q8LGF8	44.49	12	12	8.57E5	2	2	2	N	29362	Tonneau 1b OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3308	7615	Q9FQ25	44.49	12	12	8.57E5	2	2	2	N	29334	Protein TONNEAU 1a OS=Arabidopsis thaliana OX=3702 GN=TON1A PE=1 SV=1
3302	108302	A0A178VXA7	44.48	11	11	6.69E6	2	2	2	N	21816	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g23240 PE=4 SV=1
3302	108303	Q9XIN6	44.48	11	11	6.69E6	2	2	2	N	21760	At2g27290 OS=Arabidopsis thaliana OX=3702 GN=At2g27290 PE=2 SV=1
3302	108304	Q8LBI5	44.48	11	11	6.69E6	2	2	2	N	21788	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3288	11296	Q9SUK9	44.47	6	6	1.88E6	2	2	2	N	50297	Probable protein phosphatase 2C 55 OS=Arabidopsis thaliana OX=3702 GN=At4g16580 PE=2 SV=2
3288	11297	A0A178UYA1	44.47	6	6	1.88E6	2	2	2	N	50309	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g19530 PE=4 SV=1
2915	108176	Q94AI7	44.34	2	2	5.28E5	2	2	2	Y	124298	Protein TOPLESS OS=Arabidopsis thaliana OX=3702 GN=TPL PE=1 SV=1
2915	8987	A0A178WLB2	44.34	2	2	5.28E5	2	2	2	Y	124328	WSIP1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g16510 PE=4 SV=1
2202	108162	A0A178VAH5	44.32	30	30	3.34E7	2	2	4	Y	6429	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g37530 PE=4 SV=1
2202	108163	Q680P8	44.32	30	30	3.34E7	2	2	4	Y	6429	40S ribosomal protein S29 OS=Arabidopsis thaliana OX=3702 GN=RPS29A PE=3 SV=2
2202	108164	A0A178VIQ1	44.32	27	27	3.34E7	2	2	4	Y	7160	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g37570 PE=3 SV=1
3052	6439	C0Z2T3	44.27	8	8	3.35E6	2	2	2	N	36415	AT2G01110 protein OS=Arabidopsis thaliana OX=3702 GN=At2g01110 PE=2 SV=1
3052	6440	Q9SJV5	44.27	8	8	3.35E6	2	2	2	N	37367	Sec-independent protein translocase protein TATC, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TATC PE=1 SV=2
3052	6441	A0A178VUB7	44.27	8	8	3.35E6	2	2	2	N	37367	UNE3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g00060 PE=3 SV=1
2464	10004	A0A178VXI9	44.27	42	42	8.52E7	2	2	4	N	5976	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g37900 PE=4 SV=1
2464	10005	Q94K78	44.27	42	42	8.52E7	2	2	4	N	5976	Transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=At2g40765 PE=2 SV=1
3140	8180	Q8LG70	44.13	16	16	1.11E7	2	2	2	N	28863	Probable 6-phosphogluconolactonase 2 OS=Arabidopsis thaliana OX=3702 GN=PGL2 PE=2 SV=2
3140	8181	A0A178VCR4	44.13	16	16	1.11E7	2	2	2	N	28883	Probable 6-phosphogluconolactonase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g43510 PE=3 SV=1
2764	59911	A0A178VC73	44.03	6	6	3.87E5	2	2	2	N	63136	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g27680 PE=4 SV=1
2764	59550	F4JA39	44.03	6	6	3.87E5	2	2	2	N	63058	SLH domain protein OS=Arabidopsis thaliana OX=3702 GN=At3g25680 PE=4 SV=1
2764	59551	Q9LI75	44.03	5	5	3.87E5	2	2	2	N	63989	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
3072	59856	A0A178UNA3	43.99	6	6	1.25E6	2	2	2	N	51793	PMAT1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g36500 PE=4 SV=1
3072	59857	Q940Z5	43.99	6	6	1.25E6	2	2	2	N	51765	Phenolic glucoside malonyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=PMAT1 PE=1 SV=1
3069	59773	A0A178V4D8	43.37	10	10	5.44E6	2	2	2	Y	32190	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g24260 PE=4 SV=1
3069	59774	Q9SUC0	43.37	9	9	5.44E6	2	2	2	Y	37365	Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g20930 PE=2 SV=3
3069	59775	A0A178V240	43.37	9	9	5.44E6	2	2	2	Y	37425	3-hydroxyisobutyrate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g24260 PE=3 SV=1
3069	59772	A0A1P8B7M5	43.37	11	11	5.44E6	2	2	2	Y	29288	6-phosphogluconate dehydrogenase family protein OS=Arabidopsis thaliana OX=3702 GN=At4g20930 PE=4 SV=1
2761	8241	A0A178W414	43.37	11	11	4.94E6	3	3	3	Y	51818	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g42670 PE=4 SV=1
2761	8242	Q9LP67	43.37	11	11	4.94E6	3	3	3	Y	51818	T1N15.19 OS=Arabidopsis thaliana OX=3702 GN=At1g48570 PE=2 SV=1
3058	108240	A0A178VZ80	43.30	8	8	1.54E7	2	2	2	Y	43022	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g00370 PE=4 SV=1
3058	108241	Q9ZNQ5	43.30	8	8	1.54E7	2	2	2	Y	43022	NHL domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At2g01410 PE=2 SV=1
3169	108287	F4JDA6	43.20	5	5	1.1E6	2	2	2	N	50819	GPI transamidase component PIG-S-like protein OS=Arabidopsis thaliana OX=3702 GN=At3g07180 PE=4 SV=1
3169	7994	F4JDA5	43.20	4	4	1.1E6	2	2	2	N	66214	GPI transamidase component PIG-S-like protein OS=Arabidopsis thaliana OX=3702 GN=At3g07180 PE=4 SV=1
3169	7995	Q8W4D7	43.20	4	4	1.1E6	2	2	2	N	67129	GPI transamidase component PIG-S-like protein OS=Arabidopsis thaliana OX=3702 GN=T1B9.16 PE=2 SV=1
3169	108288	A0A178VA33	43.20	4	4	1.1E6	2	2	2	N	66995	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g07090 PE=4 SV=1
3169	7996	Q9SFU8	43.20	4	4	1.1E6	2	2	2	N	67499	T1B9.16 protein OS=Arabidopsis thaliana OX=3702 GN=T1B9.16 PE=4 SV=1
2951	108372	Q3E8H9	43.08	5	5	3.03E6	2	2	2	N	33361	Late embryogenesis abundant protein (LEA) family protein OS=Arabidopsis thaliana OX=3702 GN=At5g44310 PE=4 SV=1
2951	108373	Q9FKV7	43.08	5	5	3.03E6	2	2	2	N	37159	Late embryogenesis abundant protein (LEA) family protein OS=Arabidopsis thaliana OX=3702 GN=At5g44310 PE=4 SV=1
2951	108374	Q6NMC2	43.08	5	5	3.03E6	2	2	2	N	38451	At5g44310 OS=Arabidopsis thaliana OX=3702 GN=At5g44310 PE=2 SV=1
2951	108375	A0A178UQA5	43.08	5	5	3.03E6	2	2	2	N	38524	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g42430 PE=4 SV=1
3304	10026	Q9XGX9	43.04	24	24	1.31E7	2	2	2	Y	10715	Mitochondrial import inner membrane translocase subunit TIM9 OS=Arabidopsis thaliana OX=3702 GN=TIM9 PE=1 SV=2
2921	6589	A0A178UYD4	42.96	3	3	1.54E6	2	2	2	N	121306	DDB1A OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g04700 PE=4 SV=1
2921	6590	Q9M0V3	42.96	3	3	1.54E6	2	2	2	N	121306	DNA damage-binding protein 1a OS=Arabidopsis thaliana OX=3702 GN=DDB1A PE=1 SV=1
3294	10007	A0A1P8B421	42.78	16	16	3.76E6	2	2	2	Y	19332	PLAC8 family protein OS=Arabidopsis thaliana OX=3702 GN=At4g23470 PE=4 SV=1
3294	10008	A0A178UWB6	42.78	15	15	3.76E6	2	2	2	Y	21676	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g27190 PE=4 SV=1
3294	10009	Q67XV0	42.78	15	15	3.76E6	2	2	2	Y	21676	PLAC8 family protein OS=Arabidopsis thaliana OX=3702 GN=At4g23470 PE=2 SV=1
3294	10010	F4JNK5	42.78	12	12	3.76E6	2	2	2	Y	26082	PLAC8 family protein OS=Arabidopsis thaliana OX=3702 GN=At4g23470 PE=4 SV=1
3294	10011	Q8LCK6	42.78	12	12	3.76E6	2	2	2	Y	27439	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3294	10012	Q681W8	42.78	11	11	3.76E6	2	2	2	Y	28409	mRNA, clone: RAFL21-92-L18 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3294	10013	Q681W9	42.78	11	11	3.76E6	2	2	2	Y	28367	mRNA, clone: RAFL21-92-I07 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3294	10014	Q67YE3	42.78	11	11	3.76E6	2	2	2	Y	28443	mRNA, clone: RAFL25-03-N20 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3294	10015	Q8W458	42.78	11	11	3.76E6	2	2	2	Y	28427	PLAC8 family protein OS=Arabidopsis thaliana OX=3702 GN=F16G20.170:F16G20.180 PE=2 SV=1
3050	9641	A0A178UBS2	42.69	13	13	8.6E6	2	2	2	N	19097	EMB3137 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g13790 PE=3 SV=1
3050	9642	P42732	42.69	13	13	8.6E6	2	2	2	N	19097	30S ribosomal protein S13, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPS13 PE=2 SV=1
3050	9640	B3H631	42.69	17	17	8.6E6	2	2	2	N	14412	Ribosomal protein S13/S18 family OS=Arabidopsis thaliana OX=3702 GN=EMB3137 PE=3 SV=1
3133	10323	A0A178WAB1	42.69	9	9	4.29E6	2	2	2	N	38798	MES14 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g34790 PE=4 SV=1
3133	10324	Q9FVW3	42.69	9	9	4.29E6	2	2	2	N	38855	Putative methylesterase 14, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MES14 PE=1 SV=1
3301	5225	A0A178V6Q6	42.65	7	7	1.36E7	2	2	2	N	40925	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g39660 PE=4 SV=1
3301	5226	Q8VWF1	42.65	7	7	1.36E7	2	2	2	N	40925	SH3 domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=SH3P2 PE=1 SV=1
3143	8879	A0A178UAS7	42.29	5	5	2.12E6	2	2	2	N	76317	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g52590 PE=1 SV=1
3143	8880	Q93XY1	42.29	5	5	2.12E6	2	2	2	N	76317	At5g53620 OS=Arabidopsis thaliana OX=3702 GN=MNC6.16 PE=1 SV=1
2942	10291	Q9LXX7	42.16	4	4	6.51E6	2	2	2	N	57127	Cytochrome P450, family 94, subfamily D, polypeptide 2 OS=Arabidopsis thaliana OX=3702 GN=T5P19_280 PE=3 SV=1
2942	10292	A0A384LI94	42.16	4	4	6.51E6	2	2	2	N	57127	CYP94D2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g51230 PE=3 SV=1
3139	108232	Q9M8M9	41.91	9	9	2.33E6	2	2	2	N	47401	S15/NS1, RNA-binding protein OS=Arabidopsis thaliana OX=3702 GN=T21F11.5 PE=3 SV=1
3139	108233	A0A178W8E5	41.91	9	9	2.33E6	2	2	2	N	47488	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g75470 PE=3 SV=1
3134	7497	Q9M0N1	41.69	6	6	3.15E6	2	2	2	Y	52803	Plant UBX domain-containing protein 10 OS=Arabidopsis thaliana OX=3702 GN=PUX10 PE=2 SV=1
3305	108305	A0A178V7W2	41.67	7	7	1.73E6	2	2	2	N	65068	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g43880 PE=4 SV=1
3305	108306	Q0WTB4	41.67	7	7	1.73E6	2	2	2	N	69579	GTP-binding protein At3g49725, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g49725 PE=2 SV=2
3011	5513	A0A178WAV9	41.59	7	7	1.05E6	2	2	2	N	53638	ASA1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g20890 PE=4 SV=1
3011	5514	Q43870	41.59	7	7	1.05E6	2	2	2	N	53638	ATP sulfurylase 2 OS=Arabidopsis thaliana OX=3702 GN=APS2 PE=1 SV=1
2901	8319	F4IDS7	41.49	2	2	1.12E6	2	2	2	N	112320	Vacuolar sorting protein 18 OS=Arabidopsis thaliana OX=3702 GN=VPS18 PE=1 SV=1
2943	7727	A0A097PP44	41.27	11	11	1.57E6	2	2	3	N	32137	Uncoupling protein 3 (Fragment) OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
2943	7728	Q9XI74	41.27	11	11	1.57E6	2	2	3	N	33441	Mitochondrial uncoupling protein 3 OS=Arabidopsis thaliana OX=3702 GN=PUMP3 PE=2 SV=1
2943	7729	A0A178WH45	41.27	11	11	1.57E6	2	2	3	N	33441	UCP3 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g14680 PE=3 SV=1
3043	3648	A0A1P8BE56	40.86	3	3	1.04E6	2	2	2	N	87615	P-type ATPase of Arabidopsis 2 OS=Arabidopsis thaliana OX=3702 GN=PAA2 PE=3 SV=1
3043	3651	B9DFX7	40.86	3	3	1.04E6	2	2	2	N	94260	Copper-transporting ATPase PAA2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PAA2 PE=1 SV=1
3043	4407	F4K8C8	40.86	3	3	1.04E6	2	2	2	N	91859	P-type ATPase of Arabidopsis 2 OS=Arabidopsis thaliana OX=3702 GN=PAA2 PE=3 SV=1
3142	108236	A0A178WQS8	40.50	2	2	3.45E5	2	2	2	Y	131593	SCD1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g43200 PE=4 SV=1
3183	9806	Q8LDU8	40.36	23	23	1.7E6	2	2	2	N	14666	Acyl carrier protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3183	9807	P25702	40.36	23	23	1.7E6	2	2	2	N	14650	Acyl carrier protein 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ACP3 PE=1 SV=2
3183	9808	A0A178W5G2	40.36	23	23	1.7E6	2	2	2	N	14620	Acyl carrier protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g49120 PE=3 SV=1
3182	108316	A0A1P8AU36	39.58	7	7	3.34E6	2	2	2	N	36967	NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g54870 PE=4 SV=1
3182	108317	A0A178W6Z1	39.58	7	7	3.34E6	2	2	2	N	39237	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g49360 PE=4 SV=1
3182	108318	Q9FZ42	39.58	8	8	3.34E6	2	2	2	N	31387	NADPH-dependent aldehyde reductase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ChlADR1 PE=1 SV=1
3309	60384	Q9STL8	39.29	4	4	3.37E6	2	2	2	N	71466	Probable Ufm1-specific protease OS=Arabidopsis thaliana OX=3702 GN=At3g48380 PE=1 SV=2
3309	60385	A0A178VEK0	39.29	4	4	3.37E6	2	2	2	N	71513	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g42490 PE=4 SV=1
3309	60386	F4JDY2	39.29	4	4	3.37E6	2	2	2	N	72805	Peptidase C78, ubiquitin fold modifier-specific peptidase 1/ 2 OS=Arabidopsis thaliana OX=3702 GN=At3g48380 PE=1 SV=1
3306	10662	Q9FKF4	39.17	10	10	3.21E6	2	2	2	Y	33790	Protein ORANGE, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OR PE=1 SV=1
3306	10663	A0A178UAP2	39.17	10	10	3.21E6	2	2	2	Y	33790	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g61180 PE=4 SV=1
2945	8258	Q8S904	38.99	14	14	2.07E7	2	2	3	Y	22121	Adrenodoxin-like protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MFDX2 PE=2 SV=1
3313	4820	A0A178V6H0	38.90	7	7	4.97E6	2	2	2	N	39534	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g21210 PE=4 SV=1
3313	4821	Q8L7W0	38.90	7	7	4.97E6	2	2	2	N	39534	SH3 domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=SH3P3 PE=1 SV=1
2913	108168	A0A384KMZ3	37.91	8	8	6.42E6	2	2	2	N	26887	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g12690 PE=4 SV=1
2913	108169	Q9LTX0	37.91	8	8	6.42E6	2	2	2	N	26887	AT3g12650/T2E22_103 OS=Arabidopsis thaliana OX=3702 GN=T2E22.4 PE=2 SV=1
3073	5772	A0A178VG47	37.85	6	6	2.02E6	2	2	2	Y	57765	HCF101 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g26400 PE=3 SV=1
3317	6446	A0A1R7T377	37.34	11	11	9.22E5	2	2	2	N	37834	DUF1995 domain protein, putative (DUF1995) OS=Arabidopsis thaliana OX=3702 GN=At5g27560 PE=4 SV=1
3317	6447	Q94K68	37.34	11	11	9.22E5	2	2	2	N	38046	DUF1995 domain protein, putative (DUF1995) OS=Arabidopsis thaliana OX=3702 GN=At5g27560 PE=2 SV=1
3317	8011	A0A178UPT1	37.34	11	11	9.22E5	2	2	2	N	38060	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g27470 PE=4 SV=1
3184	10016	Q9SD79	37.21	12	12	7.91E7	2	2	2	N	16580	Wiskott-aldrich syndrome family protein, putative (DUF1118) OS=Arabidopsis thaliana OX=3702 GN=F13G24.250 PE=1 SV=1
3184	10017	A0A178UDZ5	37.21	12	12	7.91E7	2	2	2	N	16580	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g07820 PE=1 SV=1
3184	10018	Q8VYV1	37.21	12	12	7.91E7	2	2	2	N	16566	At5g08050/F13G24_250 OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3314	8643	F4J037	36.94	17	17	3.38E6	2	2	2	Y	27730	Post-illumination chlorophyll fluorescence increase OS=Arabidopsis thaliana OX=3702 GN=PIFI PE=4 SV=1
3314	9235	F4J034	36.94	16	16	3.38E6	2	2	2	Y	29377	Post-illumination chlorophyll fluorescence increase OS=Arabidopsis thaliana OX=3702 GN=PIFI PE=4 SV=1
3314	8644	Q9LVZ5	36.94	16	16	3.38E6	2	2	2	Y	29691	Post-illumination chlorophyll fluorescence increase OS=Arabidopsis thaliana OX=3702 GN=PIFI PE=2 SV=1
3314	8645	F4J036	36.94	16	16	3.38E6	2	2	2	Y	29732	Post-illumination chlorophyll fluorescence increase OS=Arabidopsis thaliana OX=3702 GN=PIFI PE=4 SV=1
3314	8646	A0A384KKW7	36.94	16	16	3.38E6	2	2	2	Y	29691	PIFI OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g16630 PE=4 SV=1
3120	59657	Q8LEB1	36.59	11	11	5.53E6	2	2	2	N	24609	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3120	59656	Q93XZ7	36.59	11	11	5.53E6	2	2	2	N	24565	At5g42570 OS=Arabidopsis thaliana OX=3702 GN=At5g42570 PE=1 SV=1
3120	59566	Q9FH68	36.59	9	9	5.53E6	2	2	2	N	28569	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=4 SV=1
3120	59655	A0A178US89	36.59	20	20	5.53E6	2	2	2	N	13158	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g40420 PE=4 SV=1
2688	10060	A0A178W5G5	36.05	7	7	6.7E6	2	2	2	N	33828	SRC2 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g08890 PE=4 SV=1
2688	10061	O04023	36.05	6	6	6.7E6	2	2	2	N	34189	Protein SRC2 homolog OS=Arabidopsis thaliana OX=3702 GN=SRC2 PE=1 SV=1
3117	5665	Q93WC8	35.37	7	7	2.28E7	2	2	2	N	33287	Protein prenylyltransferase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g04830 PE=2 SV=1
3117	5666	A0A384LJD8	35.37	7	7	2.28E7	2	2	2	N	33745	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g04300 PE=4 SV=1
3117	5667	Q9CAU9	35.37	7	7	2.28E7	2	2	2	N	33745	Contains similarity to O-linked GlcNAc transferases OS=Arabidopsis thaliana OX=3702 GN=At3g04830 PE=2 SV=1
3118	6812	A0A384LPG4	35.09	5	5	5.52E5	2	2	2	N	59117	Glucose-6-phosphate 1-dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g38480 PE=3 SV=1
3118	6813	Q0WSL0	35.09	5	5	5.52E5	2	2	2	N	59117	Glucose-6-phosphate 1-dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=At5g40760 PE=2 SV=1
3118	6814	Q9FJI5	35.09	5	5	5.52E5	2	2	2	N	59117	Glucose-6-phosphate 1-dehydrogenase 6, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=G6PD6 PE=1 SV=1
3217	7076	Q9C7V7	34.61	4	4	2.93E6	2	2	2	N	64495	At1g64330 OS=Arabidopsis thaliana OX=3702 GN=At1g64330 PE=2 SV=1
3328	59747	Q9SYL3	33.76	11	11	6.3E6	2	2	2	N	17901	F3F20.17 protein OS=Arabidopsis thaliana OX=3702 GN=F3F20.17 PE=4 SV=1
3328	59746	Q8LC62	33.76	11	11	6.3E6	2	2	2	N	17933	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 PE=2 SV=1
3328	59748	Q8GWP6	33.76	11	11	6.3E6	2	2	2	N	18574	Selenoprotein family protein OS=Arabidopsis thaliana OX=3702 GN=At1g05720 PE=2 SV=1
3328	59749	A0A178W3Q1	33.76	11	11	6.3E6	2	2	2	N	18574	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g05200 PE=4 SV=1
3330	60049	P0DKI3	32.92	14	14	2.48E6	2	2	2	N	28332	Tropinone reductase homolog At1g07440 OS=Arabidopsis thaliana OX=3702 GN=At1g07440 PE=1 SV=1
3330	60050	A0A178WGL5	32.92	14	14	2.48E6	2	2	2	N	28332	Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g07070 PE=4 SV=1
total 5802 proteins

A0A178UTF1

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
K.FDAGLTESQMIQHMVDLASK.N	Y	67.26	2220.0554	20	1.8	1111.0370	2	137.09	3	87517	20190523-10-H3.raw	5.8E8	4	4	125	144
R.FGVPMGYGGPHAAFLATSQEYK.R	N	67.14	2327.1045	22	0.6	1164.5602	2	112.34	3	64720	20190523-10-H3.raw	4.62E8	3	3	340	361
R.VVDSTTITASFDETTTLDDVDKLFK.V	Y	63.37	2760.3594	25	1.8	921.1287	3	141.80	3	91880	20190523-10-H3.raw	2.03E8	10	10	482	506
R.NIMENPAWYTQYTPYQAEISQGR.L	N	63.06	2759.2649	23	0.2	1380.6400	2	127.98	3	79078	20190523-10-H3.raw	1.9E8	5	5	168	190
K.DLSLC(+57.02)HSMIPLGSC(+57.02)TMK.L	N	62.74	1948.8879	17	1.1	975.4523	2	112.42	3	64789	20190523-10-H3.raw	6.93E8	4	4	565	581	Carbamidomethylation
K.TFVIASNC(+57.02)HPQTIDVC(+57.02)K.T	N	62.26	1988.9448	17	1.3	995.4810	2	90.58	3	45629	20190523-10-H3.raw	1.01E9	8	8	238	254	Carbamidomethylation
K.SFIGMGYYNTHVPTVILR.N	Y	62.26	2067.0610	18	1.0	1034.5388	2	120.50	3	72147	20190523-10-H3.raw	4.21E8	4	4	150	167
R.NVC(+57.02)IIPVSAHGTNPASAAMC(+57.02)GMK.I	N	59.41	2385.1062	23	-0.3	1193.5601	2	103.12	3	56469	20190523-10-H3.raw	1.02E9	7	7	662	684	Carbamidomethylation
K.VVMATDLLALTVLKPPGEFGADIVVGSAQR.F	Y	59.31	3066.6787	30	4.3	1023.2379	3	152.24	3	101492	20190523-10-H3.raw	2.31E8	7	7	310	339
K.VFASGKPVPFTAESLAPEVQNSIPSSLTR.E	Y	59.18	3028.5869	29	1.5	1010.5377	3	124.23	3	75601	20190523-10-H3.raw	6.45E8	7	7	507	535
R.DKATSNIC(+57.02)TAQALLANMAAMYAVYHGPAGLK.S	Y	59.18	3250.5938	31	-0.3	813.6555	4	147.25	3	96884	20190523-10-H3.raw	7.29E7	3	3	395	425	Carbamidomethylation
R.ESPYLTHPIFNMYHTEHELLR.Y	N	58.17	2626.2639	21	-0.8	876.4279	3	108.57	3	61329	20190523-10-H3.raw	1.43E9	13	13	536	556
K.NHLAPFLPSHPVIPTGGIPQPEK.T	Y	57.66	2445.3169	23	-0.4	816.1126	3	108.30	3	61106	20190523-10-H3.raw	8.76E8	12	12	794	816
R.FGVPMGYGGPHAAFLATSQEYKR.M	N	57.38	2483.2056	23	0.2	621.8088	4	104.18	3	57431	20190523-10-H3.raw	4.82E8	5	5	340	362
K.FSKFDAGLTESQMIQHMVDLASK.N	Y	56.89	2582.2510	23	0.3	646.5702	4	130.29	3	81175	20190523-10-H3.raw	2.78E7	3	3	122	144
R.GVNGTVAHEFIIDLR.G	N	56.83	1639.8682	15	-0.2	820.9412	2	108.77	3	61494	20190523-10-H3.raw	3.66E8	12	12	877	891
K.DIDYSSGDVC(+57.02)GVLVQYPGTEGEVLDYAEFVK.N	Y	56.62	3423.5703	31	1.0	1142.1985	3	151.61	3	100897	20190523-10-H3.raw	1.27E7	2	2	271	301	Carbamidomethylation
K.C(+57.02)SDAHAIADAASKSEINLR.V	Y	56.37	2027.9694	19	-0.5	676.9967	3	85.54	3	41387	20190523-10-H3.raw	6.66E7	2	2	463	481	Carbamidomethylation
R.VHGLAGIFSLGLNK.L	Y	56.25	1424.8140	14	0.0	713.4142	2	114.86	3	67012	20190523-10-H3.raw	4.18E8	7	7	431	444
K.TFC(+57.02)IPHGGGGPGMGPIGVK.N	N	55.71	1837.8967	19	0.2	919.9558	2	99.59	3	53384	20190523-10-H3.raw	7.93E7	3	3	775	793	Carbamidomethylation
K.ATSNIC(+57.02)TAQALLANMAAMYAVYHGPAGLK.S	Y	55.59	3007.4717	29	1.8	1003.4996	3	150.05	3	99469	20190523-10-H3.raw	5.95E8	5	5	397	425	Carbamidomethylation
K.FC(+57.02)GFDHIDSLIDATVPK.S	Y	55.57	1933.9243	17	0.8	967.9702	2	129.05	3	80069	20190523-10-H3.raw	4.24E8	5	5	97	113	Carbamidomethylation
R.LMDYGFHGPTMSWPVPGTLMIEPTESESK.A	N	55.57	3236.4868	29	1.1	1079.8374	3	140.68	3	90836	20190523-10-H3.raw	3.51E8	6	6	908	936
K.VVTSDLKDIDYSSGDVC(+57.02)GVLVQYPGTEGEVLDYAEFVK.N	Y	54.81	4165.9927	38	1.9	1389.6741	3	142.19	3	92249	20190523-10-H3.raw	1.58E7	2	2	264	301	Carbamidomethylation
K.AELDRFC(+57.02)DALISIREEIAQIEKGNADVQNNVLK.G	Y	54.28	3770.9260	33	0.4	755.1927	5	150.05	3	99470	20190523-10-H3.raw	1.74E7	2	2	937	969	Carbamidomethylation
K.GAPHPPSLLMADTWK.K	N	53.80	1619.8130	15	0.1	810.9139	2	104.67	3	57864	20190523-10-H3.raw	8.59E8	9	9	970	984
R.LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDR.F	N	53.04	3820.7786	34	3.5	956.2053	4	135.24	3	85784	20190523-10-H3.raw	4.09E7	3	3	908	941
K.LGVAEVQELPFFDTVK.I	Y	52.59	1790.9454	16	0.4	896.4803	2	138.46	3	88794	20190523-10-H3.raw	7.05E8	4	4	445	460
K.RLMDYGFHGPTMSWPVPGTLMIEPTESESK.A	N	51.43	3392.5879	30	-0.4	849.1539	4	132.70	3	83425	20190523-10-H3.raw	3.95E7	2	2	907	936
K.AELDRFC(+57.02)DALISIREEIAQIEK.G	Y	50.49	2618.3374	22	1.1	655.5923	4	149.50	3	98960	20190523-10-H3.raw	4.72E7	3	3	937	958	Carbamidomethylation
R.FC(+57.02)DALISIREEIAQIEK.G	Y	49.42	2034.0455	17	0.2	679.0226	3	134.57	3	85164	20190523-10-H3.raw	8.6E7	3	3	942	958	Carbamidomethylation
K.AELDRFC(+57.02)DALISIR.E	N	49.32	1677.8508	14	0.7	560.2913	3	117.56	3	69448	20190523-10-H3.raw	4.81E7	1	1	937	950	Carbamidomethylation
K.TAPLGAISAAPWGSALILPISYTYIAMM(+15.99)GSGGLTDASK.I	Y	49.19	3767.9153	38	0.6	1256.9797	3	157.21	3	106210	20190523-10-H3.raw	4.35E6	1	1	817	854	Oxidation (M)
K.C(+57.02)SDAHAIADAASK.S	Y	48.72	1315.5826	13	1.2	439.5353	3	59.12	3	19703	20190523-10-H3.raw	2.32E8	2	2	463	475	Carbamidomethylation
K.VVM(+15.99)ATDLLALTVLKPPGEFGADIVVGSAQR.F	Y	47.59	3082.6736	30	6.7	1028.5720	3	148.56	3	98083	20190523-10-H3.raw	1.75E7	4	4	310	339	Oxidation (M)
K.PVPFTAESLAPEVQNSIPSSLTR.E	Y	47.27	2439.2644	23	1.1	814.0963	3	130.85	3	81701	20190523-10-H3.raw	2.93E7	4	4	513	535
R.FC(+57.02)DALISIREEIAQIEKGNADVQNNVLK.G	Y	46.88	3186.6343	28	0.3	797.6661	4	138.17	3	88517	20190523-10-H3.raw	2.94E7	1	1	942	969	Carbamidomethylation
R.NIM(+15.99)ENPAWYTQYTPYQAEISQGR.L	N	46.75	2775.2598	23	3.2	1388.6416	2	120.60	3	72239	20190523-10-H3.raw	0	1	1	168	190	Oxidation (M)
K.SFIGM(+15.99)GYYNTHVPTVILR.N	Y	46.63	2083.0562	18	3.7	695.3619	3	113.32	3	65605	20190523-10-H3.raw	2.23E7	2	2	150	167	Oxidation (M)
R.KLVC(+57.02)TLLPEEEQVAAAVSA	Y	46.27	2027.0608	19	1.3	1014.5389	2	123.76	3	75166	20190523-10-H3.raw	2.22E8	4	4	1019	1037	Carbamidomethylation
K.TAPLGAISAAPWGSALILPISYTYIAMMGSGGLTDASK.I	Y	46.02	3751.9204	38	2.7	1251.6508	3	159.02	3	107886	20190523-10-H3.raw	3.03E7	1	1	817	854
F.TAESLAPEVQNSIPSSLTR.E	Y	46.01	1999.0222	19	0.3	1000.5187	2	108.65	3	61399	20190523-10-H3.raw	1.43E8	4	4	517	535
S.ISVDAVKPSDTFPR.R	Y	45.23	1530.8042	14	0.5	766.4098	2	90.08	3	45205	20190523-10-H3.raw	5.69E8	5	5	68	81
R.EYAAFPAPWLR.S	N	43.83	1319.6663	11	-0.2	660.8403	2	124.90	3	76232	20190523-10-H3.raw	4.37E8	4	4	990	1000
K.KTFVIASNC(+57.02)HPQTIDVC(+57.02)K.T	N	43.54	2117.0398	18	-1.2	530.2666	4	80.43	3	37059	20190523-10-H3.raw	6.57E7	3	3	237	254	Carbamidomethylation
K.GAPHPPSLLMADTWKKPYSR.E	N	43.23	2251.1572	20	-0.6	563.7963	4	92.89	3	47598	20190523-10-H3.raw	2.97E6	1	1	970	989
R.GFKNTAGIEPEDVAK.R	N	42.50	1574.7939	15	-0.3	788.4040	2	76.64	3	33931	20190523-10-H3.raw	1.56E7	2	2	892	906
K.DNLAALMVTYPSTHGVYEEGIDEIC(+57.02)NIIHENGGQVYMDGANMNAQVGLTSPGFIGADVC(+57.02)HLNLHK.T	N	42.39	7069.2876	65	-0.2	1179.2217	6	152.69	3	101926	20190523-10-H3.raw	6.04E6	3	3	710	774	Carbamidomethylation
R.LM(+15.99)DYGFHGPTMSWPVPGTLMIEPTESESK.A	N	41.95	3252.4817	29	1.7	1085.1697	3	136.80	3	87244	20190523-10-H3.raw	9.73E6	2	2	908	936	Oxidation (M)
K.NTAGIEPEDVAK.R	N	41.77	1242.6091	12	1.0	622.3124	2	73.65	3	31415	20190523-10-H3.raw	2.76E8	2	2	895	906
R.LMDYGFHGPTMSWPVPGTLM(+15.99)IEPTESESK.A	N	41.67	3252.4817	29	2.1	1085.1702	3	135.69	3	86208	20190523-10-H3.raw	8.92E6	1	1	908	936	Oxidation (M)
K.GNADVQNNVLK.G	Y	41.50	1170.5992	11	0.8	586.3074	2	67.40	3	26392	20190523-10-H3.raw	1.76E8	1	1	959	969
R.LMDF(sub Y)GFHGPTM(+15.99)SWPVPGTLMIEPTESESK.A	N	40.72	3236.4868	29	0.1	810.1290	4	140.51	3	90675	20190523-10-H3.raw	1.09E7	1	1	908	936	Oxidation (M)
K.DLSLC(+57.02)HSM(+15.99)IPLGSC(+57.02)TMK.L	N	40.61	1964.8828	17	-0.4	655.9680	3	102.47	3	55876	20190523-10-H3.raw	1.21E7	1	1	565	581	Carbamidomethylation; Oxidation (M)
K.IITVGTDAKGNINIEEVRK.A	Y	39.74	2069.1479	19	-0.6	518.2939	4	88.57	3	43955	20190523-10-H3.raw	1.09E7	1	1	685	703
R.ESPYLTHPIFNM(+15.99)YHTEHELLR.Y	N	39.70	2642.2588	21	1.6	529.4599	5	98.53	3	52441	20190523-10-H3.raw	2.43E7	2	2	536	556	Oxidation (M)
K.NTAGIEPEDVAKR.L	N	39.33	1398.7102	13	1.1	467.2445	3	68.25	3	27068	20190523-10-H3.raw	1.13E8	4	4	895	907
Q.RFGVPMGYGGPHAAFLATSQEYK.R	N	39.17	2483.2056	23	1.6	621.8096	4	102.93	3	56296	20190523-10-H3.raw	1.14E7	1	1	339	361
K.GNINIEEVR.K	Y	38.84	1042.5406	9	1.3	522.2783	2	78.08	3	35058	20190523-10-H3.raw	1.89E8	2	2	694	702
R.IIGISVDSSGK.Q	Y	37.69	1074.5920	11	0.8	538.3037	2	86.03	3	41771	20190523-10-H3.raw	4.15E8	3	3	368	378
N.AGAAGEYAGLMVIR.A	N	37.22	1377.7074	14	-2.1	689.8595	2	108.02	3	60865	20190523-10-H3.raw	1.23E7	1	1	637	650
K.IAILNANYMAK.R	N	36.94	1220.6587	11	0.1	611.3367	2	99.73	3	53507	20190523-10-H3.raw	5.39E8	1	1	855	865
K.ATSNIC(+57.02)TAQALLANMAAM(+15.99)YAVYHGPAGLK.S	Y	36.86	3023.4668	29	1.2	1008.8307	3	142.91	3	92909	20190523-10-H3.raw	6.54E6	1	1	397	425	Carbamidomethylation; Oxidation (M)
R.EEIAQIEKGNADVQNNVLK.G	Y	36.46	2111.0857	19	-1.3	1056.5487	2	90.49	3	45554	20190523-10-H3.raw	1.31E7	2	2	951	969
K.GAPHPPSLLM(+15.99)ADTWK.K	N	36.32	1635.8079	15	0.9	546.2770	3	96.84	3	51004	20190523-10-H3.raw	2.36E6	1	1	970	984	Oxidation (M)
R.FC(+57.02)DALISIR.E	N	36.06	1093.5590	9	0.1	547.7868	2	104.94	3	58108	20190523-10-H3.raw	3.68E8	2	2	942	950	Carbamidomethylation
K.LVC(+57.02)TLLPEEEQVAAAVSA	Y	35.45	1898.9659	18	1.5	950.4916	2	138.52	3	88857	20190523-10-H3.raw	2.05E8	2	2	1020	1037	Carbamidomethylation
K.TFC(+57.02)IPHGGGGPGM(+15.99)GPIGVK.N	N	35.02	1853.8916	19	1.0	927.9540	2	91.23	3	46187	20190523-10-H3.raw	1.97E7	2	2	775	793	Carbamidomethylation; Oxidation (M)
K.DLSLC(+57.02)HSMIPLGSC(+57.02)TM(+15.99)K.L	N	34.33	1964.8828	17	-1.4	655.9673	3	106.78	3	59741	20190523-10-H3.raw	1.34E7	2	2	565	581	Carbamidomethylation; Oxidation (M)
K.SIAQRVHGLAGIFSLGLNK.L	Y	34.27	1980.1268	19	0.1	496.0390	4	116.97	3	68904	20190523-10-H3.raw	4.35E5	1	1	426	444
R.FGVPM(+15.99)GYGGPHAAFLATSQEYK.R	N	34.14	2343.0994	22	0.6	782.0409	3	106.47	3	59481	20190523-10-H3.raw	6.38E6	1	1	340	361	Oxidation (M)
R.GFKNTAGIEPEDVAKR.L	N	33.45	1730.8950	16	1.7	577.9733	3	72.29	3	30308	20190523-10-H3.raw	1.59E7	2	2	892	907
R.LMDF(sub Y)GY(sub F)HGPTMSWPVPGTLM(+15.99)IEPTESESK.A	N	32.40	3252.4817	29	1.6	1085.1696	3	135.32	3	85868	20190523-10-H3.raw	8.92E6	1	1	908	936	Oxidation (M)
R.VDNVYGDR.K	N	31.62	936.4301	8	0.2	469.2224	2	59.84	3	20259	20190523-10-H3.raw	2.48E7	1	1	1011	1018
K.RLMDF(sub Y)GY(sub F)HGPTMSWPVPGTLMIEPTESESK.A	N	31.45	3392.5879	30	1.3	1131.8713	3	132.57	3	83306	20190523-10-H3.raw	1.06E6	1	1	907	936
K.IITVGTDAK.G	Y	30.11	916.5229	9	-0.6	459.2685	2	67.07	3	26110	20190523-10-H3.raw	1.66E8	2	2	685	693
R.EEIAQIEK.G	Y	29.11	958.4971	8	0.6	480.2561	2	67.96	3	26828	20190523-10-H3.raw	6.62E7	2	2	951	958
K.GNINIEEVRK.A	Y	28.93	1170.6356	10	1.0	586.3257	2	66.78	3	25861	20190523-10-H3.raw	2E7	1	1	694	703
R.ADGFDLK.V	N	27.89	764.3704	7	0.4	383.1927	2	75.07	3	32589	20190523-10-H3.raw	8.87E7	2	2	257	263
K.HYPVLFR.G	N	27.37	930.5076	7	1.7	466.2619	2	81.31	3	37827	20190523-10-H3.raw	3.93E8	9	9	870	876
R.FGVPMGYGGPH.A	N	26.81	1117.5015	11	-0.7	559.7576	2	97.37	3	51432	20190523-10-H3.raw	5.45E6	2	2	340	350
R.LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFC(+57.02)DALISIR.E	N	26.72	4896.3271	43	4.4	980.2770	5	152.25	3	101499	20190523-10-H3.raw	1.75E7	1	1	908	950	Carbamidomethylation
K.IAILNANYM(+15.99)AK.R	N	26.06	1236.6536	11	1.3	619.3348	2	99.89	3	53640	20190523-10-H3.raw	7.37E5	1	1	855	865	Oxidation (M)
K.TRADGFDLK.V	N	25.81	1021.5192	9	2.0	511.7679	2	66.74	3	25828	20190523-10-H3.raw	1.47E7	1	1	255	263
K.VFASGKPVPF.T	Y	25.75	1047.5753	10	1.3	524.7956	2	95.70	3	50050	20190523-10-H3.raw	9.74E7	2	2	507	516
K.LGVAEVQELPFFDTVKIK.C	Y	23.73	2032.1244	18	3.6	678.3845	3	132.75	3	83472	20190523-10-H3.raw	6.4E5	1	1	445	462
K.TY(sub F)C(+57.02)IPHGGGGPGMGPIGVK.N	N	22.92	1853.8916	19	0.6	618.9715	3	94.00	3	48556	20190523-10-H3.raw	1.15E6	1	1	775	793	Carbamidomethylation
K.VVTSDLK.D	Y	21.07	760.4330	7	0.2	381.2239	2	57.79	3	18573	20190523-10-H3.raw	3.38E6	1	1	264	270
K.LNATTEMMPVTWPSFTDIHPF.A	Y	21.04	2434.1338	21	-2.0	1218.0718	2	153.20	3	102412	20190523-10-H3.raw	2.55E5	1	1	582	602
total 89 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
K.IGIAHSPAWFEAHDLADSQDGASIDR.A	Y	66.26	2778.2998	26	1.2	927.1083	3	105.55	3	58644	20190523-10-H3.raw	3.18E9	10	10	268	293
K.YANPEIMIMENGYGEELGASDSVAVGTADHNR.K	Y	65.31	3409.5190	32	1.3	1137.5151	3	123.96	3	75345	20190523-10-H3.raw	1.63E8	10	10	409	440
R.SGYEAYLVTHNLLISHAEAVEAYR.K	Y	63.61	2705.3450	24	1.6	1353.6819	2	120.67	3	72299	20190523-10-H3.raw	2.44E9	14	14	235	258
R.ALDFILGWHLDTTTFGDYPQIMK.D	Y	63.57	2681.3198	23	-0.4	1341.6666	2	152.78	3	102003	20190523-10-H3.raw	3E8	17	17	294	316
K.HWITFNEPWVFSHAGYDVGK.K	Y	62.63	2389.1279	20	0.1	1195.5714	2	122.62	3	74096	20190523-10-H3.raw	1.84E9	13	13	197	216
K.DKYANPEIMIMENGYGEELGASDSVAVGTADHNRK.Y	Y	60.37	3780.7358	35	0.5	946.1917	4	112.71	3	65056	20190523-10-H3.raw	4.7E8	9	9	407	441
K.NAQNYAIGSKPLTAALNVYSR.G	Y	60.32	2250.1755	21	0.5	1126.0956	2	107.19	3	60099	20190523-10-H3.raw	3.27E9	12	12	376	396
K.NGITPFVTVFHWDTPQDLEDEYGGFLSER.I	Y	60.10	3368.5625	29	0.8	1123.8623	3	153.16	3	102372	20190523-10-H3.raw	3.06E8	2	2	147	175
K.ASTDFVGLNYYTSVFSNHLEKPDPSKPR.W	Y	59.62	3168.5515	28	1.2	1057.1924	3	117.59	3	69475	20190523-10-H3.raw	2.73E9	7	7	336	363
K.GVSQAGVQFYHDLIDELIK.N	Y	59.18	2131.0950	19	0.4	1066.5552	2	147.46	3	97076	20190523-10-H3.raw	2.14E9	6	6	128	146
H.SPAWFEAHDLADSQDGASIDR.A	Y	59.18	2287.0142	21	-0.1	1144.5143	2	105.24	3	58367	20190523-10-H3.raw	2.13E8	3	3	273	293
K.DKYANPEIMIMENGYGEELGASDSVAVGTADHNR.K	Y	58.96	3652.6409	34	0.1	1218.5543	3	120.02	3	71704	20190523-10-H3.raw	2.37E8	6	6	407	440
K.EKGVSQAGVQFYHDLIDELIK.N	Y	58.22	2388.2324	21	0.2	1195.1238	2	137.47	3	87867	20190523-10-H3.raw	1.3E8	2	2	126	146
R.WMQDSLITWESKNAQNYAIGSKPLTAALNVYSR.G	Y	57.47	3754.8777	33	0.3	939.7270	4	133.44	3	84113	20190523-10-H3.raw	1.28E7	1	1	364	396
R.SGYEAYLVTHNLLISHAEAVEAYRK.C	Y	56.86	2833.4399	25	-2.5	945.4849	3	112.36	3	64734	20190523-10-H3.raw	9.8E8	6	6	235	259
K.YANPEIMIMENGYGEELGASDSVAVGTADHNRK.Y	Y	56.31	3537.6140	33	2.1	885.4126	4	116.34	3	68315	20190523-10-H3.raw	3.63E8	5	5	409	441
K.VKHWITFNEPWVFSHAGYDVGK.K	Y	56.28	2616.2913	22	0.7	1309.1538	2	112.55	3	64905	20190523-10-H3.raw	6.4E8	7	7	195	216
F.VTVFHWDTPQDLEDEYGGFLSER.I	Y	55.48	2739.2451	23	0.7	1370.6309	2	141.07	3	91199	20190523-10-H3.raw	4.52E8	4	4	153	175
R.HLLSMQEAVC(+57.02)IDK.V	Y	55.19	1542.7534	13	1.2	772.3849	2	93.73	3	48343	20190523-10-H3.raw	3.03E8	11	11	447	459	Carbamidomethylation
K.LKASTDFVGLNYYTSVFSNHLEKPDPSKPR.W	Y	53.89	3409.7305	30	-0.1	682.9533	5	112.39	3	64762	20190523-10-H3.raw	1.93E8	3	3	334	363
D.KYANPEIMIMENGYGEELGASDSVAVGTADHNR.K	Y	51.51	3537.6140	33	0.3	885.4110	4	114.23	3	66432	20190523-10-H3.raw	1.31E7	1	1	408	440
R.C(+57.02)NNDNGDVAVDFFHR.Y	Y	51.01	1778.7430	15	1.4	890.3800	2	98.51	3	52427	20190523-10-H3.raw	2.73E9	7	7	80	94	Carbamidomethylation
K.YYKDFLSQGVRPSALK.K	Y	50.62	1870.9940	16	0.6	936.5049	2	91.74	3	46624	20190523-10-H3.raw	7.11E8	8	8	505	520
R.ALDFILGWHLDTTTFGDYPQIM(+15.99)K.D	Y	50.51	2697.3149	23	-1.0	900.1113	3	147.86	3	97446	20190523-10-H3.raw	5.3E7	3	3	294	316	Oxidation (M)
K.IGIAHSPAWY(sub F)EAHDLADSQDGASIDR.A	Y	49.30	2794.2947	26	0.4	699.5812	4	101.96	3	55426	20190523-10-H3.raw	5.68E7	6	6	268	293
K.DFREYADFVFQEYGGK.V	Y	49.00	1969.8845	16	2.3	985.9518	2	136.78	3	87227	20190523-10-H3.raw	9.09E7	6	6	179	194
R.EYADFVFQEYGGK.V	Y	48.06	1551.6881	13	0.5	776.8517	2	116.04	3	68045	20190523-10-H3.raw	1.4E9	11	11	182	194
K.ASTDFVGLNYYTSVY(sub F)SNHLEKPDPSKPR.W	Y	47.65	3184.5464	28	0.6	637.9169	5	109.77	3	62389	20190523-10-H3.raw	1.86E7	1	1	336	363
K.NGITPY(sub F)VTVY(sub F)HWDTPQDLEDEYGGFLSER.I	Y	46.84	3400.5522	29	0.0	1134.5247	3	152.43	3	101676	20190523-10-H3.raw	1.82E7	1	1	147	175
H.WITFNEPWVFSHAGYDVGK.K	Y	46.46	2252.0691	19	1.1	751.6978	3	133.01	3	83711	20190523-10-H3.raw	3.04E7	2	2	198	216
A.YLVTHNLLISHAEAVEAYR.K	Y	46.01	2198.1484	19	8.2	733.7294	3	120.62	3	72248	20190523-10-H3.raw	5.05E6	1	1	240	258
K.DFLSQGVRPSALK.K	Y	46.00	1416.7725	13	0.6	709.3939	2	93.95	3	48521	20190523-10-H3.raw	2.69E9	5	5	508	520
K.YIKDKYANPEIMIMENGYGEELGASDSVAVGTADHNRK.Y	Y	45.35	4184.9780	38	0.2	698.5037	6	107.36	3	60256	20190523-10-H3.raw	2.55E6	1	1	404	441
K.HWITY(sub F)NEPWVFSHAGYDVGK.K	Y	44.67	2405.1228	20	-2.0	802.7133	3	116.79	3	68730	20190523-10-H3.raw	2.09E7	2	2	197	216
R.GPALWDIYC(+57.02)R.R	N	44.19	1249.5913	10	-0.4	625.8027	2	114.03	3	66247	20190523-10-H3.raw	1.91E9	3	3	65	74	Carbamidomethylation
Y.AIGSKPLTAALNVYSR.G	Y	43.51	1659.9308	16	0.6	554.3179	3	96.14	3	50445	20190523-10-H3.raw	3.08E7	2	2	381	396
K.GVSQAGVQY(sub F)YHDLIDELIK.N	Y	43.47	2147.0898	19	1.5	716.7050	3	140.54	3	90703	20190523-10-H3.raw	3.26E7	2	2	128	146
R.WMQDSLITWESK.N	Y	43.15	1522.7126	12	0.5	762.3640	2	119.97	3	71660	20190523-10-H3.raw	1.82E9	8	8	364	375
F.VTVY(sub F)HWDTPQDLEDEYGGFLSER.I	Y	42.99	2755.2402	23	0.6	919.4213	3	135.73	3	86251	20190523-10-H3.raw	4.73E6	1	1	153	175
R.C(+57.02)NNDNGDVAVDY(sub F)FHR.Y	Y	42.70	1794.7379	15	0.3	599.2534	3	89.56	3	44796	20190523-10-H3.raw	2.42E7	1	1	80	94	Carbamidomethylation
K.NGITPFVTVY(sub F)HWDTPQDLEDEYGGFLSER.I	Y	42.29	3384.5574	29	-3.0	1129.1897	3	152.04	3	101300	20190523-10-H3.raw	6.05E6	2	2	147	175
K.ASTDFVGLNYYTSVFSNHLEKPDPSK.P	Y	41.97	2915.3977	26	0.7	729.8572	4	124.74	3	76080	20190523-10-H3.raw	0	1	1	336	361
K.HWITFNEPWVFSH.A	Y	41.20	1698.7943	13	1.1	850.4053	2	128.53	3	79592	20190523-10-H3.raw	3.71E8	5	5	197	209
A.DGPVC(+57.02)PPSNKLSR.A	Y	40.51	1425.7034	13	0.5	476.2420	3	67.66	3	26585	20190523-10-H3.raw	1.43E8	5	5	25	37	Carbamidomethylation
R.C(+57.02)NNDNGDVAVDFY(sub F)HR.Y	Y	40.39	1794.7379	15	0.9	599.2538	3	89.22	3	44532	20190523-10-H3.raw	2.42E7	1	1	80	94	Carbamidomethylation
K.ASTDFVGLNYYTSVFSNHLEKPD.P	Y	40.25	2603.2180	23	0.2	868.7468	3	133.28	3	83962	20190523-10-H3.raw	8.8E6	2	2	336	358
K.DFLSQGVRPSALKK.D	Y	40.18	1544.8674	14	-1.7	773.4397	2	81.97	3	38408	20190523-10-H3.raw	6.37E8	5	5	508	521
K.VKHWITFNEPWVFSH.A	Y	39.68	1925.9576	15	1.6	963.9876	2	115.86	3	67874	20190523-10-H3.raw	9.31E7	5	5	195	209
H.NLLISHAEAVEAYR.K	Y	39.67	1584.8259	14	0.7	793.4208	2	94.31	3	48825	20190523-10-H3.raw	6.65E7	4	4	245	258
R.WM(+15.99)QDSLITWESK.N	Y	39.61	1538.7075	12	0.6	770.3615	2	111.10	3	63603	20190523-10-H3.raw	3.33E7	5	5	364	375	Oxidation (M)
R.FGLYYVDFK.N	N	38.71	1150.5698	9	0.7	576.2926	2	120.60	3	72231	20190523-10-H3.raw	1.53E9	6	6	484	492
A.DGPVC(+57.02)PPSNK.L	Y	38.25	1069.4862	10	0.8	535.7508	2	59.77	3	20202	20190523-10-H3.raw	8.38E8	5	5	25	34	Carbamidomethylation
R.EYADFVY(sub F)QEYGGK.V	Y	38.22	1567.6830	13	-0.9	784.8481	2	108.20	3	61021	20190523-10-H3.raw	3.97E6	1	1	182	194
K.PLTAALNVYSR.G	Y	37.03	1203.6611	11	-0.2	602.8377	2	95.51	3	49877	20190523-10-H3.raw	3.94E8	3	3	386	396
K.ESGKYYKDFLSQGVRPSALK.K	Y	37.01	2272.1851	20	2.6	1137.1028	2	91.02	3	46001	20190523-10-H3.raw	5.93E7	2	2	501	520
Y.LVTHNLLISHAEAVEAYR.K	Y	36.14	2035.0851	18	1.4	509.7792	4	94.41	3	48913	20190523-10-H3.raw	2.57E7	1	1	241	258
R.YKEDIQLMK.N	N	36.12	1166.6005	9	1.0	584.3081	2	76.05	3	33426	20190523-10-H3.raw	2.6E9	3	3	95	103
R.IVKDFREYADFVFQEYGGK.V	Y	35.59	2310.1321	19	-0.6	578.5400	4	126.14	3	77399	20190523-10-H3.raw	3.34E7	2	2	176	194
H.DLADSQDGASIDR.A	Y	35.29	1361.6058	13	2.0	681.8115	2	75.85	3	33253	20190523-10-H3.raw	2.53E7	2	2	281	293
E.KGVSQAGVQFYHDLIDELIK.N	Y	35.15	2259.1899	20	2.7	754.0726	3	134.70	3	85285	20190523-10-H3.raw	9.32E6	2	2	127	146
K.DKYANPEIMIM(+15.99)ENGYGEELGASDSVAVGTADHNR.K	Y	35.00	3668.6357	34	-3.9	918.1627	4	111.53	3	63985	20190523-10-H3.raw	1.3E6	1	1	407	440	Oxidation (M)
W.SLLDNFEWQDGYK.N	N	34.74	1613.7361	13	2.2	807.8771	2	125.99	3	77261	20190523-10-H3.raw	4.37E6	1	1	469	481
R.IVKDY(sub F)REF(sub Y)ADFVFQEYGGK.V	Y	34.23	2310.1321	19	1.0	578.5409	4	125.80	3	77081	20190523-10-H3.raw	3.34E7	1	1	176	194
K.NGITPY(sub F)VTVFHWDTPQDLEDEYGGFLSER.I	Y	33.61	3384.5574	29	1.7	1129.1949	3	147.36	3	96982	20190523-10-H3.raw	3.9E6	2	2	147	175
R.SGYEAYLVTH.N	Y	33.27	1138.5294	10	0.9	570.2725	2	93.35	3	48014	20190523-10-H3.raw	0	1	1	235	244
R.MSIAWPR.I	Y	31.43	859.4374	7	-0.3	430.7259	2	96.85	3	51013	20190523-10-H3.raw	1.45E9	5	5	112	118
R.Y(sub F)GLYYVDFK.N	N	31.37	1166.5648	9	0.0	584.2897	2	114.82	3	66977	20190523-10-H3.raw	9.72E6	1	1	484	492
K.DFLSQGVRPSALKKDEL	Y	31.00	1902.0210	17	-2.1	952.0158	2	96.22	3	50530	20190523-10-H3.raw	9.78E7	3	3	508	524
Q.FYHDLIDELIK.N	N	30.94	1404.7289	11	0.9	469.2506	3	126.82	3	78038	20190523-10-H3.raw	3.44E6	1	1	136	146
R.GPALWDIYC(+57.02)RR.Y	N	30.94	1405.6925	11	1.0	469.5719	3	101.76	3	55235	20190523-10-H3.raw	2.58E7	1	1	65	75	Carbamidomethylation
K.NLNTDAFR.M	N	30.76	949.4617	8	0.9	475.7386	2	76.04	3	33418	20190523-10-H3.raw	1.54E9	3	3	104	111
K.DIVGHRLPK.F	Y	30.59	1033.6033	9	0.1	345.5417	3	62.14	3	22057	20190523-10-H3.raw	2.65E8	4	4	317	325
G.KIGIAHSPAWFEAHDLADSQDGASIDR.A	Y	29.78	2906.3945	27	0.9	727.6066	4	98.20	3	52157	20190523-10-H3.raw	7.98E6	1	1	267	293
K.GVSQAGVQY(sub F)F(sub Y)HDLIDELIKNGITPF.V	Y	29.06	2760.4121	25	0.8	921.1454	3	155.77	3	104851	20190523-10-H3.raw	4.85E6	1	1	128	152
R.SGYEAYLVTHNLLISH.A	Y	28.18	1815.9155	16	0.5	606.3127	3	117.13	3	69054	20190523-10-H3.raw	4.63E6	1	1	235	250
R.EYADY(sub F)VFQEYGGK.V	Y	27.61	1567.6830	13	1.6	784.8500	2	110.05	3	62650	20190523-10-H3.raw	1.01E7	1	1	182	194
I.VGHRLPK.F	N	25.47	805.4922	7	-1.3	403.7529	2	61.64	3	21672	20190523-10-H3.raw	3.06E6	1	1	319	325
R.SGYEAYLVTHN.L	Y	25.46	1252.5724	11	-3.9	627.2910	2	92.03	3	46873	20190523-10-H3.raw	0	1	1	235	245
M.IMENGYGEELGASDSVAVGTADHNR.K	Y	24.85	2591.1558	25	-1.5	864.7245	3	94.30	3	48818	20190523-10-H3.raw	5.18E5	1	1	416	440
R.SGYEAYLVTHNLLISHAEAVEAYRKC(+57.02)EK.C	Y	24.52	3250.6079	28	1.1	542.7759	6	108.83	3	61542	20190523-10-H3.raw	5.83E6	1	1	235	262	Carbamidomethylation
K.HWITY(sub F)NEPWVY(sub F)SHAGYDVGK.K	Y	24.17	2421.1177	20	1.1	808.0474	3	117.40	3	69306	20190523-10-H3.raw	1.18E7	1	1	197	216
F.HWDTPQDLEDEYGGFLSER.I	Y	24.03	2292.9922	19	4.2	765.3412	3	128.15	3	79245	20190523-10-H3.raw	8.89E5	1	1	157	175
K.NAQNYAIGSKPLTAALNVY.S	Y	23.85	2007.0425	19	0.3	670.0217	3	117.11	3	69038	20190523-10-H3.raw	3.25E7	1	1	376	394
K.YYKDFLSQGVRPSALKK.D	Y	23.64	1999.0890	17	0.4	500.7797	4	82.42	3	38807	20190523-10-H3.raw	2.61E7	1	1	505	521
R.ALDFILGWHLDTTTY(sub F)GDYPQIMK.D	Y	23.26	2697.3149	23	-3.5	900.1091	3	152.53	3	101774	20190523-10-H3.raw	0	2	2	294	316
R.C(+57.02)SSYVNAK.C	Y	23.22	927.4120	8	-0.8	464.7129	2	52.40	3	14470	20190523-10-H3.raw	3.73E6	1	1	222	229	Carbamidomethylation
K.IGIAHSPAWFEAHDLADSQDGASIDRALDFILGWHLDTTTFGDYPQIMK.D	Y	22.96	5441.6089	49	-2.0	907.9403	6	153.68	3	102869	20190523-10-H3.raw	2.88E6	1	1	268	316
K.EDIQLMK.N	N	22.73	875.4423	7	0.1	438.7285	2	78.50	3	35412	20190523-10-H3.raw	4.03E7	1	1	97	103
K.YANPEIMIM(+15.99)ENGYGEELGASDSVAVGTADHNRK.Y	Y	22.43	3553.6089	33	8.2	889.4167	4	108.75	3	61479	20190523-10-H3.raw	0	1	1	409	441	Oxidation (M)
Y.TSVFSNHLEKPDPSKPR.W	Y	21.89	1937.9958	17	2.9	485.5077	4	68.49	3	27273	20190523-10-H3.raw	1.78E6	1	1	347	363
K.NAQNF(sub Y)AIGSKPLTAALNVYSR.G	Y	21.30	2234.1807	21	-12.9	745.7245	3	108.39	3	61175	20190523-10-H3.raw	0	1	1	376	396
R.YKEDIQLM(+15.99)K.N	N	21.27	1182.5955	9	3.5	592.3071	2	66.60	3	25695	20190523-10-H3.raw	1.14E7	1	1	95	103	Oxidation (M)
K.DFLSQGVR.P	Y	21.17	920.4716	8	0.7	461.2434	2	87.48	3	42989	20190523-10-H3.raw	1.4E8	1	1	508	515
F.YHDLIDELIK.N	N	20.42	1257.6604	10	-0.3	420.2273	3	112.90	3	65220	20190523-10-H3.raw	4.23E5	1	1	137	146
total 94 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
R.ELGVPIVMHDYLTGGFTANTSLSHYC(+57.02)R.D	Y	65.39	3037.4426	27	1.3	1013.4895	3	126.46	3	77707	20190523-10-H3.raw	2.71E9	68	68	259	285	Carbamidomethylation
R.VTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDR.Y	Y	61.76	3853.8645	38	1.1	1285.6302	3	151.07	3	100402	20190523-10-H3.raw	4.56E8	48	48	42	79
R.GGLDFTKDDENVNSQPFMR.W	Y	61.21	2168.9797	19	1.4	1085.4987	2	104.01	3	57280	20190523-10-H3.raw	2.38E9	9	9	195	213
R.EAC(+57.02)KWSPELAAAC(+57.02)EVWK.E	Y	60.76	2033.9338	17	0.9	1017.9752	2	111.30	3	63774	20190523-10-H3.raw	2.36E8	4	4	447	463	Carbamidomethylation
R.ESTLGFVDLLRDDYVEK.D	Y	59.23	1997.9945	17	1.8	1000.0063	2	130.65	3	81515	20190523-10-H3.raw	1.41E8	3	3	340	356
K.GHYLNATAGTC(+57.02)EEMIK.R	Y	58.14	1793.8076	16	1.4	897.9124	2	81.39	3	37898	20190523-10-H3.raw	1.2E9	12	12	237	252	Carbamidomethylation
K.GHYLNATAGTC(+57.02)EEMIKR.A	Y	57.72	1949.9087	17	1.5	650.9778	3	74.97	3	32513	20190523-10-H3.raw	9.73E8	7	7	237	253	Carbamidomethylation
R.LSGGDHIHAGTVVGK.L	Y	57.29	1446.7579	15	0.4	724.3865	2	61.62	3	21657	20190523-10-H3.raw	4.54E9	13	13	320	334
R.VTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYK.G	Y	57.10	4145.0229	40	1.1	1037.2642	4	146.23	3	95936	20190523-10-H3.raw	1.41E8	3	3	42	81
K.LTYYTPEYETKDTDILAAFR.V	Y	55.14	2409.1738	20	2.0	1205.5966	2	124.93	3	76261	20190523-10-H3.raw	9.1E8	7	7	22	41
H.MPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANR.V	Y	55.01	3551.7256	35	1.0	1184.9170	3	149.24	3	98719	20190523-10-H3.raw	3.37E7	3	3	387	421
R.ELGVPIVMHDYLTGGY(sub F)TANTSLSHYC(+57.02)R.D	Y	54.83	3053.4375	27	-0.5	764.3663	4	122.44	3	73929	20190523-10-H3.raw	7E7	2	2	259	285	Carbamidomethylation
R.ELGVPIVM(+15.99)HDYLTGGFTANTSLSHYC(+57.02)R.D	Y	54.42	3053.4375	27	0.5	764.3670	4	116.75	3	68696	20190523-10-H3.raw	1.52E8	3	3	259	285	Oxidation (M); Carbamidomethylation
R.ESTLGFVDLLRDDYVEKDR.S	Y	54.31	2269.1226	19	0.1	757.3815	3	123.54	3	74953	20190523-10-H3.raw	6.48E8	5	5	340	358
K.WSPELAAAC(+57.02)EVWKEITFNFPTIDKLDGQE	Y	54.23	3393.6226	29	0.4	1132.2152	3	156.00	3	105075	20190523-10-H3.raw	4.46E7	1	1	451	479	Carbamidomethylation
R.LSGGDHIHAGTVVGKLEGDRESTLGFVDLLR.D	Y	54.06	3247.6948	31	-0.3	650.5460	5	115.20	3	67290	20190523-10-H3.raw	3.21E7	2	2	320	350
K.LEGDRESTLGFVDLLRDDYVEKDR.S	Y	53.56	2839.3987	24	0.7	710.8574	4	119.55	3	71271	20190523-10-H3.raw	1.43E9	6	6	335	358
K.SQAETGEIKGHYLNATAGTC(+57.02)EEMIKR.A	Y	52.90	2893.3699	26	1.3	724.3507	4	81.89	3	38326	20190523-10-H3.raw	5.1E8	4	4	228	253	Carbamidomethylation
K.LEGDRESTLGFVDLLR.D	Y	52.90	1818.9475	16	1.5	910.4824	2	121.58	3	73132	20190523-10-H3.raw	4.85E8	3	3	335	350
R.NEGRDLAVEGNEIIREAC(+57.02)K.W	Y	51.23	2172.0593	19	-0.1	725.0270	3	95.62	3	49979	20190523-10-H3.raw	5.06E7	2	2	432	450	Carbamidomethylation
K.TFQGPPHGIQVER.D	Y	50.03	1464.7473	13	1.6	733.3821	2	77.68	3	34731	20190523-10-H3.raw	4.58E9	13	13	147	159
R.NEGRDLAVEGNEIIR.E	Y	49.99	1683.8540	15	0.8	562.2924	3	86.61	3	42254	20190523-10-H3.raw	5.78E8	3	3	432	446
R.GGLDFTKDDENVNSQPY(sub F)MR.W	Y	49.70	2184.9746	19	1.3	729.3331	3	99.00	3	52864	20190523-10-H3.raw	6.51E7	2	2	195	213
R.ELGVPIVMHDYLTGGFTAN.T	Y	49.26	2032.9928	19	2.4	1017.5062	2	140.11	3	90303	20190523-10-H3.raw	9.89E7	3	3	259	277
K.LTYYTPEYETKDTDILAAY(sub F)R.V	Y	49.09	2425.1689	20	2.3	1213.5945	2	118.02	3	69871	20190523-10-H3.raw	3.93E5	1	1	22	41
K.EITFNFPTIDKLDGQE	Y	48.99	1865.9047	16	0.0	933.9596	2	134.78	3	85357	20190523-10-H3.raw	2.54E9	7	7	464	479
R.GGLDY(sub F)TKDDENVNSQPFMR.W	Y	48.95	2184.9746	19	-0.7	729.3317	3	97.99	3	51967	20190523-10-H3.raw	1.36E7	3	3	195	213
K.LEGDRESTLGFVDLLRDDYVEK.D	Y	48.80	2568.2708	22	0.3	643.0751	4	125.05	3	76376	20190523-10-H3.raw	2.03E8	3	3	335	356
K.WSPELAAAC(+57.02)EVWK.E	Y	48.63	1545.7285	13	1.0	773.8723	2	118.88	3	70694	20190523-10-H3.raw	2.85E9	9	9	451	463	Carbamidomethylation
K.EITFNY(sub F)PTIDKLDGQE	Y	48.48	1881.8995	16	1.5	941.9585	2	126.60	3	77829	20190523-10-H3.raw	9.08E7	1	1	464	479
R.LSGGDHIHAGTVVGKLEGDR.E	Y	48.19	2017.0341	20	-0.3	404.4140	5	76.33	3	33679	20190523-10-H3.raw	5.34E7	3	3	320	339
K.WSPELAAAC(+57.02)EVWKEITFNFPTIDK.L	Y	47.84	2851.3889	24	-3.8	951.4667	3	154.69	3	103829	20190523-10-H3.raw	2.09E6	1	1	451	474	Carbamidomethylation
R.GGLDFTKDDENVNSQPFM(+15.99)R.W	Y	47.82	2184.9746	19	0.7	1093.4954	2	96.56	3	50810	20190523-10-H3.raw	5.63E7	6	6	195	213	Oxidation (M)
K.EITY(sub F)NFPTIDKLDGQE	Y	47.64	1881.8995	16	0.6	941.9576	2	126.25	3	77509	20190523-10-H3.raw	9.08E7	1	1	464	479
K.DDENVNSQPFMR.W	Y	47.29	1450.6146	12	1.1	726.3154	2	86.61	3	42253	20190523-10-H3.raw	6.63E8	4	4	202	213
L.SGGDHIHAGTVVGK.L	Y	47.13	1333.6738	14	0.9	445.5656	3	61.71	3	21719	20190523-10-H3.raw	2.1E7	1	1	321	334
K.YGRPLLGC(+57.02)TIKPK.L	Y	46.34	1501.8439	13	0.5	501.6222	3	71.48	3	29630	20190523-10-H3.raw	3.27E9	11	11	165	177	Carbamidomethylation
K.TY(sub F)QGPPHGIQVER.D	Y	45.47	1480.7422	13	1.3	741.3793	2	74.04	3	31725	20190523-10-H3.raw	1.14E8	4	4	147	159
R.DNGLLLHIHR.A	Y	45.43	1186.6571	10	0.8	594.3363	2	80.74	3	37328	20190523-10-H3.raw	3.5E9	9	9	286	295
R.EAC(+57.02)KWSPELAAAC(+57.02)EVWKEITFNFPTIDKLDGQE	Y	45.02	3881.8279	33	1.1	971.4653	4	154.59	3	103732	20190523-10-H3.raw	3.89E7	2	2	447	479	Carbamidomethylation
R.EAC(+57.02)KWSPELAAAC(+57.02)EVWKEITFNFPTIDK.L	Y	44.93	3339.5942	28	3.2	835.9085	4	153.19	3	102403	20190523-10-H3.raw	1.77E6	1	1	447	474	Carbamidomethylation
R.ELGVPIVM(+15.99)HDF(sub Y)LTGGFTANTSLSHYC(+57.02)R.D	Y	44.61	3037.4426	27	0.1	760.3680	4	136.19	3	86674	20190523-10-H3.raw	2.96E7	3	3	259	285	Oxidation (M); Carbamidomethylation
R.LEDLRIPPAYTK.T	Y	43.74	1414.7820	12	2.4	708.4000	2	91.09	3	46066	20190523-10-H3.raw	1.36E9	16	16	135	146
R.GGLDY(sub F)TKDDENVNSQPY(sub F)MR.W	Y	42.90	2200.9695	19	0.8	734.6644	3	92.36	3	47151	20190523-10-H3.raw	4.3E6	1	1	195	213
R.C(+57.02)YHIEPVPGEETQFIAY.V	Y	41.97	2051.9299	17	0.8	1026.9730	2	118.82	3	70632	20190523-10-H3.raw	3.87E7	1	1	84	100	Carbamidomethylation
R.ELGVPIVMHDYLTGGFTANTSLSHYC(+57.02)RDNGLLLHIHR.A	Y	41.97	4206.0889	37	1.9	601.8782	7	124.38	3	75745	20190523-10-H3.raw	1.02E7	1	1	259	295	Carbamidomethylation
L.RLSGGDHIHAGTVVGK.L	Y	41.32	1602.8590	16	1.0	401.7224	4	58.26	3	18975	20190523-10-H3.raw	2.98E6	1	1	319	334
K.SQAETGEIKGHYLNATAGTC(+57.02)EEMIK.R	Y	40.93	2737.2688	25	1.4	685.3254	4	86.71	3	42345	20190523-10-H3.raw	1.09E8	4	4	228	252	Carbamidomethylation
S.GGDHIHAGTVVGK.L	Y	40.16	1246.6418	13	0.3	416.5547	3	61.81	3	21798	20190523-10-H3.raw	1.46E6	2	2	322	334
K.LTYYTPEYETK.D	Y	39.75	1406.6605	11	0.8	704.3381	2	88.45	3	43853	20190523-10-H3.raw	2.2E9	2	2	22	32
R.NEGRDLAVEGNEIIREAC(+57.02)KWSPELAAAC(+57.02)EVWK.E	Y	39.52	3699.7773	32	0.8	740.9633	5	136.20	3	86688	20190523-10-H3.raw	5.84E6	1	1	432	463	Carbamidomethylation
R.ESTLGFVDLLR.D	Y	38.68	1248.6714	11	0.6	625.3433	2	129.62	3	80573	20190523-10-H3.raw	6.49E8	6	6	340	350
R.FLFC(+57.02)AEAIYK.S	Y	38.50	1260.6212	10	0.4	631.3181	2	117.04	3	68967	20190523-10-H3.raw	1.23E9	5	5	218	227	Carbamidomethylation
K.GHYLNATAGTC(+57.02)EEM(+15.99)IK.R	Y	38.20	1809.8026	16	-0.5	604.2745	3	72.76	3	30701	20190523-10-H3.raw	2.74E7	4	4	237	252	Carbamidomethylation; Oxidation (M)
R.ESTLGY(sub F)VDLLRDDYVEK.D	Y	38.09	2013.9894	17	1.8	672.3383	3	121.91	3	73442	20190523-10-H3.raw	1.03E7	2	2	340	356
K.EITFNFPTIDK.L	Y	38.06	1323.6710	11	0.0	662.8428	2	120.68	3	72307	20190523-10-H3.raw	3.33E8	3	3	464	474
K.DDENVNSQPY(sub F)MR.W	Y	37.80	1466.6096	12	0.6	734.3126	2	78.83	3	35692	20190523-10-H3.raw	1.38E7	2	2	202	213
R.VALEAC(+57.02)VQAR.N	Y	37.66	1115.5757	10	0.5	558.7954	2	76.49	3	33811	20190523-10-H3.raw	3.22E9	24	24	422	431	Carbamidomethylation
K.GHYLNATAGTC(+57.02)EEM(+15.99)IKR.A	Y	37.54	1965.9037	17	0.2	492.4833	4	67.69	3	26608	20190523-10-H3.raw	1.31E7	2	2	237	253	Carbamidomethylation; Oxidation (M)
R.ELGVPIVMHDYLTGGFTANTSLSH.Y	Y	37.08	2558.2476	24	-0.2	853.7563	3	134.13	3	84745	20190523-10-H3.raw	1.63E7	2	2	259	282
R.GIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANR.V	Y	36.54	6352.1743	61	5.3	1271.4489	5	155.38	3	104482	20190523-10-H3.raw	1.28E7	1	1	361	421
R.DLAVEGNEIIR.E	Y	36.31	1227.6459	11	0.3	614.8304	2	99.14	3	52994	20190523-10-H3.raw	2.52E9	10	10	436	446
R.GGLDFTKDDENVNSQPF.M	Y	36.03	1881.8380	17	1.2	941.9274	2	110.98	3	63483	20190523-10-H3.raw	2.49E7	1	1	195	211
R.DRFLFC(+57.02)AEAIYK.S	Y	35.58	1531.7493	12	1.6	766.8831	2	110.53	3	63098	20190523-10-H3.raw	3.83E6	5	5	216	227	Carbamidomethylation
K.DDENVNSQPFM(+15.99)R.W	Y	35.53	1466.6096	12	-0.3	734.3119	2	75.93	3	33319	20190523-10-H3.raw	1.89E7	4	4	202	213	Oxidation (M)
K.DTDILAAFR.V	Y	35.37	1020.5240	9	0.6	511.2696	2	119.32	3	71074	20190523-10-H3.raw	2.1E9	5	5	33	41
R.PLLGC(+57.02)TIKPK.L	Y	35.26	1125.6580	10	1.0	563.8368	2	72.18	3	30204	20190523-10-H3.raw	6.8E8	4	4	168	177	Carbamidomethylation
R.ESTLGY(sub F)VDLLR.D	Y	34.70	1264.6663	11	0.9	633.3410	2	119.71	3	71417	20190523-10-H3.raw	4.54E7	2	2	340	350
K.ALRLSGGDHIHAGTVVGK.L	Y	34.70	1786.9802	18	-1.6	358.4027	5	70.50	3	28842	20190523-10-H3.raw	1.39E6	1	1	317	334
R.ELGVPIVM(+15.99)HDF(sub Y)LTGGFTANTSLSHYC(+57.02)RDNGLLLHIHR.A	Y	34.11	4206.0889	37	-2.9	702.0200	6	124.56	3	75917	20190523-10-H3.raw	7.44E6	1	1	259	295	Oxidation (M); Carbamidomethylation
R.EAC(+57.02)KWSPELAAAC(+57.02)EVWKEITY(sub F)NY(sub F)PTIDKLDGQE	Y	33.88	3913.8179	33	5.9	979.4675	4	152.88	3	102108	20190523-10-H3.raw	5.47E6	1	1	447	479	Carbamidomethylation
R.VTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGR.C	Y	33.55	4358.1455	42	0.9	1090.5447	4	138.67	3	88993	20190523-10-H3.raw	1.46E7	1	1	42	83
R.ELGVPIVMHDYLTGGFTANTSLSHY.C	Y	33.29	2721.3108	25	-2.4	908.1087	3	137.21	3	87627	20190523-10-H3.raw	1.23E7	1	1	259	283
K.LEGDRESTLGY(sub F)VDLLRDDYVEKDR.S	Y	32.86	2855.3936	24	-7.9	714.8500	4	112.16	3	64559	20190523-10-H3.raw	0	1	1	335	358
K.GHYLNATAGTC(+57.02)EEM.I	Y	32.85	1552.6287	14	2.7	777.3237	2	81.50	3	37988	20190523-10-H3.raw	9.17E6	1	1	237	250	Carbamidomethylation
H.YLNATAGTC(+57.02)EEMIKR.A	Y	32.15	1755.8284	15	0.5	586.2837	3	80.39	3	37025	20190523-10-H3.raw	1.57E7	1	1	239	253	Carbamidomethylation
K.ASVGFKAGVKEYKLTYYTPEYETK.D	Y	30.76	2771.4058	24	3.2	693.8609	4	95.00	3	49438	20190523-10-H3.raw	0	1	1	9	32
R.AMHAVIDR.Q	Y	30.15	911.4647	8	-0.9	304.8286	3	57.64	3	18443	20190523-10-H3.raw	8.84E7	4	4	296	303
R.GIY(sub F)Y(sub F)TQDWVSLPGVLPVASGGIHVWHM(+15.99)PALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANR.V	Y	30.05	6400.1592	61	3.4	1281.0435	5	153.67	3	102859	20190523-10-H3.raw	0	1	1	361	421	Oxidation (M)
F.TSIVGNVFGFK.A	Y	29.81	1167.6288	11	0.2	584.8218	2	117.01	3	68942	20190523-10-H3.raw	3.71E6	1	1	118	128
K.DTDILAAY(sub F)R.V	Y	29.45	1036.5189	9	0.1	519.2668	2	106.70	3	59680	20190523-10-H3.raw	4.97E7	2	2	33	41
K.ALAALRLEDLR.I	Y	29.21	1239.7299	11	-0.5	414.2503	3	99.44	3	53256	20190523-10-H3.raw	2.4E8	3	3	129	139
R.AVYEC(+57.02)LR.G	Y	29.18	909.4378	7	0.4	455.7264	2	71.36	3	29530	20190523-10-H3.raw	2.13E9	3	3	188	194	Carbamidomethylation
R.Y(sub F)LY(sub F)C(+57.02)AEAIYK.S	Y	28.93	1292.6111	10	0.4	647.3130	2	101.71	3	55196	20190523-10-H3.raw	3.56E6	1	1	218	227	Carbamidomethylation
R.Y(sub F)LFC(+57.02)AEAIYK.S	Y	28.51	1276.6162	10	-1.0	639.3148	2	111.75	3	64187	20190523-10-H3.raw	5.56E7	1	1	218	227	Carbamidomethylation
K.EITY(sub F)NY(sub F)PTIDKLDGQE	Y	28.47	1897.8945	16	1.1	949.9556	2	118.33	3	70175	20190523-10-H3.raw	1.43E7	1	1	464	479
F.TANTSLSHYC(+57.02)R.D	Y	28.07	1308.5881	11	-0.6	655.3010	2	59.34	3	19896	20190523-10-H3.raw	6.51E6	2	2	275	285	Carbamidomethylation
R.IPPAYTK.T	Y	26.96	788.4432	7	1.0	395.2293	2	58.71	3	19363	20190523-10-H3.raw	1.26E8	7	7	140	146
K.YGRPLLGC(+57.02).T	Y	26.44	934.4694	8	1.5	468.2427	2	80.94	3	37500	20190523-10-H3.raw	7.59E7	1	1	165	172	Carbamidomethylation
R.GGLDFTK.D	Y	26.31	736.3755	7	0.1	369.1951	2	73.58	3	31363	20190523-10-H3.raw	2.27E8	2	2	195	201
R.AM(+15.99)HAVIDR.Q	Y	26.29	927.4596	8	-1.8	310.1599	3	50.14	3	13206	20190523-10-H3.raw	5.59E6	3	3	296	303	Oxidation (M)
K.TFQGPPHGIQVERDKLNK.Y	Y	26.25	2063.0911	18	1.2	516.7806	4	73.01	3	30914	20190523-10-H3.raw	9.7E6	1	1	147	164
K.EITFNFPTIDKL.D	Y	25.64	1436.7551	12	0.8	719.3854	2	136.88	3	87322	20190523-10-H3.raw	4.41E7	2	2	464	475
K.WSPELAAAC(+57.02)EVWKEITY(sub F)NY(sub F)PTIDKLDGQE	Y	24.23	3425.6125	29	-2.0	1142.8759	3	154.33	3	103484	20190523-10-H3.raw	1.52E7	1	1	451	479	Carbamidomethylation
R.GGLDFTKDDENVNSQPY(sub F).M	Y	23.68	1897.8330	17	2.1	949.9258	2	104.05	3	57322	20190523-10-H3.raw	2.44E6	1	1	195	211
K.SQAETGEIK.G	Y	22.40	961.4716	9	-2.1	481.7421	2	52.02	3	14228	20190523-10-H3.raw	4.16E6	1	1	228	236
R.DDYVEKDR.S	Y	20.65	1038.4618	8	-0.6	347.1610	3	52.81	3	14782	20190523-10-H3.raw	2.84E6	1	1	351	358
total 97 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
K.EVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALK.Q	Y	66.99	3790.9683	35	2.0	1264.6659	3	134.07	3	84694	20190523-10-H3.raw	8.02E8	8	8	311	345
K.LKDFVSAMESSSTIQSEIAK.L	Y	64.71	2170.0828	20	1.1	1086.0498	2	112.38	3	64753	20190523-10-H3.raw	4.24E8	4	4	472	491
R.GYELVSGGTDNHLVLVNLKPK.G	Y	64.13	2252.2163	21	1.3	1127.1169	2	104.12	3	57380	20190523-10-H3.raw	1.35E9	6	6	374	394
K.QLNAPLEEVDPEIADIIEHEK.A	Y	58.39	2401.2012	21	1.9	801.4092	3	132.72	3	83441	20190523-10-H3.raw	1.2E9	5	5	50	70
K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Y	58.18	3654.8425	35	0.7	914.7185	4	152.05	3	101314	20190523-10-H3.raw	3.53E8	11	11	252	286
K.WGVNVQPLSGSPANFHVYTALLKPHER.I	Y	58.16	3016.5671	27	1.7	755.1503	4	117.74	3	69614	20190523-10-H3.raw	1.64E9	8	8	140	166
K.DFVSAMESSSTIQSEIAK.L	Y	57.61	1928.9037	18	1.8	965.4608	2	124.82	3	76160	20190523-10-H3.raw	3.9E7	4	4	474	491
K.QATTSEYKAYQEQVLSNSAK.F	Y	56.49	2245.0862	20	2.8	749.3714	3	85.34	3	41205	20190523-10-H3.raw	3.19E7	2	2	346	365
K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Y	56.46	2730.4487	27	2.0	911.1586	3	107.64	3	60505	20190523-10-H3.raw	2.12E8	3	3	404	430
R.YYGGNEYIDMAETLC(+57.02)QK.R	N	56.09	2053.8762	17	1.1	1027.9465	2	120.37	3	72031	20190523-10-H3.raw	3.45E8	5	5	111	127	Carbamidomethylation
K.VAEYFDKAVTIALK.V	Y	55.91	1566.8657	14	0.0	784.4401	2	109.73	3	62349	20190523-10-H3.raw	4.63E7	2	2	449	462
K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Y	55.85	2737.3667	26	1.2	913.4639	3	153.30	3	102500	20190523-10-H3.raw	2.66E8	4	4	76	101
K.QLNAPLEEVDPEIADIIEHEKAR.Q	Y	55.32	2628.3394	23	0.0	658.0921	4	125.09	3	76407	20190523-10-H3.raw	2.97E8	3	3	50	72
K.AVM(+15.99)LADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Y	55.00	3670.8374	35	-1.5	918.7153	4	147.40	3	97016	20190523-10-H3.raw	2.17E7	1	1	252	286	Oxidation (M)
R.YYGGNEYIDMAETLC(+57.02)QKR.A	N	53.83	2209.9773	18	-1.4	1105.9944	2	112.33	3	64708	20190523-10-H3.raw	3.3E8	4	4	111	128	Carbamidomethylation
R.IMALDLPHGGHLSHGYQTDTK.K	N	52.43	2290.1165	21	0.8	764.3801	3	85.20	3	41092	20190523-10-H3.raw	9.95E8	6	6	167	187
R.ALEAFRLDPEKWGVNVQPLSGSPANFHVYTALLKPHER.I	Y	51.99	4286.2388	38	-0.5	613.3268	7	128.75	3	79797	20190523-10-H3.raw	1.13E7	2	2	129	166
K.INQAVFPGLQGGPHNHTITGLAVALK.Q	N	51.98	2652.4500	26	0.3	664.1200	4	110.99	3	63497	20190523-10-H3.raw	1.29E8	7	7	320	345
K.NTVPGDVSAMVPGGIR.M	N	51.67	1568.7981	16	-0.5	523.9397	3	107.84	3	60696	20190523-10-H3.raw	6.84E8	4	4	415	430
R.GFVEEDFAKVAEYFDKAVTIALK.V	Y	50.96	2589.3364	23	-1.0	648.3408	4	154.81	3	103947	20190523-10-H3.raw	1.13E7	2	2	440	462
K.GLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGAR.Y	Y	50.44	3717.8018	35	1.3	1240.2761	3	150.71	3	100069	20190523-10-H3.raw	4.06E7	2	2	76	110
R.LDESTGYIDYDQMEK.S	Y	50.05	1805.7665	15	0.3	903.8907	2	100.10	3	53803	20190523-10-H3.raw	2.97E8	2	2	203	217
H.ISGLVAANVIPSPFDYADVVTTTTHK.S	Y	49.73	2715.4119	26	3.2	906.1475	3	135.89	3	86396	20190523-10-H3.raw	2.08E8	4	4	261	286
K.VLEAVHIASNK.N	Y	48.78	1179.6611	11	0.8	590.8383	2	70.68	3	28985	20190523-10-H3.raw	9.81E7	2	2	404	414
K.FAQTLMERGYELVSGGTDNHLVLVNLKPK.G	Y	48.69	3228.6965	29	1.3	646.7474	5	125.55	3	76844	20190523-10-H3.raw	7.9E6	1	1	366	394
K.KISAVSIFFETMPYR.L	N	48.10	1787.9280	15	0.8	894.9720	2	126.95	3	78163	20190523-10-H3.raw	1.93E7	2	2	188	202
K.ISAVSIFFETMPYRLDESTGYIDYDQMEK.S	Y	47.48	3447.5889	29	3.8	1150.2079	3	151.98	3	101250	20190523-10-H3.raw	1.67E7	1	1	189	217
K.ISAVSIFFETMPYR.L	N	46.76	1659.8330	14	0.5	554.2852	3	143.75	3	93681	20190523-10-H3.raw	2.7E8	4	4	189	202
A.RYYGGNEYIDMAETLC(+57.02)QK.R	N	46.08	2209.9773	18	2.0	737.6678	3	108.87	3	61573	20190523-10-H3.raw	3.91E7	4	4	110	127	Carbamidomethylation
K.ISAVSIFFETM(+15.99)PYR.L	N	46.06	1675.8279	14	1.6	838.9225	2	132.00	3	82769	20190523-10-H3.raw	2.06E7	3	3	189	202	Oxidation (M)
K.AVMLADM(+15.99)AHISGLVAANVIPSPFDYADVVTTTTHK.S	Y	44.60	3670.8374	35	2.8	918.7192	4	138.80	3	89105	20190523-10-H3.raw	7.6E6	1	1	252	286	Oxidation (M)
L.SGSPANFHVYTALLKPHER.I	Y	42.97	2123.0911	19	1.9	708.7056	3	88.91	3	44240	20190523-10-H3.raw	4.89E7	4	4	148	166
K.AYQEQVLSNSAK.F	Y	42.84	1336.6622	12	0.7	669.3389	2	70.74	3	29035	20190523-10-H3.raw	5.21E8	4	4	354	365
K.QFPTIGFEKETMK.Y	Y	42.11	1554.7751	13	-0.3	519.2655	3	96.15	3	50457	20190523-10-H3.raw	5.51E7	2	2	502	514
M.LADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Y	41.50	3353.6965	32	-0.3	839.4312	4	140.86	3	91002	20190523-10-H3.raw	4.35E6	1	1	255	286
K.LRHEVEEFAK.Q	Y	38.97	1256.6512	10	0.4	419.8912	3	61.70	3	21709	20190523-10-H3.raw	5.94E8	9	9	492	501
R.HEVEEFAK.Q	Y	38.13	987.4661	8	0.3	494.7405	2	57.98	3	18729	20190523-10-H3.raw	1.5E7	2	2	494	501
K.WGVNVQPLSGSPANY(sub F)HVYTALLKPHER.I	Y	37.62	3032.5620	27	-0.6	607.5193	5	114.15	3	66353	20190523-10-H3.raw	2.87E6	1	1	140	166
L.PSEAVDEKER.S	Y	36.88	1158.5516	10	0.9	580.2836	2	64.42	3	23919	20190523-10-H3.raw	2.63E6	1	1	33	42
R.GFVEEDFAK.V	Y	36.70	1040.4814	9	0.3	521.2482	2	88.95	3	44281	20190523-10-H3.raw	5.19E8	2	2	440	448
K.NTVPGDVSAM(+15.99)VPGGIR.M	N	36.54	1584.7930	16	1.9	793.4053	2	93.35	3	48016	20190523-10-H3.raw	2.48E7	1	1	415	430	Oxidation (M)
R.IMALDLPHGGHLSHGYQTDTKK.I	N	35.38	2418.2114	22	0.9	605.5607	4	78.84	3	35697	20190523-10-H3.raw	1.13E8	2	2	167	188
R.MGTPALTSR.G	N	34.30	932.4750	9	-0.1	467.2447	2	69.08	3	27764	20190523-10-H3.raw	2.81E8	2	2	431	439
K.LIVAGASAYAR.L	N	34.04	1090.6134	11	0.4	546.3142	2	82.42	3	38812	20190523-10-H3.raw	5.89E8	8	8	226	236
K.YSEGYPGAR.Y	N	33.72	998.4457	9	0.8	500.2305	2	63.32	3	23020	20190523-10-H3.raw	3.75E8	2	2	102	110
K.EVLYDFEDK.I	Y	33.46	1156.5288	9	-0.2	579.2715	2	96.85	3	51014	20190523-10-H3.raw	1.79E8	3	3	311	319
M.SSLPSEAVDEKER.S	Y	32.90	1445.6997	13	1.1	482.9077	3	65.91	3	25108	20190523-10-H3.raw	6.69E7	4	4	30	42
M.SSLPSEAVDEK.E	Y	31.71	1160.5560	11	2.3	581.2866	2	69.38	3	27982	20190523-10-H3.raw	6.58E6	2	2	30	40
K.LKDFVSAM(+15.99)ESSSTIQSEIAK.L	Y	31.27	2186.0776	20	0.8	729.7004	3	96.27	3	50576	20190523-10-H3.raw	1.18E6	1	1	472	491	Oxidation (M)
L.EAVHIASNK.N	Y	31.07	967.5087	9	1.0	484.7621	2	70.60	3	28921	20190523-10-H3.raw	0	1	1	406	414
K.WGVNVQPLSGSPANFH.V	Y	30.87	1708.8322	16	3.0	855.4259	2	115.52	3	67565	20190523-10-H3.raw	6.17E5	1	1	140	155
K.WGVNVQPLSGSPANFHVY.T	Y	30.55	1970.9639	18	-1.1	986.4881	2	127.99	3	79083	20190523-10-H3.raw	1.2E7	1	1	140	157
K.GLELIPSENY(sub F)TSVSVMQAVGSVMTNK.Y	Y	29.90	2753.3616	26	3.0	1377.6921	2	144.27	3	94160	20190523-10-H3.raw	5.04E5	2	2	76	101
K.LRHEVEEY(sub F)AK.Q	Y	29.52	1272.6462	10	0.1	425.2227	3	58.59	3	19267	20190523-10-H3.raw	1.05E6	1	1	492	501
R.YYGGNEYIDM(+15.99)AETLC(+57.02)QK.R	N	29.40	2069.8711	17	2.1	1035.9449	2	104.90	3	58078	20190523-10-H3.raw	1.16E6	2	2	111	127	Oxidation (M); Carbamidomethylation
K.QFPTIGFEK.E	N	29.36	1065.5494	9	0.5	533.7823	2	101.49	3	54996	20190523-10-H3.raw	6.42E8	2	2	502	510
S.SLPSEAVDEKER.S	Y	28.97	1358.6677	12	0.7	453.8968	3	64.25	3	23768	20190523-10-H3.raw	6.02E8	4	4	31	42
K.VAEYFDK.A	Y	28.76	870.4123	7	1.0	436.2139	2	70.62	3	28940	20190523-10-H3.raw	2.21E8	2	2	449	455
K.FAQTLMER.G	Y	28.52	994.4906	8	0.5	498.2528	2	78.57	3	35473	20190523-10-H3.raw	6.25E8	3	3	366	373
R.STSC(+57.02)YMSSLPSEAVDEKER.S	Y	27.42	2174.9460	19	0.0	725.9893	3	88.73	3	44085	20190523-10-H3.raw	5.39E5	1	1	24	42	Carbamidomethylation
R.IM(+15.99)ALDLPHGGHLSHGYQTDTK.K	N	26.03	2306.1113	21	2.3	462.2306	5	79.46	3	36210	20190523-10-H3.raw	2.51E7	1	1	167	187	Oxidation (M)
K.EVLYDFEDKINQAVFPGLQGGPHNH.T	Y	25.68	2823.3616	25	0.7	706.8481	4	128.61	3	79666	20190523-10-H3.raw	0	1	1	311	335
R.ALEAFRLDPEK.W	Y	25.30	1287.6823	11	-1.2	644.8477	2	90.11	3	45230	20190523-10-H3.raw	1.15E8	2	2	129	139
R.LSSSIDKPIRPLIR.S	Y	24.25	1593.9565	14	1.3	399.4969	4	81.06	3	37597	20190523-10-H3.raw	3.8E6	1	1	10	23
K.AVMLADMAH.I	N	23.74	957.4412	9	1.2	479.7285	2	87.10	3	42693	20190523-10-H3.raw	9.94E7	1	1	252	260
K.AVTIALK.V	Y	23.64	714.4639	7	-0.3	358.2391	2	75.29	3	32780	20190523-10-H3.raw	3.39E8	2	2	456	462
S.SLPSEAVDEK.E	Y	23.00	1073.5240	10	1.0	537.7698	2	68.13	3	26964	20190523-10-H3.raw	6.24E7	2	2	31	40
K.SATLFRPKLIVAGASAYAR.L	Y	22.92	1991.1316	19	1.1	498.7907	4	98.81	3	52692	20190523-10-H3.raw	2.15E6	1	1	218	236
R.GAMIFFR.K	N	22.59	840.4316	7	0.0	421.2231	2	103.99	3	57256	20190523-10-H3.raw	4.46E8	1	1	293	299
K.KISAVSIFFETMPYRLDESTGYIDYDQMEK.S	Y	21.68	3575.6838	30	-1.7	894.9267	4	140.43	3	90598	20190523-10-H3.raw	9.72E6	1	1	188	217
R.ALEAFR.L	Y	21.47	705.3809	6	0.1	353.6978	2	70.65	3	28959	20190523-10-H3.raw	9.84E7	2	2	129	134
R.VTWPK.Q	Y	20.19	629.3537	5	-0.4	315.6840	2	68.75	3	27511	20190523-10-H3.raw	1.3E7	2	2	45	49
total 72 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
K.GRDTLGQEINVTC(+57.02)EVQQLLGNNR.V	Y	61.07	2613.2930	23	1.1	1307.6552	2	129.90	3	80823	20190523-10-H3.raw	5.46E8	5	5	51	73	Carbamidomethylation
R.YKELQDIIAILGLDELSEEDR.L	Y	60.63	2461.2588	21	2.2	1231.6394	2	152.89	3	102117	20190523-10-H3.raw	9.26E7	3	3	398	418
K.IGLFGGAGVGKTVLIMELINNIAK.A	Y	60.02	2427.3923	24	6.3	1214.7111	2	153.97	3	103147	20190523-10-H3.raw	2.3E7	3	3	168	191
R.GMDVVDMGNPLSVPVGGATLGR.I	Y	59.72	2141.0608	22	0.0	1071.5377	2	130.47	3	81342	20190523-10-H3.raw	6.26E8	5	5	88	109
K.GIYPAVDPLDSTSTMLQPR.I	Y	58.89	2060.0249	19	0.1	687.6823	3	126.03	3	77299	20190523-10-H3.raw	1.31E9	6	6	360	378
R.DTLGQEINVTC(+57.02)EVQQLLGNNR.V	Y	58.55	2400.1704	21	0.8	1201.0934	2	146.40	3	96096	20190523-10-H3.raw	7.26E8	9	9	53	73	Carbamidomethylation
R.GMDVVDM(+15.99)GNPLSVPVGGATLGR.I	Y	58.15	2157.0559	22	2.6	1079.5381	2	120.35	3	72012	20190523-10-H3.raw	4.26E7	6	6	88	109	Oxidation (M)
R.IVGEEHYETAQQVK.Q	Y	58.00	1629.7998	14	0.6	815.9077	2	67.97	3	26840	20190523-10-H3.raw	8.31E8	5	5	379	392
R.MPSAVGYQPTLSTEMGTLQER.I	Y	57.34	2295.0874	21	1.5	766.0375	3	114.15	3	66356	20190523-10-H3.raw	1.34E9	5	5	292	312
R.GM(+15.99)DVVDMGNPLSVPVGGATLGR.I	Y	56.83	2157.0559	22	-0.1	1079.5352	2	123.19	3	74625	20190523-10-H3.raw	1.79E7	2	2	88	109	Oxidation (M)
K.GSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR.G	Y	55.48	3713.8787	36	2.1	1238.9695	3	139.96	3	90160	20190523-10-H3.raw	3.43E8	7	7	319	354
R.M(+15.99)PSAVGYQPTLSTEMGTLQER.I	Y	54.94	2311.0825	21	-1.4	1156.5469	2	108.90	3	61601	20190523-10-H3.raw	3.53E7	4	4	292	312	Oxidation (M)
R.DVNEQDVLLFIDNIFR.F	Y	54.63	1948.9894	16	2.4	975.5043	2	159.06	3	107918	20190523-10-H3.raw	8.72E7	3	3	262	277
R.IAQIIGPVLDVAFPPGK.M	Y	54.44	1734.0079	17	0.8	579.0104	3	135.86	3	86369	20190523-10-H3.raw	3.84E9	18	18	23	39
K.IGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGER.T	Y	54.33	3737.0449	38	3.6	935.2719	4	152.90	3	102127	20190523-10-H3.raw	2.15E7	2	2	168	205
K.ELQDIIAILGLDELSEEDR.L	Y	54.15	2170.1003	19	-0.4	1086.0570	2	155.60	3	104690	20190523-10-H3.raw	6.95E7	2	2	400	418
K.VALVYGQMNEPPGAR.M	Y	53.55	1600.8031	15	0.5	534.6086	3	94.59	3	49078	20190523-10-H3.raw	1.47E9	13	13	232	246
R.YKELQDIIAILGLDELSEEDRLTVAR.A	Y	52.74	3001.5972	26	1.5	1001.5412	3	150.35	3	99742	20190523-10-H3.raw	5.46E8	11	11	398	423
K.SAPAFIELDTKLSIFETGIK.V	Y	52.48	2179.1775	20	0.6	727.4002	3	136.85	3	87289	20190523-10-H3.raw	5.28E7	4	4	135	154
K.KGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR.G	Y	52.08	3841.9736	37	5.6	1281.6724	3	131.17	3	81998	20190523-10-H3.raw	3.81E8	9	9	318	354
K.RGMDVVDMGNPLSVPVGGATLGR.I	Y	51.46	2297.1621	23	2.1	766.7296	3	120.30	3	71970	20190523-10-H3.raw	5.36E7	2	2	87	109
K.GIYPAVDPLDSTSTM(+15.99)LQPR.I	Y	51.40	2076.0198	19	1.8	1039.0190	2	115.89	3	67903	20190523-10-H3.raw	2.62E7	1	1	360	378	Oxidation (M)
R.GFNLILSGEFDSLPEQAFYLVGNIDEATAK.A	Y	51.00	3257.6130	30	0.3	1629.8143	2	157.10	3	106104	20190523-10-H3.raw	4E7	3	3	457	486
R.FLSQPFFVAEVFTGSPGK.Y	Y	50.60	1956.9985	18	-0.7	653.3397	3	144.64	3	94501	20190523-10-H3.raw	2.05E7	2	2	430	447
K.MPNIYNALVVK.G	Y	49.94	1260.6901	11	1.1	631.3530	2	113.21	3	65503	20190523-10-H3.raw	1.15E9	5	5	40	50
R.IAQIIGPVLDVAFPPGKMPNIYNALVVK.G	Y	49.79	2976.6873	28	0.0	745.1791	4	150.17	3	99571	20190523-10-H3.raw	3.18E8	10	10	23	50
R.IFNVLGEPVDNLGPVDTR.T	Y	49.16	1954.0160	18	0.8	652.3464	3	127.69	3	78812	20190523-10-H3.raw	1.22E9	6	6	110	127
K.ELQDIIAILGLDELSEEDRLTVAR.A	Y	49.01	2710.4387	24	0.3	678.6171	4	153.95	3	103124	20190523-10-H3.raw	1.81E8	4	4	400	423
K.AHGGVSVFGGVGER.T	Y	48.51	1327.6632	14	0.6	664.8393	2	78.16	3	35118	20190523-10-H3.raw	8.6E8	15	15	192	205
R.IAQIIGPVLDVAY(sub F)PPGK.M	Y	47.69	1750.0028	17	2.6	584.3431	3	129.25	3	80245	20190523-10-H3.raw	2.77E7	8	8	23	39
K.TVLIMELINNIAK.A	Y	47.05	1470.8480	13	-0.3	736.4311	2	153.23	3	102435	20190523-10-H3.raw	2.05E9	19	19	179	191
R.DVNEQDVLLFIDNIY(sub F)R.F	Y	46.88	1964.9843	16	2.3	983.5016	2	156.57	3	105606	20190523-10-H3.raw	5.75E6	2	2	262	277
R.IY(sub F)NVLGEPVDNLGPVDTR.T	Y	46.05	1970.0109	18	1.3	986.0140	2	121.86	3	73396	20190523-10-H3.raw	2.93E7	3	3	110	127
R.VGLTALTMAEYFR.D	Y	46.01	1470.7540	13	0.5	736.3846	2	132.71	3	83428	20190523-10-H3.raw	7.47E8	6	6	249	261
K.GRDTLGQEINVTC(+57.02)EVQQLLGNNRVR.A	Y	45.99	2868.4624	25	1.1	718.1237	4	123.67	3	75084	20190523-10-H3.raw	9.06E7	2	2	51	75	Carbamidomethylation
K.SAPAFIELDTKLSIFETGIKVVDLLAPYRR.G	Y	45.65	3361.8647	30	2.6	673.3820	5	152.95	3	102175	20190523-10-H3.raw	5.5E6	2	2	135	164
K.LSIFETGIKVVDLLAPYR.R	Y	45.49	2033.1560	18	0.6	678.7264	3	152.85	3	102074	20190523-10-H3.raw	3.61E6	1	1	146	163
K.M(+15.99)PNIYNALVVK.G	Y	45.14	1276.6849	11	0.6	639.3501	2	103.27	3	56595	20190523-10-H3.raw	1.67E7	2	2	40	50	Oxidation (M)
K.ESGVINEQNLAESK.V	Y	44.33	1516.7368	14	0.7	759.3762	2	78.70	3	35579	20190523-10-H3.raw	1.12E9	5	5	218	231
R.TNPTTSNPEVSIR.E	Y	44.32	1414.7052	13	1.2	708.3607	2	74.26	3	31900	20190523-10-H3.raw	1.06E9	5	5	3	15
R.FVQAGSEVSALLGR.M	Y	44.24	1432.7673	14	0.7	478.5967	3	113.12	3	65424	20190523-10-H3.raw	1.42E9	9	9	278	291
N.LILSGEFDSLPEQAFYLVGNIDEATAK.A	Y	43.71	2939.4802	27	-2.1	1470.7443	2	155.31	3	104417	20190523-10-H3.raw	2.88E6	2	2	460	486
R.GGKIGLFGGAGVGKTVLIMELINNIAK.A	Y	43.46	2669.5303	27	-1.1	668.3891	4	146.62	3	96304	20190523-10-H3.raw	2.32E6	1	1	165	191
R.EGNDLYMEMK.E	Y	43.39	1228.5104	10	0.8	615.2629	2	89.02	3	44347	20190523-10-H3.raw	3.06E8	2	2	208	217
K.TVLIM(+15.99)ELINNIAK.A	Y	43.22	1486.8429	13	0.0	744.4287	2	139.31	3	89547	20190523-10-H3.raw	1.58E8	5	5	179	191	Oxidation (M)
R.Y(sub F)VQAGSEVSALLGR.M	Y	42.58	1448.7623	14	0.4	725.3887	2	110.32	3	62905	20190523-10-H3.raw	2.27E7	2	2	278	291
K.SAPAFIELDTK.L	Y	41.84	1190.6183	11	-0.6	596.3160	2	100.05	3	53772	20190523-10-H3.raw	6.24E8	2	2	135	145
K.ESGVINEQNLAESKVALVYGQMNEPPGAR.M	Y	41.81	3099.5295	29	-0.5	1034.1832	3	116.33	3	68312	20190523-10-H3.raw	1.37E6	1	1	218	246
R.TNPTTSNPEVSIREK.K	Y	39.87	1671.8428	15	1.4	558.2890	3	66.73	3	25813	20190523-10-H3.raw	8.23E6	2	2	3	17
K.VALVYGQM(+15.99)NEPPGAR.M	Y	39.77	1616.7981	15	0.3	809.4066	2	84.36	3	40410	20190523-10-H3.raw	2.22E7	8	8	232	246	Oxidation (M)
R.DTLGQEINVTC(+57.02)EVQQLLGNNRVR.A	Y	39.76	2655.3398	23	-3.4	664.8400	4	137.30	3	87708	20190523-10-H3.raw	2.57E6	1	1	53	75	Carbamidomethylation
K.VVDLLAPYR.R	Y	39.21	1044.5967	9	1.0	349.2065	3	109.45	3	62096	20190523-10-H3.raw	7.21E8	7	7	155	163
R.VGLTALTMAEYY(sub F)R.D	Y	39.09	1486.7490	13	1.1	744.3826	2	124.58	3	75928	20190523-10-H3.raw	2.2E7	1	1	249	261
R.AVAMSATEGLK.R	Y	38.80	1076.5536	11	1.3	539.2848	2	74.79	3	32360	20190523-10-H3.raw	4.53E8	5	5	76	86
R.TREGNDLYMEMK.E	Y	37.74	1485.6592	12	0.9	743.8375	2	76.65	3	33940	20190523-10-H3.raw	2.6E8	5	5	206	217
K.RGM(+15.99)DVVDMGNPLSVPVGGATLGR.I	Y	37.56	2313.1570	23	-2.7	772.0576	3	112.71	3	65049	20190523-10-H3.raw	1.67E6	1	1	87	109	Oxidation (M)
R.TREGNDLYMEMKESGVINEQNLAESK.V	Y	37.28	2984.3855	26	-1.3	747.1027	4	102.52	3	55922	20190523-10-H3.raw	4.72E6	1	1	206	231
R.AVAMSATEGLKR.G	Y	37.27	1232.6547	12	0.1	411.8922	3	67.09	3	26127	20190523-10-H3.raw	3.71E8	5	5	76	87
R.VGLTALTM(+15.99)AEYFR.D	Y	37.25	1486.7490	13	-1.9	744.3804	2	117.91	3	69772	20190523-10-H3.raw	2.79E7	3	3	249	261	Oxidation (M)
R.MPSAVGYQPTLSTEM(+15.99)GTLQER.I	Y	37.18	2311.0825	21	4.3	1156.5535	2	102.73	3	56115	20190523-10-H3.raw	1.09E7	2	2	292	312	Oxidation (M)
K.VVDLLAPYRR.G	Y	35.45	1200.6979	10	1.5	601.3571	2	92.97	3	47668	20190523-10-H3.raw	3.52E8	5	5	155	164
R.EGNDLYM(+15.99)EMK.E	Y	34.05	1244.5054	10	0.3	623.2601	2	79.62	3	36344	20190523-10-H3.raw	2.19E7	1	1	208	217	Oxidation (M)
K.IGLFGGAGVGK.T	N	33.77	974.5549	11	-0.5	488.2845	2	96.51	3	50781	20190523-10-H3.raw	1.17E9	4	4	168	178
D.PLDSTSTMLQPR.I	Y	32.34	1344.6708	12	0.7	673.3431	2	86.74	3	42375	20190523-10-H3.raw	0	1	1	367	378
R.AVAM(+15.99)SATEGLK.R	Y	32.28	1092.5485	11	2.2	547.2827	2	62.61	3	22431	20190523-10-H3.raw	7.05E6	2	2	76	86	Oxidation (M)
K.LSIFETGIK.V	Y	31.60	1006.5699	9	1.3	504.2929	2	104.92	3	58094	20190523-10-H3.raw	7.38E8	3	3	146	154
K.SAPAY(sub F)IELDTK.L	Y	29.18	1206.6132	11	-0.2	604.3137	2	92.07	3	46906	20190523-10-H3.raw	4.57E7	1	1	135	145
R.AVAM(+15.99)SATEGLKR.G	Y	28.31	1248.6495	12	0.3	417.2239	3	58.49	3	19180	20190523-10-H3.raw	1.44E7	1	1	76	87	Oxidation (M)
F.AHLDATTVLSR.G	N	28.05	1182.6356	11	1.1	592.3257	2	77.92	3	34923	20190523-10-H3.raw	3.6E6	1	1	344	354
N.PTTSNPEVSIR.E	Y	27.89	1199.6146	11	5.2	600.8177	2	74.16	3	31821	20190523-10-H3.raw	4.47E6	1	1	5	15
K.IGLY(sub F)GGAGVGK.T	N	25.42	990.5498	11	2.8	496.2836	2	85.29	3	41163	20190523-10-H3.raw	9.05E6	1	1	168	178
R.DVNEQDVLLY(sub F)IDNIFR.F	Y	24.83	1964.9843	16	-1.6	656.0010	3	157.20	3	106204	20190523-10-H3.raw	1.35E5	1	1	262	277
K.YVGLAETIR.G	Y	23.36	1020.5604	9	2.1	511.2885	2	87.85	3	43319	20190523-10-H3.raw	3.03E7	1	1	448	456
K.KGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPR.I	Y	23.05	6324.2627	61	0.9	1055.0520	6	143.73	3	93660	20190523-10-H3.raw	0	1	1	318	378
R.GFNLILSGEY(sub F)DSLPEQAFYLVGNIDEATAK.A	Y	22.94	3273.6082	30	-1.4	1092.2085	3	156.17	3	105237	20190523-10-H3.raw	2.71E6	1	1	457	486
H.LDATTVLSR.G	N	20.75	974.5397	9	3.2	488.2787	2	87.39	3	42914	20190523-10-H3.raw	4.92E6	1	1	346	354
R.TREGNDLYM(+15.99)EMK.E	Y	20.49	1501.6541	12	0.6	751.8348	2	70.04	3	28498	20190523-10-H3.raw	2.16E6	1	1	206	217	Oxidation (M)
N.IYNALVVK.G	Y	20.29	918.5538	8	0.4	460.2844	2	82.65	3	39019	20190523-10-H3.raw	5.39E7	1	1	43	50
R.EGNDLYMEMKESGVINEQNLAESK.V	Y	20.22	2727.2368	24	2.4	910.0884	3	110.86	3	63372	20190523-10-H3.raw	3.22E6	1	1	208	231
total 79 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
K.QVANATNDVAGDGTTC(+57.02)ATVLTR.A	N	62.16	2234.0598	22	-0.1	1118.0371	2	89.92	3	45071	20190523-10-H3.raw	1.76E8	5	5	106	127	Carbamidomethylation
R.KANLQDLAALTGGEVITDELGMNLEK.V	Y	60.08	2742.4109	26	2.4	1372.2159	2	139.84	3	90045	20190523-10-H3.raw	8.45E7	4	4	316	341
K.ANLQDLAALTGGEVITDELGMNLEKVDLSMLGTC(+57.02)KK.V	Y	59.87	3846.9417	36	0.4	962.7430	4	153.23	3	102437	20190523-10-H3.raw	1.29E7	2	2	317	352	Carbamidomethylation
R.KANLQDLAALTGGEVITDELGMNLEKVDLSMLGTC(+57.02)K.K	Y	57.91	3846.9417	36	3.7	962.7463	4	152.73	3	101956	20190523-10-H3.raw	6.35E6	1	1	316	351	Carbamidomethylation
K.LLEQDNPDLGYDAAKGEYVDMVK.A	Y	57.26	2582.2209	23	2.7	861.7499	3	110.17	3	62765	20190523-10-H3.raw	1.07E8	2	2	499	521
K.ANLQDLAALTGGEVITDELGMNLEK.V	Y	56.73	2614.3159	25	-0.8	872.4452	3	152.70	3	101929	20190523-10-H3.raw	4.28E7	2	2	317	341
R.TALVDAASVSSLLTTTEAVVVDLPK.D	Y	55.98	2499.3684	25	-0.7	834.1295	3	156.15	3	105218	20190523-10-H3.raw	1.01E7	2	2	533	557
R.MISTSEEIAQVGTISANGER.E	Y	55.28	2092.0107	20	-1.4	1047.0112	2	105.21	3	58346	20190523-10-H3.raw	3.84E7	4	4	167	186
R.QRPLLIVSEDVESDALATLILNK.L	Y	54.64	2536.4111	23	1.2	846.4786	3	145.73	3	95471	20190523-10-H3.raw	3.98E7	8	8	274	296
K.AAVEEGILPGGGVALLYAAR.E	Y	54.40	1926.0574	20	0.4	643.0267	3	132.15	3	82906	20190523-10-H3.raw	2.01E8	4	4	435	454
K.TPVYTIASNAGVEGAVIVGK.L	Y	53.98	1945.0520	20	-1.0	973.5323	2	113.52	3	65794	20190523-10-H3.raw	1.14E7	5	5	479	498
R.MISTSEEIAQVGTISANGEREIGELIAK.A	Y	51.39	2945.5015	28	-1.3	982.8398	3	139.32	3	89562	20190523-10-H3.raw	1.16E8	2	2	167	194
R.GISMAVDAVVTNLK.S	Y	50.82	1416.7646	14	0.8	709.3901	2	120.20	3	71878	20190523-10-H3.raw	1.19E8	8	8	149	162
K.LLEQDNPDLGYDAAK.G	N	49.69	1660.7944	15	1.1	831.4054	2	92.66	3	47399	20190523-10-H3.raw	1.28E8	2	2	499	513
K.VTVSKDDTVILDGAGDKK.G	Y	47.94	1859.9840	18	-0.4	621.0017	3	76.37	3	33707	20190523-10-H3.raw	9.71E6	1	1	353	370
K.C(+57.02)ELDDPLILIHEK.K	Y	47.86	1593.8073	13	0.4	532.2766	3	112.50	3	64862	20190523-10-H3.raw	1.47E8	3	3	243	255	Carbamidomethylation
K.GVEDLADAVKVTMGPK.G	N	47.77	1628.8444	16	2.2	543.9566	3	110.97	3	63479	20190523-10-H3.raw	1.55E7	2	2	49	64
K.ANLQDLAALTGGEVITDELGMNLEKVDLSMLGTC(+57.02)K.K	Y	47.70	3718.8467	35	-1.0	930.7180	4	155.07	3	104189	20190523-10-H3.raw	1.31E6	1	1	317	351	Carbamidomethylation
K.TLFNELEVVEGMK.L	N	47.23	1507.7592	13	1.0	754.8876	2	130.13	3	81027	20190523-10-H3.raw	1.69E8	5	5	212	224
K.TLFNELEVVEGMKLDR.G	N	46.86	1891.9713	16	0.2	631.6645	3	128.86	3	79899	20190523-10-H3.raw	7.6E7	5	5	212	227
K.EGVITIQDGKTLFNELEVVEGMK.L	N	46.73	2548.3093	23	1.3	850.4448	3	143.60	3	93546	20190523-10-H3.raw	2.65E6	1	1	202	224
R.SAIELSTSDYDKEKLQER.L	Y	45.91	2111.0381	18	-0.4	528.7666	4	81.99	3	38420	20190523-10-H3.raw	3.15E7	3	3	381	398
K.SVAAGMNAMDLR.R	N	44.05	1234.5798	12	1.1	618.2979	2	90.06	3	45186	20190523-10-H3.raw	1.55E8	3	3	136	147
K.LPTANFDQK.I	Y	42.57	1032.5239	9	0.0	517.2692	2	76.31	3	33664	20190523-10-H3.raw	5.24E7	2	2	459	467
R.NVVIEQSWGAPK.V	Y	42.56	1326.6931	12	-0.1	664.3538	2	92.16	3	46972	20190523-10-H3.raw	1.4E8	2	2	67	78
R.GYTSPYFITNQK.T	Y	42.34	1417.6877	12	0.5	709.8515	2	94.41	3	48910	20190523-10-H3.raw	1.53E8	2	2	228	239
R.SAIELSTSDYDKEK.L	Y	41.24	1584.7518	14	0.7	529.2582	3	77.22	3	34373	20190523-10-H3.raw	8.85E7	3	3	381	394
R.QRPLLIVSEDVESDALATLILNKLR.A	Y	41.12	2805.5962	25	0.7	702.4068	4	147.45	3	97065	20190523-10-H3.raw	7.17E5	1	1	274	298
K.TQKC(+57.02)ELDDPLILIHEK.K	Y	39.36	1951.0084	16	2.7	488.7607	4	100.58	3	54200	20190523-10-H3.raw	5.7E6	1	1	240	255	Carbamidomethylation
R.ELEKLPTANFDQK.I	Y	38.92	1531.7882	13	1.9	766.9028	2	86.90	3	42507	20190523-10-H3.raw	1.03E8	4	4	455	467
K.VTVSKDDTVILDGAGDKKGIEER.C	Y	38.87	2444.2759	23	1.7	612.0773	4	80.47	3	37090	20190523-10-H3.raw	7.25E5	1	1	353	375
K.EGVITIQDGK.T	N	37.68	1058.5608	10	0.7	530.2880	2	76.22	3	33582	20190523-10-H3.raw	1.18E8	1	1	202	211
K.AGIIDPLKVIR.T	N	37.32	1193.7495	11	0.4	398.9240	3	105.77	3	58834	20190523-10-H3.raw	1.86E7	2	2	522	532
K.DDTVILDGAGDKK.G	Y	37.17	1345.6725	13	-0.2	449.5647	3	74.33	3	31960	20190523-10-H3.raw	2.77E7	3	3	358	370
K.VDLSMLGTC(+57.02)K.K	Y	36.96	1122.5413	10	-1.7	562.2770	2	97.86	3	51857	20190523-10-H3.raw	1.25E7	1	1	342	351	Carbamidomethylation
R.SAIELSTSDYDK.E	Y	36.86	1327.6143	12	0.5	664.8148	2	85.16	3	41053	20190523-10-H3.raw	1.14E7	2	2	381	392
K.IGVQIIQNALK.T	N	36.60	1195.7289	11	-0.6	598.8713	2	108.45	3	61233	20190523-10-H3.raw	3.89E8	2	2	468	478
R.RGISMAVDAVVTNLK.S	Y	36.45	1572.8657	15	-1.1	525.2953	3	106.51	3	59515	20190523-10-H3.raw	2.43E6	1	1	148	162
K.IGGASEAEVGEKK.D	Y	36.21	1273.6514	13	0.4	425.5579	3	55.83	3	16954	20190523-10-H3.raw	1.33E7	2	2	411	423
R.VTDALNATK.A	N	34.99	931.4974	9	0.8	466.7563	2	60.22	3	20541	20190523-10-H3.raw	2.35E7	1	1	426	434
K.DDTVILDGAGDK.K	Y	34.80	1217.5775	12	-4.7	609.7932	2	86.07	3	41804	20190523-10-H3.raw	3.48E6	1	1	358	369
K.KVTVSKDDTVILDGAGDKK.G	Y	34.63	1988.0790	19	0.3	498.0272	4	70.10	3	28548	20190523-10-H3.raw	1.4E7	1	1	352	370
K.VGKEGVITIQDGKTLFNELEVVEGMKLDR.G	N	33.22	3216.7063	29	-1.8	644.3474	5	132.63	3	83361	20190523-10-H3.raw	1.98E6	1	1	199	227
R.KANLQDLAALTGGEVITDELGM(+15.99)NLEK.V	Y	32.70	2758.4058	26	6.9	920.4822	3	135.08	3	85644	20190523-10-H3.raw	2.27E5	1	1	316	341	Oxidation (M)
R.AIFAEGC(+57.02)K.S	Y	30.89	894.4269	8	0.4	448.2209	2	67.84	3	26725	20190523-10-H3.raw	2.3E7	1	1	128	135	Carbamidomethylation
K.IKNVGASLVK.Q	N	30.80	1027.6389	10	0.2	343.5536	3	64.42	3	23917	20190523-10-H3.raw	1.73E7	1	1	96	105
K.GVEDLADAVK.V	N	30.37	1015.5186	10	2.0	508.7676	2	91.41	3	46346	20190523-10-H3.raw	5.35E8	1	1	49	58
K.ISSINSIVK.V	Y	30.25	959.5651	9	0.9	480.7903	2	81.13	3	37666	20190523-10-H3.raw	1.1E8	2	2	257	265
K.DRVTDALNATK.A	N	29.55	1202.6255	11	7.2	602.3243	2	76.12	3	33484	20190523-10-H3.raw	6.38E6	2	2	424	434
K.VDLSMLGTC(+57.02)KK.V	Y	29.18	1250.6362	11	-1.5	626.3245	2	84.11	3	40200	20190523-10-H3.raw	2.08E7	2	2	342	352	Carbamidomethylation
K.VGKEGVITIQDGK.T	N	28.94	1342.7456	13	-4.4	672.3771	2	68.90	3	27621	20190523-10-H3.raw	1.51E5	1	1	199	211
K.AGIIDPLK.V	N	28.31	825.4960	8	0.0	413.7552	2	90.09	3	45214	20190523-10-H3.raw	1.93E8	2	2	522	529
K.C(+57.02)ELDDPLILIHEKK.I	Y	27.75	1721.9021	14	1.4	574.9755	3	101.07	3	54613	20190523-10-H3.raw	0	1	1	243	256	Carbamidomethylation
R.EIGELIAK.A	N	27.30	871.5015	8	0.9	436.7584	2	81.72	3	38185	20190523-10-H3.raw	2.26E8	2	2	187	194
L.KIGGASEAEVGEK.K	Y	27.30	1273.6514	13	-0.1	425.5577	3	56.20	3	17258	20190523-10-H3.raw	1.33E7	1	1	410	422
K.KISSINSIVK.V	Y	27.19	1087.6600	10	3.2	363.5618	3	70.55	3	28884	20190523-10-H3.raw	5.23E6	2	2	256	265
K.GEYVDMVK.A	Y	26.91	939.4371	8	0.4	470.7260	2	77.08	3	34270	20190523-10-H3.raw	4.71E7	2	2	514	521
K.LSGGVAVLK.I	N	26.58	842.5225	9	-0.2	422.2684	2	73.06	3	30963	20190523-10-H3.raw	2.15E8	2	2	402	410
K.NVGASLVK.Q	N	25.51	786.4600	8	0.8	394.2376	2	64.52	3	24001	20190523-10-H3.raw	3.01E7	1	1	98	105
K.ISSINSIVKVLELALKR.Q	Y	24.82	1882.1615	17	-0.8	471.5473	4	141.81	3	91890	20190523-10-H3.raw	7.3E5	1	1	257	273
K.VLELALKR.Q	Y	24.26	940.6069	8	0.3	314.5430	3	78.72	3	35600	20190523-10-H3.raw	8.03E7	2	2	266	273
K.VLELALK.R	N	23.48	784.5058	7	0.2	393.2603	2	91.98	3	46831	20190523-10-H3.raw	1.01E8	2	2	266	272
K.EGVITIQDGKTLFNELEVVEGMKLDR.G	N	23.45	2932.5215	26	3.2	734.1400	4	140.84	3	90990	20190523-10-H3.raw	1.29E7	2	2	202	227
R.GISM(+15.99)AVDAVVTNLK.S	Y	23.24	1432.7595	14	3.1	478.5953	3	116.61	3	68568	20190523-10-H3.raw	1.78E6	1	1	149	162	Oxidation (M)
K.FGVEAR.A	N	20.20	677.3496	6	0.5	339.6823	2	62.12	3	22045	20190523-10-H3.raw	1.21E7	1	1	38	43
total 65 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
R.AGEYVNAIGAYLAPSGTTPLTPATQSQK.L	Y	66.14	2805.4185	28	0.1	1403.7167	2	125.68	3	76969	20190523-10-H3.raw	3.04E8	6	6	535	562
K.LEGAGSEAGTLWDDGAFDGVR.K	Y	60.07	2121.9602	21	0.6	1061.9880	2	121.54	3	73094	20190523-10-H3.raw	2.28E8	8	8	563	583
K.LEAQGNSTGGTSWDDGSDYDGVTK.I	Y	59.47	2459.0361	24	0.7	1230.5262	2	92.70	3	47431	20190523-10-H3.raw	7.98E7	5	5	255	278
K.VSVGQAQDGIGAVSFVYDK.A	Y	59.39	1938.9686	19	1.1	970.4926	2	114.52	3	66693	20190523-10-H3.raw	2.28E8	3	3	585	603
K.TNLNTYEVSIYPFEPSTDTK.F	Y	57.85	2318.0955	20	1.4	1160.0566	2	124.05	3	75435	20190523-10-H3.raw	1.74E8	3	3	346	365
K.SAEFTLAPDEYITALSAYGK.S	Y	57.74	2146.0469	20	0.5	1074.0312	2	141.83	3	91913	20190523-10-H3.raw	4.24E8	5	5	47	66
K.SLSTQEVITALTFTTNK.T	Y	55.61	1852.9781	17	1.9	927.4981	2	131.36	3	82170	20190523-10-H3.raw	3.85E8	7	7	67	83
K.LEGAGSEAGTLWDDGAFDGVRK.V	Y	53.32	2250.0552	22	0.0	751.0257	3	108.46	3	61242	20190523-10-H3.raw	1.42E8	6	6	563	584
K.LTAEGGETGAVWDDGSHDDVKK.V	Y	53.12	2286.0400	22	0.0	763.0206	3	77.60	3	34668	20190523-10-H3.raw	2.88E8	9	9	409	430
K.SLSTQEVITALTFTTNKTSYGPYGTK.S	Y	53.09	2807.4229	26	1.1	936.8159	3	128.16	3	79250	20190523-10-H3.raw	1.32E7	1	1	67	92
K.VSVGQAQDGIGAVSFVYDKAGQVVEGK.E	Y	52.31	2707.3816	27	0.8	903.4685	3	125.03	3	76352	20190523-10-H3.raw	1.18E7	1	1	585	611
R.KVSVGQAQDGIGAVSFVYDK.A	Y	52.02	2067.0637	20	-0.5	690.0281	3	103.10	3	56452	20190523-10-H3.raw	1.74E8	3	3	584	603
R.VSIPFGIGAGTAFEFK.K	Y	51.44	1639.8610	16	0.1	820.9379	2	137.08	3	87508	20190523-10-H3.raw	1.29E8	4	4	661	676
K.IIGFHGFAGNHVNSIGAYFVPK.S	Y	51.34	2344.2117	22	4.0	782.4143	3	114.62	3	66786	20190523-10-H3.raw	3.96E8	5	5	375	396
R.KVSVGQAQDGIGAVSFVYDKAGQVVEGK.E	Y	50.37	2835.4766	28	-3.2	709.8741	4	115.90	3	67910	20190523-10-H3.raw	1.14E6	1	1	584	611
R.VSIPFGIGAGTAFEFKK.D	Y	48.82	1767.9559	17	-0.2	590.3258	3	121.90	3	73430	20190523-10-H3.raw	3.59E8	5	5	661	677
K.VSVGQAQDGIGAVSY(sub F)VYDK.A	Y	48.20	1954.9636	19	1.0	978.4901	2	109.08	3	61763	20190523-10-H3.raw	2.39E5	1	1	585	603
K.TAGPFGIVSGTKFEFKK.E	Y	47.96	1812.9773	17	-0.4	454.2514	4	101.54	3	55044	20190523-10-H3.raw	0	2	2	507	523
K.TAGPFGIVSGTK.F	Y	46.78	1133.6080	12	-0.9	567.8108	2	92.78	3	47500	20190523-10-H3.raw	3.35E8	5	5	507	518
K.NFGVDTVVTTLIFK.T	Y	45.99	1552.8501	14	-1.0	777.4315	2	145.27	3	95073	20190523-10-H3.raw	2.14E8	5	5	488	501
K.VYVGQGQDGVAAVKFEYK.N	Y	45.91	1956.9945	18	-0.7	653.3383	3	95.21	3	49626	20190523-10-H3.raw	5.46E7	1	1	431	448
K.VYVGQGQDGVAAVK.F	Y	45.81	1389.7252	14	0.2	695.8700	2	76.81	3	34083	20190523-10-H3.raw	3.5E8	3	3	431	444
K.IYASYGGEGIQYVK.F	Y	45.67	1546.7667	14	0.9	774.3913	2	95.85	3	50171	20190523-10-H3.raw	4.55E8	4	4	279	292
K.TAGPFGIVSGTKFEFK.K	Y	45.31	1684.8824	16	0.0	562.6348	3	113.01	3	65326	20190523-10-H3.raw	2.99E7	2	2	507	522
Y.LAPSGTTPLTPATQSQK.L	Y	44.79	1696.8995	17	1.0	849.4579	2	78.40	3	35320	20190523-10-H3.raw	1.03E7	2	2	546	562
K.FGVHVAPITK	Y	44.07	1067.6128	10	1.2	534.8143	2	78.73	3	35608	20190523-10-H3.raw	7.3E8	4	4	696	705
K.NGSQVVFGDER.G	Y	43.90	1206.5629	11	0.9	604.2892	2	74.23	3	31878	20190523-10-H3.raw	2.77E8	2	2	449	459
K.TNLNTYEVSIYPFEPSTDTKFTLQVQDKK.I	Y	43.55	3405.6980	29	4.2	852.4354	4	121.81	3	73345	20190523-10-H3.raw	3.38E7	3	3	346	374
K.VQLTFDEIIYSIQVTYDGATALQSQLR.G	Y	42.28	3071.5815	27	-0.2	1024.8676	3	157.71	3	106676	20190523-10-H3.raw	2.46E6	2	2	14	40
K.NGSQVVFGDERGTR.T	Y	41.58	1520.7332	14	2.1	507.9194	3	66.74	3	25827	20190523-10-H3.raw	1.17E7	2	2	449	462
K.SSTTPVPSTPLK.L	Y	41.23	1213.6554	12	0.5	607.8353	2	76.18	3	33544	20190523-10-H3.raw	3.61E8	2	2	397	408
N.STGGTSWDDGSDYDGVTK.I	Y	39.81	1846.7493	18	0.1	924.3820	2	87.08	3	42672	20190523-10-H3.raw	4.2E6	1	1	261	278
K.LTAEGGETGAVWDDGSHDDVK.K	Y	39.73	2157.9451	21	-0.9	1079.9789	2	85.88	3	41639	20190523-10-H3.raw	3.62E7	2	2	409	429
K.KVYVGQGQDGVAAVK.F	Y	39.57	1517.8202	15	0.8	506.9478	3	68.09	3	26930	20190523-10-H3.raw	7.76E6	2	2	430	444
K.SGFQISAPEATGK.Q	Y	39.47	1291.6407	13	-0.4	646.8274	2	87.15	3	42737	20190523-10-H3.raw	4.21E8	3	3	93	105
K.RVSIPFGIGAGTAFEFK.K	Y	37.01	1795.9620	17	1.3	599.6620	3	124.01	3	75399	20190523-10-H3.raw	9.86E5	1	1	660	676
Q.KLEGAGSEAGTLWDDGAFDGVR.K	Y	36.07	2250.0552	22	3.9	751.0286	3	110.16	3	62749	20190523-10-H3.raw	0	1	1	562	583
F.HGFAGNHVNSIGAYFVPK.S	Y	35.70	1913.9536	18	0.6	479.4960	4	93.04	3	47735	20190523-10-H3.raw	2.97E6	1	1	379	396
K.FTLQVQDKK.I	N	33.80	1105.6132	9	1.4	553.8146	2	69.10	3	27775	20190523-10-H3.raw	7.4E7	3	3	366	374
K.VSVGQAQDGIGAVSFVYDKAG.Q	Y	32.93	2067.0273	21	17.1	690.0282	3	104.52	3	57738	20190523-10-H3.raw	7.97E7	3	3	585	605
K.FTLQVQDK.K	N	32.29	977.5182	8	1.0	489.7669	2	81.58	3	38068	20190523-10-H3.raw	1.69E8	2	2	366	373
K.TSYGPYGTK.S	Y	31.25	972.4553	9	0.5	487.2351	2	64.59	3	24066	20190523-10-H3.raw	1.07E8	1	1	84	92
K.EGYKITGFHGR.A	Y	31.17	1263.6360	11	0.8	316.9165	4	66.33	3	25453	20190523-10-H3.raw	5.45E6	1	1	524	534
K.SAEFTLAPDEYITALSAYGKSLSTQEVITALTFTTNKTSYGPYGTK.S	Y	27.89	4935.4595	46	-2.0	1234.8696	4	153.99	3	103163	20190523-10-H3.raw	3.19E6	1	1	47	92
L.KLTAEGGETGAVWDDGSHDDVK.K	Y	27.22	2286.0400	22	1.4	572.5181	4	79.13	3	35940	20190523-10-H3.raw	1.88E7	2	2	408	429
R.AGEYVNAIGAYLAPSGTTPLTPATQSQKLEGAGSEAGTLWDDGAFDGVRK.V	Y	25.39	5037.4629	50	-1.0	1260.3717	4	134.64	3	85230	20190523-10-H3.raw	2.09E7	1	1	535	584
K.EHGKPTLLGFEEFELDYPSEYITAVDGTYDAIFGNEPIVNM(+15.99)LR.F	Y	24.92	4905.3369	43	4.0	1227.3464	4	155.07	3	104192	20190523-10-H3.raw	0	1	1	612	654	Oxidation (M)
K.RVSIPFGIGAGTAFEFKK.D	Y	24.49	1924.0570	18	-0.5	482.0213	4	111.37	3	63844	20190523-10-H3.raw	0	1	1	660	677
R.VSIPFGIGAGTAFEY(sub F)KK.D	Y	23.15	1783.9508	17	-0.6	595.6572	3	117.45	3	69349	20190523-10-H3.raw	7.07E5	1	1	661	677
R.AGEYVNAIGAYLAPSGTTPLTPATQSQKLEGAGSEAGTLWDDGAFDGVR.K	Y	22.86	4909.3682	49	3.9	1228.3541	4	142.00	3	92068	20190523-10-H3.raw	0	1	1	535	583
R.AGDLLHKFGVHVAPITK	Y	21.62	1802.0203	17	-1.9	451.5115	4	94.71	3	49175	20190523-10-H3.raw	4.35E6	1	1	689	705
total 51 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
K.QSQSAPLTVEEQIMTIYTGTNGYLDGLEIGQVRK.F	Y	65.64	3738.8774	34	1.6	1247.3018	3	152.52	3	101763	20190523-10-H3.raw	1.55E8	3	3	423	456
K.LKLELAQFAELEAFSQFSSDLDKATQNQLAR.G	Y	62.48	3510.7993	31	0.3	1171.2740	3	151.44	3	100741	20190523-10-H3.raw	9.03E7	7	7	383	413
K.TLTAEAESFLKEGIQEQLER.F	Y	61.87	2291.1646	20	1.9	1146.5917	2	133.22	3	83910	20190523-10-H3.raw	5.08E8	6	6	481	500
K.QSQSAPLTVEEQIMTIYTGTNGYLDGLEIGQVR.K	Y	61.61	3610.7825	33	-0.7	1204.6006	3	154.81	3	103940	20190523-10-H3.raw	1.75E8	2	2	423	455
K.TAVATDTILNQQGQNVIC(+57.02)VYVAIGQK.A	Y	60.93	2803.4539	26	0.9	1402.7355	2	134.42	3	85022	20190523-10-H3.raw	6.81E7	21	21	177	202	Carbamidomethylation
K.LELAQFAELEAFSQFSSDLDKATQNQLAR.G	Y	59.92	3269.6204	29	2.6	1090.8835	3	153.25	3	102462	20190523-10-H3.raw	6.35E7	2	2	385	413
R.SVYEPLQTGLIAIDSMIPIGR.G	Y	56.49	2272.2136	21	2.4	1137.1168	2	154.74	3	103880	20190523-10-H3.raw	1.03E9	4	4	142	162
K.LELAQFAELEAFSQFSSDLDK.A	Y	54.55	2387.1531	21	1.7	1194.5858	2	154.56	3	103709	20190523-10-H3.raw	4.18E7	5	5	385	405
R.RSVYEPLQTGLIAIDSMIPIGR.G	Y	54.53	2428.3147	22	0.8	810.4462	3	147.17	3	96810	20190523-10-H3.raw	1.83E8	4	4	141	162
R.EVTIVNTGTVLQVGDGIAR.I	Y	54.05	1941.0531	19	0.1	971.5339	2	119.11	3	70910	20190523-10-H3.raw	5.85E8	18	18	23	41
K.LKLELAQFAELEAFSQFSSDLDK.A	Y	53.08	2628.3323	23	-3.1	877.1153	3	152.81	3	102039	20190523-10-H3.raw	4.13E7	17	17	383	405
K.TAVATDTILNQQGQNVIC(+57.02)VYVAIGQKASSVAQVVTSLQER.G	Y	52.17	4259.2222	40	-1.9	1420.7454	3	154.16	3	103321	20190523-10-H3.raw	8.22E6	2	2	177	216	Carbamidomethylation
K.TNKPQFQEIIASTK.T	Y	51.79	1603.8569	14	0.1	802.9358	2	84.03	3	40142	20190523-10-H3.raw	1.01E9	5	5	467	480
Q.SAPLTVEEQIMTIYTGTNGYLDGLEIGQVR.K	Y	51.50	3267.6333	30	2.8	1090.2214	3	154.81	3	103941	20190523-10-H3.raw	1.68E6	1	1	426	455
K.QSQSAPLTVEEQIM(+15.99)TIYTGTNGYLDGLEIGQVR.K	Y	51.32	3626.7773	33	5.6	1209.9398	3	153.03	3	102252	20190523-10-H3.raw	1.07E7	1	1	423	455	Oxidation (M)
K.ASSVAQVVTSLQER.G	Y	50.65	1473.7787	14	0.3	737.8969	2	102.50	3	55903	20190523-10-H3.raw	1.04E9	5	5	203	216
R.SVYEPLQTGLIAIDSM(+15.99)IPIGR.G	Y	50.51	2288.2085	21	-0.2	1145.1113	2	144.74	3	94594	20190523-10-H3.raw	9.1E7	8	8	142	162	Oxidation (M)
L.KQSQSAPLTVEEQIMTIYTGTNGYLDGLEIGQVR.K	Y	49.49	3738.8774	34	1.7	1247.3019	3	152.17	3	101430	20190523-10-H3.raw	1.27E7	1	1	422	455
A.GIRPAINVGISVSR.V	N	48.36	1437.8416	14	0.6	719.9285	2	91.20	3	46159	20190523-10-H3.raw	4.44E8	5	5	353	366
K.TNKPQFQEIIASTKTLTAEAESFLKEGIQEQLER.F	Y	48.23	3877.0107	34	-1.8	776.4080	5	152.85	3	102071	20190523-10-H3.raw	0	1	1	467	500
Y.TGTNGYLDGLEIGQVR.K	Y	47.99	1691.8478	16	0.3	846.9315	2	112.20	3	64597	20190523-10-H3.raw	1.56E7	2	2	440	455
K.IAQIPVSEAYLGR.V	Y	47.72	1415.7772	13	0.3	472.9332	3	104.38	3	57615	20190523-10-H3.raw	1.97E9	6	6	95	107
R.RSVYEPLQTGLIAIDSM(+15.99)IPIGR.G	Y	47.54	2444.3096	22	-2.1	815.7755	3	132.07	3	82838	20190523-10-H3.raw	2.95E6	1	1	141	162	Oxidation (M)
K.TNKPQY(sub F)QEIIASTK.T	Y	45.62	1619.8518	14	1.0	540.9584	3	78.28	3	35213	20190523-10-H3.raw	4.08E7	2	2	467	480
R.IEQYNREVTIVNTGTVLQVGDGIAR.I	Y	45.60	2744.4456	25	1.5	915.8239	3	113.89	3	66120	20190523-10-H3.raw	7.08E6	2	2	17	41
R.EAYPGDVFYLHSR.L	Y	44.47	1552.7310	13	0.8	518.5847	3	102.37	3	55790	20190523-10-H3.raw	1.58E9	7	7	285	297
R.EQHTLIIYDDLSK.Q	Y	43.12	1573.7987	13	8.8	787.9136	2	97.85	3	51844	20190523-10-H3.raw	4.43E7	4	4	254	266
K.TLTAEAESFLK.E	Y	41.69	1208.6288	11	0.6	605.3220	2	110.41	3	62981	20190523-10-H3.raw	9.25E8	4	4	481	491
R.EAYPGDVY(sub F)YLHSR.L	Y	39.86	1568.7260	13	1.3	523.9166	3	90.95	3	45941	20190523-10-H3.raw	6.5E7	2	2	285	297
R.EAF(sub Y)PGDVY(sub F)YLHSR.L	Y	39.44	1552.7310	13	0.8	518.5847	3	101.24	3	54767	20190523-10-H3.raw	3.92E7	2	2	285	297
R.VINALANPIDGR.G	Y	38.73	1251.6935	12	3.9	626.8564	2	94.77	3	49232	20190523-10-H3.raw	1.8E9	2	2	108	119
S.RLIESPAPGIISR.R	Y	38.45	1407.8197	13	0.3	470.2806	3	86.69	3	42330	20190523-10-H3.raw	4.19E7	1	1	128	140
R.ADEISNIIR.E	Y	37.71	1029.5454	9	0.4	515.7802	2	90.99	3	45974	20190523-10-H3.raw	1.02E9	3	3	6	14
K.TLTAEAESY(sub F)LK.E	Y	37.41	1224.6238	11	0.5	613.3195	2	102.51	3	55915	20190523-10-H3.raw	3.41E7	2	2	481	491
Y.TIVVAETADSPATLQYLAPYTGAALAEYFMYR.E	Y	36.40	3495.7271	32	2.0	1166.2520	3	155.69	3	104779	20190523-10-H3.raw	0	1	1	222	253
L.KQSQSAPLTVEEQIM(+15.99)TIF(sub Y)TGTNGYLDGLEIGQVR.K	Y	36.19	3738.8774	34	0.1	935.7267	4	152.20	3	101452	20190523-10-H3.raw	3.36E6	1	1	422	455	Oxidation (M)
R.LIESPAPGIISR.R	Y	34.96	1251.7186	12	-1.4	626.8657	2	94.44	3	48936	20190523-10-H3.raw	3.79E8	2	2	129	140
R.PAINVGISVSR.V	N	34.83	1111.6349	11	-0.2	556.8246	2	92.61	3	47354	20190523-10-H3.raw	5.44E7	6	6	356	366
Y.TGAALAEYFMYR.E	Y	33.81	1391.6543	12	0.3	696.8347	2	119.43	3	71164	20190523-10-H3.raw	3.89E6	1	1	242	253
R.SVYEPLQTGLIAIDSMIPIGRGQR.E	Y	32.84	2613.3948	24	1.6	872.1403	3	148.29	3	97835	20190523-10-H3.raw	3.39E6	1	1	142	165
K.EGIQEQLER.F	Y	32.70	1100.5461	9	1.2	551.2810	2	75.22	3	32713	20190523-10-H3.raw	5.99E8	2	2	492	500
M.VTIRADEISNIIR.E	Y	31.63	1498.8467	13	0.8	500.6232	3	103.38	3	56706	20190523-10-H3.raw	2.88E7	1	1	2	14
R.ELIIGDRQTGK.T	N	29.97	1228.6775	11	1.0	410.5669	3	67.23	3	26245	20190523-10-H3.raw	4.5E7	3	3	166	176
R.EAYPGDVFYLH.S	Y	28.86	1309.5979	11	0.5	655.8066	2	114.81	3	66961	20190523-10-H3.raw	8.97E7	1	1	285	295
R.LIESPAPGIISRR.S	Y	26.30	1407.8197	13	0.1	470.2806	3	84.14	3	40225	20190523-10-H3.raw	7.64E7	2	2	129	141
R.ERIEQYNR.E	Y	26.11	1106.5469	8	-0.7	369.8560	3	53.90	3	15535	20190523-10-H3.raw	3.76E6	1	1	15	22
R.ERIEQYNREVTIVNTGTVLQVGDGIAR.I	Y	26.05	3029.5894	27	-7.8	758.3987	4	109.20	3	61870	20190523-10-H3.raw	1.12E6	1	1	15	41
R.QMSLLLR.R	N	26.03	859.4949	7	0.5	430.7550	2	94.13	3	48670	20190523-10-H3.raw	1.31E9	3	3	273	279
Y.LAPYTGAALAEYFMYR.E	Y	25.94	1835.8916	16	-1.8	612.9700	3	139.55	3	89769	20190523-10-H3.raw	6.09E5	1	1	238	253
R.ADEISNIIRERIEQYNREVTIVNTGTVLQVGDGIAR.I	Y	24.38	4041.1243	36	-0.8	809.2315	5	137.96	3	88320	20190523-10-H3.raw	4.98E6	1	1	6	41
Y.PGDVFYLHSR.L	N	22.88	1189.5880	10	-5.8	595.7979	2	98.25	3	52198	20190523-10-H3.raw	2.01E6	1	1	288	297
R.ELIIGDR.Q	N	21.92	814.4548	7	0.4	408.2349	2	80.73	3	37315	20190523-10-H3.raw	1.25E9	3	3	166	172
K.TLTAEAESFLKEGIQEQLERFLLQEKV	Y	20.38	3148.6655	27	3.4	1050.5660	3	153.37	3	102569	20190523-10-H3.raw	1.18E6	1	1	481	507
total 53 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End
K.IIGFHGSAGGNLNSLGAYFAPLTTTTPLTPAK.Q	Y	69.66	3186.6714	32	0.6	1594.3439	2	137.50	3	87895	20190523-10-H3.raw	2.57E9	16	16	122	153
K.QLTAFGSDDGTVWDDGAYVGVK.K	Y	63.18	2300.0596	22	0.5	1151.0376	2	125.23	3	76540	20190523-10-H3.raw	6.04E8	13	13	154	175
K.QLTAFGSDDGTVWDDGAYVGVKK.V	Y	60.89	2428.1545	23	1.3	1215.0862	2	112.33	3	64712	20190523-10-H3.raw	5.66E8	5	5	154	176
K.TSDVIGSDEGTHFTLQVK.D	Y	57.93	1932.9429	18	0.7	967.4794	2	97.52	3	51563	20190523-10-H3.raw	7.43E8	16	16	101	118
K.QTSPPFGLEAGTVFELKEEGHKIVGFHGR.A	Y	57.29	3166.6199	29	1.1	528.7778	6	112.50	3	64863	20190523-10-H3.raw	1.14E8	4	4	253	281
K.IQLAAGIDGIQYVQFDYVK.N	Y	57.26	2140.1204	19	1.5	1071.0691	2	138.55	3	88883	20190523-10-H3.raw	2.65E8	89	89	28	46
K.QTSPPFGLEAGTVFELK.E	Y	56.75	1819.9355	17	1.6	910.9765	2	130.80	3	81652	20190523-10-H3.raw	3.64E8	12	12	253	269
R.VLPADPFVINHPDEHLVSVEGWYSPEGIIQGIK.F	Y	56.41	3654.8721	33	-0.1	1219.2979	3	141.23	3	91354	20190523-10-H3.raw	2.86E9	7	7	62	94
K.QTSPPFGLEAGTVFELKEEGHK.I	Y	55.92	2400.1960	22	-0.1	1201.1052	2	109.71	3	62337	20190523-10-H3.raw	7.15E8	8	8	253	274
K.IIGFHGSAGGNLNSLGAYY(sub F)APLTTTTPLTPAK.Q	Y	55.78	3202.6663	32	1.0	1068.5637	3	130.31	3	81192	20190523-10-H3.raw	1.15E7	1	1	122	153
K.FVYDKSPEEVTGEEHGK.S	N	55.21	1949.9006	17	0.5	975.9581	2	73.24	3	31105	20190523-10-H3.raw	1.01E9	6	6	191	207
K.GRVLPADPFVINHPDEHLVSVEGWYSPEGIIQGIK.F	Y	53.95	3867.9946	35	1.7	968.0076	4	133.99	3	84624	20190523-10-H3.raw	1.6E8	5	5	60	94
K.GANLWDDGSTHDAVTK.I	Y	53.25	1685.7645	16	0.7	843.8901	2	80.95	3	37516	20190523-10-H3.raw	1.9E9	6	6	12	27
K.STLLGFEEFVLDYPSEYITAVDGTYDK.I	Y	52.54	3071.4539	27	0.1	1024.8253	3	156.77	3	105795	20190523-10-H3.raw	3.16E7	2	2	208	234
K.IIGY(sub F)HGSAGGNLNSLGAYFAPLTTTTPLTPAK.Q	Y	52.18	3202.6663	32	1.8	1068.5646	3	134.37	3	84970	20190523-10-H3.raw	1.62E7	1	1	122	153
K.KVYVGQAQDGISAVK.F	N	52.10	1561.8463	15	1.5	781.9316	2	74.56	3	32153	20190523-10-H3.raw	5.98E8	4	4	176	190
K.IGVHVRPLSN	Y	49.58	1090.6248	10	0.2	546.3198	2	72.83	3	30760	20190523-10-H3.raw	1.44E9	6	6	289	298
A.KQLTAFGSDDGTVWDDGAYVGVK.K	Y	49.14	2428.1545	23	0.5	810.3925	3	111.98	3	64390	20190523-10-H3.raw	9.1E7	4	4	153	175
K.KIIGFHGSAGGNLNSLGAYFAPLTTTTPLTPAK.Q	Y	48.75	3314.7661	33	-1.5	1105.9276	3	127.36	3	78513	20190523-10-H3.raw	7.99E5	1	1	121	153
K.VEAQGGKGANLWDDGSTHDAVTK.I	Y	48.58	2355.1091	23	3.0	786.0460	3	75.69	3	33118	20190523-10-H3.raw	3.87E7	3	3	5	27
F.HGSAGGNLNSLGAYFAPLTTTTPLTPAK.Q	Y	47.36	2756.4133	28	0.3	1379.2144	2	127.48	3	78627	20190523-10-H3.raw	2.38E7	2	2	126	153
N.SLGAYFAPLTTTTPLTPAK.Q	Y	47.00	1949.0509	19	1.0	975.5337	2	128.29	3	79371	20190523-10-H3.raw	8.72E6	1	1	135	153
K.KTSDVIGSDEGTHFTLQVK.D	Y	46.04	2061.0378	19	4.5	1031.5309	2	88.88	3	44215	20190523-10-H3.raw	2.43E7	3	3	100	118
K.QLTAY(sub F)GSDDGTVWDDGAYVGVK.K	Y	46.00	2316.0547	22	-0.7	1159.0338	2	118.74	3	70559	20190523-10-H3.raw	6E5	2	2	154	175
K.VYVGQAQDGISAVK.F	N	44.95	1433.7515	14	0.3	717.8832	2	83.56	3	39735	20190523-10-H3.raw	1.9E9	6	6	177	190
K.IFGSDGSVITMLR.F	N	42.11	1394.7228	13	0.3	465.9150	3	122.18	3	73692	20190523-10-H3.raw	7.84E8	4	4	235	247
D.PFVINHPDEHLVSVEGWYSPEGIIQGIK.F	Y	40.97	3159.6028	28	0.5	790.9084	4	131.76	3	82548	20190523-10-H3.raw	1.75E7	1	1	67	94
R.ADVLLHKIGVHVRPLSN	Y	39.77	1867.0791	17	-0.3	467.7769	4	88.90	3	44239	20190523-10-H3.raw	4.65E6	1	1	282	298
Y.FAPLTTTTPLTPAK.Q	Y	39.53	1457.8130	14	2.0	729.9152	2	101.79	3	55265	20190523-10-H3.raw	4.81E7	2	2	140	153
K.IIGFHGSAGGNLNSLGAY.F	Y	37.99	1746.8689	18	0.1	874.4418	2	111.23	3	63713	20190523-10-H3.raw	2.25E7	2	2	122	139
K.SPEEVTGEEHGK.S	N	37.46	1297.5786	12	-1.4	433.5329	3	51.80	3	14116	20190523-10-H3.raw	1.65E7	1	1	196	207
K.NGQPEQAPLRGTK.G	Y	36.95	1394.7266	13	1.3	465.9167	3	55.39	3	16587	20190523-10-H3.raw	4.25E7	2	2	47	59
R.VLPADPFVINHPDEHLVSVEGWYSPEGIIQGIKFISNKK.T	Y	34.33	4372.2896	39	0.0	729.7222	6	143.04	3	93030	20190523-10-H3.raw	2.02E7	2	2	62	100
K.IQLAAGIDGIQYVQY(sub F)DF(sub Y)VK.N	Y	33.34	2140.1204	19	1.6	714.3818	3	158.83	3	107711	20190523-10-H3.raw	8.77E6	4	4	28	46
K.NGQPEQAPLR.G	Y	32.62	1108.5625	10	0.1	555.2886	2	60.26	3	20574	20190523-10-H3.raw	3.78E8	2	2	47	56
R.VLPADPY(sub F)VINHPDEHLVSVEGWYSPEGIIQGIK.F	Y	32.23	3670.8669	33	3.0	918.7268	4	137.26	3	87675	20190523-10-H3.raw	2.96E7	3	3	62	94
K.TSDVIGSDEGTHFTLQVKDK.K	Y	32.15	2176.0647	20	5.4	726.3661	3	88.80	3	44144	20190523-10-H3.raw	4.95E5	1	1	101	120
K.TSDVIGSDEGTHF.T	Y	30.88	1363.5891	13	1.4	682.8028	2	88.25	3	43672	20190523-10-H3.raw	8.76E5	1	1	101	113
K.GANLWDDGSTHDAVTKIQLAAGIDGIQYVQFDYVKNGQPEQAPLR.G	Y	30.32	4898.4263	45	3.6	980.6960	5	134.67	3	85257	20190523-10-H3.raw	0	1	1	12	56
T.AFGSDDGTVWDDGAYVGVK.K	Y	28.77	1957.8694	19	-3.2	979.9388	2	116.03	3	68043	20190523-10-H3.raw	2.68E5	1	1	157	175
K.TSDVIGSDEGTHFTLQVKDKKIIGY(sub F)HGSAGGNLNSLGAF(sub Y)FAPLTTTTPLTPAK.Q	Y	28.19	5472.8203	53	1.3	913.1452	6	126.18	3	77437	20190523-10-H3.raw	3.03E6	1	1	101	153
R.ADVLLHK.I	Y	26.19	794.4650	7	0.1	398.2398	2	58.96	3	19564	20190523-10-H3.raw	1.48E7	2	2	282	288
H.LVSVEGWYSPEGIIQGIK.F	Y	25.33	1974.0461	18	3.9	988.0342	2	136.70	3	87149	20190523-10-H3.raw	9.53E5	1	1	77	94
L.TTTTPLTPAK.Q	Y	24.19	1029.5706	10	0.3	515.7927	2	63.21	3	22930	20190523-10-H3.raw	7.97E6	1	1	144	153
F.GSDDGTVWDDGAYVGVK.K	Y	22.18	1739.7638	17	-0.9	870.8884	2	105.29	3	58414	20190523-10-H3.raw	2.15E7	1	1	159	175
N.LWDDGSTHDAVTK.I	Y	21.06	1443.6630	13	0.9	482.2287	3	72.67	3	30638	20190523-10-H3.raw	7.31E6	1	1	15	27
K.TSDVIGSDEGTHY(sub F)TLQVK.D	Y	20.77	1948.9377	18	-1.9	975.4743	2	91.68	3	46572	20190523-10-H3.raw	3.11E5	1	1	101	118
F.VLDYPSEYITAVDGTYDK.I	Y	20.14	2047.9625	18	8.5	1024.9972	2	122.07	3	73586	20190523-10-H3.raw	0	1	1	217	234
total 48 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
R.THKPLSVELGPGILGNIFDGIQRPLK.T	Y	58.70	2798.5806	26	1.7	933.8690	3	128.88	3	79917	20190523-10-H3.raw	2.42E8	6	6	85	110
K.VSGPVVVADGMAGAAMYELVR.V	Y	57.37	2091.0493	21	0.0	698.0237	3	140.98	3	91114	20190523-10-H3.raw	7.74E7	4	4	27	47
R.GNEMAEVLMDFPQLTMTLPDGR.E	Y	57.31	2464.1436	22	0.1	1233.0792	2	154.19	3	103356	20190523-10-H3.raw	2.22E7	2	2	283	304
R.GVSVPALDKDC(+57.02)LWEFQPNK.F	Y	56.61	2202.0779	19	1.6	1102.0480	2	118.54	3	70372	20190523-10-H3.raw	1.59E8	4	4	124	142	Carbamidomethylation
K.LLREDYLAQNAFTPYDKFC(+57.02)PFYK.S	Y	56.57	2898.4050	23	1.2	725.6094	4	123.15	3	74592	20190523-10-H3.raw	4.33E7	1	1	517	539	Carbamidomethylation
R.EDYLAQNAFTPYDKFC(+57.02)PFYK.S	Y	56.06	2516.1357	20	0.1	839.7193	3	126.40	3	77646	20190523-10-H3.raw	1.94E7	3	3	520	539	Carbamidomethylation
R.VLDALFPSVLGGTC(+57.02)AIPGAFGC(+57.02)GK.T	Y	55.50	2406.2075	24	-0.1	803.0764	3	148.01	3	97581	20190523-10-H3.raw	1.92E8	4	4	235	258	Carbamidomethylation
R.LVSQKFEDPAEGEDTLVEK.F	Y	55.36	2133.0476	19	0.3	712.0234	3	91.94	3	46794	20190523-10-H3.raw	6.38E7	4	4	585	603
R.LEGDSATIQVYEETAGLTVNDPVLR.T	Y	55.06	2689.3445	25	0.1	897.4556	3	135.16	3	85718	20190523-10-H3.raw	3.92E7	3	3	60	84
R.EVLQREDDLNEIVQLVGKDALAEGDKITLETAK.L	Y	53.86	3651.9207	33	0.1	731.3915	5	141.89	3	91963	20190523-10-H3.raw	6.38E7	2	2	484	516
K.YSNSDAVVYVGC(+57.02)GER.G	Y	53.47	1674.7307	15	0.2	838.3728	2	85.91	3	41666	20190523-10-H3.raw	6.54E7	3	3	268	282	Carbamidomethylation
R.LAEMPADSGYPAYLAAR.L	Y	53.38	1794.8610	17	0.3	898.4380	2	108.47	3	61243	20190523-10-H3.raw	1.72E8	2	2	368	384
K.FVEGDTITGGDLYATVFENTLMNHLVALPPDAMGK.I	Y	53.14	3735.8164	35	5.8	1246.2866	3	154.59	3	103730	20190523-10-H3.raw	1.03E8	3	3	143	177
K.YSTALESFYEKFDPDFINIR.T	Y	52.17	2454.1743	20	-3.1	1228.0906	2	140.88	3	91023	20190523-10-H3.raw	6.75E7	2	2	460	479
R.THKPLSVELGPGILGNIFDGIQR.P	Y	52.16	2460.3489	23	1.0	821.1244	3	131.47	3	82276	20190523-10-H3.raw	6.74E7	4	4	85	107
K.LTTFEDDEKESEYGYVR.K	Y	51.84	2079.9272	17	1.0	694.3171	3	91.62	3	46514	20190523-10-H3.raw	7.96E7	2	2	9	25
R.EDYLAQNAFTPYDK.F	Y	51.56	1673.7573	14	1.7	837.8873	2	107.40	3	60287	20190523-10-H3.raw	4.02E7	2	2	520	533
K.ITYIAPAGQYSLKDTVIELEFQGIK.K	Y	49.85	2796.4949	25	1.2	933.1733	3	136.13	3	86622	20190523-10-H3.raw	9.07E6	1	1	178	202
R.EDDLNEIVQLVGKDALAEGDKITLETAK.L	Y	49.65	3026.5659	28	-0.3	757.6486	4	148.15	3	97710	20190523-10-H3.raw	3.01E7	3	3	489	516
R.EDDLNEIVQLVGK.D	Y	49.47	1470.7566	13	-0.3	736.3853	2	130.99	3	81834	20190523-10-H3.raw	7.34E7	2	2	489	501
K.FEDPAEGEDTLVEK.F	Y	49.35	1577.7096	14	0.8	789.8627	2	92.84	3	47561	20190523-10-H3.raw	1.11E8	2	2	590	603
R.GNEMAEVLMDFPQLTMTLPDGREESVMK.R	Y	48.96	3167.4646	28	1.9	1056.8308	3	150.07	3	99485	20190523-10-H3.raw	2.92E7	3	3	283	310
K.LLREDYLAQNAFTPYDK.F	Y	48.60	2056.0264	17	2.1	686.3508	3	106.56	3	59562	20190523-10-H3.raw	4.54E7	2	2	517	533
R.EVLQREDDLNEIVQLVGK.D	Y	47.97	2096.1113	18	0.6	699.7115	3	123.54	3	74955	20190523-10-H3.raw	4.76E7	1	1	484	501
R.GNEMAEVLMDFPQLTMTLPDGREESVMKR.T	Y	47.65	3323.5659	29	0.5	831.8992	4	141.55	3	91648	20190523-10-H3.raw	4.57E7	3	3	283	311
R.VGHDNLIGEIIR.L	Y	47.61	1334.7306	12	2.5	668.3742	2	99.52	3	53323	20190523-10-H3.raw	2.28E8	3	3	48	59
K.ITYIAPAGQYSLKDTVIELEFQGIKK.S	Y	47.23	2924.5898	26	0.1	732.1548	4	126.38	3	77628	20190523-10-H3.raw	4.13E7	3	3	178	203
R.NIIHFYNLANQAVER.A	Y	46.33	1800.9271	15	0.5	901.4713	2	105.28	3	58405	20190523-10-H3.raw	2.01E8	4	4	546	560
R.DMGYNVSMMADSTSR.W	Y	46.28	1663.6641	15	2.2	832.8411	2	103.85	3	57140	20190523-10-H3.raw	3.74E7	5	5	342	356
R.KHFPSVNWLISYSK.Y	Y	45.64	1704.8987	14	2.2	569.3081	3	103.10	3	56454	20190523-10-H3.raw	3.41E7	3	3	446	459
R.TTLVANTSNMPVAAR.E	Y	45.62	1544.7981	15	0.9	773.4070	2	87.40	3	42928	20190523-10-H3.raw	1.63E8	3	3	312	326
K.LAADTPLLTGQR.V	Y	45.00	1254.6931	12	0.0	628.3538	2	89.60	3	44827	20190523-10-H3.raw	1.94E8	5	5	223	234
K.HFPSVNWLISYSK.Y	Y	44.28	1576.8038	13	-0.3	526.6084	3	118.31	3	70155	20190523-10-H3.raw	4.25E7	3	3	447	459
K.SYTMLQSWPVR.T	Y	42.50	1366.6704	11	0.5	684.3428	2	111.84	3	64263	20190523-10-H3.raw	1.13E8	2	2	204	214
R.LAEM(+15.99)PADSGYPAYLAAR.L	Y	42.40	1810.8560	17	2.8	906.4378	2	99.15	3	52999	20190523-10-H3.raw	3.58E6	2	2	368	384	Oxidation (M)
K.YSTALESFYEK.F	Y	41.78	1336.6187	11	1.1	669.3173	2	100.05	3	53767	20190523-10-H3.raw	5.22E7	2	2	460	470
K.LTTFEDDEKESEYGYVRK.V	Y	40.83	2208.0222	18	0.6	553.0132	4	82.14	3	38562	20190523-10-H3.raw	1.31E7	1	1	9	26
R.KVSGPVVVADGMAGAAMYELVR.V	Y	40.36	2219.1443	22	3.9	740.7249	3	127.36	3	78517	20190523-10-H3.raw	0	2	2	26	47
K.DALAEGDKITLETAK.L	Y	40.17	1573.8198	15	1.2	787.9182	2	88.26	3	43685	20190523-10-H3.raw	9.08E7	3	3	502	516
K.DTVIELEFQGIKK.S	Y	39.15	1518.8293	13	0.2	507.2838	3	107.05	3	59974	20190523-10-H3.raw	2.16E7	1	1	191	203
L.SVELGPGILGNIFDGIQRPLK.T	Y	38.49	2222.2422	21	0.4	741.7549	3	141.84	3	91921	20190523-10-H3.raw	2.69E6	1	1	90	110
K.DTVIELEFQGIK.K	Y	38.37	1390.7344	12	0.7	696.3749	2	123.32	3	74751	20190523-10-H3.raw	9.09E6	1	1	191	202
R.GVSVPALDKDC(+57.02)LWEFQPNKFVEGDTITGGDLYATVFENTLMNHLVALPPDAMGK.I	Y	37.81	5919.8838	54	1.1	1184.9854	5	153.82	3	102997	20190523-10-H3.raw	1.27E7	1	1	124	177	Carbamidomethylation
K.ITYIAPAGQYSLK.D	Y	37.44	1423.7711	13	1.3	712.8937	2	98.82	3	52703	20190523-10-H3.raw	9.81E7	2	2	178	190
K.LYDDLNAGFR.A	Y	35.91	1182.5669	10	1.0	592.2913	2	97.79	3	51797	20190523-10-H3.raw	4.4E7	2	2	607	616
R.ISGDVYIPR.G	Y	35.81	1018.5447	9	0.0	510.2796	2	85.78	3	41564	20190523-10-H3.raw	1.66E8	2	2	115	123
K.KSYTMLQSWPVR.T	Y	33.55	1494.7653	12	-0.4	499.2622	3	96.05	3	50361	20190523-10-H3.raw	2.38E6	1	1	203	214
K.FVEGDTITGGDLYATVFENTLMNHLVALPPDAM(+15.99)GK.I	Y	31.67	3751.8113	35	5.0	1251.6173	3	153.59	3	102778	20190523-10-H3.raw	1.82E7	1	1	143	177	Oxidation (M)
K.DC(+57.02)LWEFQPNK.F	Y	29.84	1335.5918	10	0.3	668.8033	2	109.49	3	62137	20190523-10-H3.raw	6.21E6	1	1	133	142	Carbamidomethylation
K.TVISQALSK.Y	Y	29.15	945.5495	9	1.1	473.7825	2	77.04	3	34231	20190523-10-H3.raw	1.65E8	2	2	259	267
K.LTTFEDDEK.E	Y	29.07	1096.4924	9	0.0	549.2535	2	70.46	3	28814	20190523-10-H3.raw	6.35E6	2	2	9	17
R.TTLVANTSNM(+15.99)PVAAR.E	Y	28.71	1560.7930	15	-1.7	781.4025	2	73.69	3	31456	20190523-10-H3.raw	2.16E6	1	1	312	326	Oxidation (M)
K.ESEYGYVR.K	Y	27.59	1001.4454	8	0.5	501.7302	2	67.56	3	26512	20190523-10-H3.raw	2.25E6	1	1	18	25
K.FVEGDTITGGDLYATVY(sub F)ENTLMNHLVALPPDAMGK.I	Y	27.54	3751.8113	35	2.8	1251.6145	3	152.52	3	101759	20190523-10-H3.raw	6.87E5	1	1	143	177
K.ITYTLIK.H	Y	27.24	850.5164	7	-0.1	426.2654	2	86.33	3	42019	20190523-10-H3.raw	1.38E8	3	3	569	575
R.NGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKK.L	Y	25.72	3844.9885	38	2.7	1282.6736	3	156.86	3	105881	20190523-10-H3.raw	2.17E6	1	1	404	441
R.LGDLFYR.L	Y	25.52	882.4599	7	-0.5	442.2370	2	96.23	3	50537	20190523-10-H3.raw	7.77E7	1	1	578	584
R.EASIYTGITIAEYFR.D	Y	24.41	1732.8672	15	-4.2	867.4373	2	140.48	3	90651	20190523-10-H3.raw	0	1	1	327	341
R.LASFYER.A	Y	23.94	884.4392	7	1.3	443.2274	2	76.47	3	33792	20190523-10-H3.raw	1.21E8	1	1	385	391
K.HFPSVNWLISY.S	Y	21.17	1361.6768	11	0.5	681.8460	2	135.55	3	86082	20190523-10-H3.raw	3.52E6	1	1	447	457
total 60 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
R.DGNEYLINLIDSPGHVDFSSEVTAALR.I	Y	59.24	2931.4250	27	1.5	978.1504	3	151.05	3	100386	20190523-10-H3.raw	3.84E7	5	5	94	120
R.LLEPVYMVEIQAPEGALGGIYSVLNQK.R	Y	58.79	2930.5461	27	0.4	1466.2810	2	154.34	3	103493	20190523-10-H3.raw	4.55E7	2	2	725	751
R.VIENANVIMATYEDPLLGDVQVYPEK.G	Y	57.91	2919.4575	26	1.8	974.1615	3	142.72	3	92729	20190523-10-H3.raw	2.71E7	4	4	181	206
R.VMQTWLPASTALLEMMIFHLPSPHTAQR.Y	Y	57.53	3205.6238	28	0.8	802.4139	4	153.74	3	102925	20190523-10-H3.raw	3.65E7	1	1	321	348
R.LYMEARPMEEGLAEAIDDGR.I	Y	57.51	2265.0405	20	1.9	756.0222	3	116.85	3	68792	20190523-10-H3.raw	4.22E7	2	2	587	606
R.YRVENLYEGPLDDQYANAIR.N	Y	56.07	2398.1553	20	0.6	800.3929	3	111.26	3	63737	20190523-10-H3.raw	6.29E7	4	4	349	368
K.IWAFGPETTGPNMVVDMC(+57.02)K.G	Y	55.39	2151.9792	19	1.9	1076.9989	2	131.40	3	82212	20190523-10-H3.raw	3.98E7	3	3	634	652	Carbamidomethylation
K.RQETVEDVPC(+57.02)GNTVAMVGLDQFITK.N	Y	55.02	2806.3630	25	-0.9	936.4608	3	124.05	3	75436	20190523-10-H3.raw	3.98E7	3	3	439	463	Carbamidomethylation
K.GVQYLNEIKDSVVAGFQWASK.E	Y	54.06	2338.1958	21	2.1	780.4075	3	139.75	3	89957	20190523-10-H3.raw	1.9E7	1	1	653	673
R.VENLYEGPLDDQYANAIR.N	Y	53.90	2078.9907	18	0.3	1040.5029	2	114.27	3	66469	20190523-10-H3.raw	4.85E7	3	3	351	368
R.GHVFEEMQRPGTPLYNIK.A	Y	52.12	2115.0571	18	0.0	1058.5359	2	92.99	3	47689	20190523-10-H3.raw	6.54E7	4	4	753	770
K.AYLPVVESFGFSSQLR.A	Y	51.66	1798.9253	16	0.6	600.6494	3	134.33	3	84934	20190523-10-H3.raw	8.44E7	4	4	771	786
K.GTVAFSAGLHGWAFTLTNFAK.M	Y	51.46	2195.1162	21	-0.3	732.7125	3	135.63	3	86153	20190523-10-H3.raw	7.39E6	1	1	207	227
K.KIWAFGPETTGPNMVVDMC(+57.02)K.G	Y	51.36	2280.0742	20	-0.6	761.0316	3	117.92	3	69782	20190523-10-H3.raw	1.53E7	2	2	633	652	Carbamidomethylation
R.LLEPVYMVEIQAPEGALGGIYSVLNQKR.G	Y	49.07	3086.6475	28	6.9	1029.8969	3	151.46	3	100757	20190523-10-H3.raw	1.11E7	1	1	725	752
K.STGISLYYEMTDESLK.S	Y	48.27	1835.8499	16	1.6	918.9337	2	121.42	3	72981	20190523-10-H3.raw	1.94E7	3	3	72	87
R.VMQTWLPASTALLEMMIFHLPSPH.T	Y	48.26	2749.3794	24	1.4	917.4683	3	156.76	3	105792	20190523-10-H3.raw	7.86E6	1	1	321	344
K.NATLTNEKEVDAHPIR.A	Y	46.95	1806.9224	16	2.1	603.3160	3	66.45	3	25563	20190523-10-H3.raw	4.62E7	2	2	464	479
K.QIIATC(+57.02)MNDQKDKLWPMLAK.L	Y	45.82	2403.2112	20	0.6	601.8104	4	108.48	3	61259	20190523-10-H3.raw	3.25E7	1	1	281	300	Carbamidomethylation
K.DLQDDFMGGAEIIK.S	Y	45.53	1550.7286	14	0.3	776.3718	2	126.50	3	77740	20190523-10-H3.raw	4.23E7	1	1	544	557
K.QIIATC(+57.02)MNDQK.D	Y	44.42	1320.6166	11	-0.1	661.3155	2	73.39	3	31218	20190523-10-H3.raw	2.22E7	2	2	281	291	Carbamidomethylation
R.PMEEGLAEAIDDGR.I	Y	44.35	1501.6719	14	1.3	751.8442	2	101.52	3	55023	20190523-10-H3.raw	3.76E7	1	1	593	606
R.NC(+57.02)DPNGPLMLYVSK.M	Y	43.72	1606.7483	14	2.3	804.3832	2	107.44	3	60329	20190523-10-H3.raw	8.14E7	2	2	369	382	Carbamidomethylation
K.ILAEEFGWDKDLAK.K	Y	43.17	1633.8351	14	0.0	545.6190	3	108.94	3	61640	20190523-10-H3.raw	6.04E7	2	2	619	632
K.STLTDSLVAAAGIIAQEVAGDVR.M	Y	42.83	2256.1960	23	3.7	1129.1095	2	158.57	3	107476	20190523-10-H3.raw	6.6E7	4	4	33	55
R.LWGENFFDPATR.K	Y	42.66	1451.6833	12	-0.2	726.8488	2	126.35	3	77597	20190523-10-H3.raw	3.58E7	2	2	244	255
R.LLEPVYM(+15.99)VEIQAPEGALGGIYSVLNQK.R	Y	40.75	2946.5413	27	2.4	983.1901	3	152.19	3	101447	20190523-10-H3.raw	3.81E6	1	1	725	751	Oxidation (M)
R.NMSVIAHVDHGK.S	Y	40.47	1306.6451	12	0.6	654.3303	2	61.40	3	21510	20190523-10-H3.raw	5.73E7	3	3	21	32
R.C(+57.02)FLELQVDGEEAYQTFSR.V	Y	40.13	2190.9890	18	-1.2	1096.5005	2	133.34	3	84018	20190523-10-H3.raw	4.96E5	1	1	163	180	Carbamidomethylation
K.EAMTPLSEFEDKL	Y	39.80	1508.7068	13	-1.4	755.3596	2	127.49	3	78635	20190523-10-H3.raw	4.6E7	3	3	831	843
K.RGHVFEEMQRPGTPLYNIK.A	Y	39.47	2271.1582	19	-0.5	568.7966	4	87.08	3	42667	20190523-10-H3.raw	2.12E7	1	1	752	770
K.EAMTPLSEFEDK.L	Y	38.73	1395.6228	12	1.7	698.8199	2	105.81	3	58873	20190523-10-H3.raw	7.2E6	1	1	831	842
R.GFVQFC(+57.02)YEPIK.Q	Y	38.17	1386.6642	11	0.2	694.3395	2	112.09	3	64490	20190523-10-H3.raw	5.95E7	2	2	270	280	Carbamidomethylation
R.QETVEDVPC(+57.02)GNTVAMVGLDQFITK.N	Y	37.37	2650.2617	24	-4.1	884.4242	3	134.32	3	84927	20190523-10-H3.raw	4.89E6	2	2	440	463	Carbamidomethylation
K.ILAEEFGWDK.D	Y	37.35	1206.5920	10	0.0	604.3033	2	109.30	3	61954	20190523-10-H3.raw	2.35E7	1	1	619	628
R.RVIYASQITAKPR.L	Y	37.21	1501.8728	13	1.5	501.6323	3	65.39	3	24698	20190523-10-H3.raw	7.09E6	1	1	712	724
R.VIYASQITAKPR.L	Y	36.59	1345.7717	12	0.0	449.5979	3	72.33	3	30348	20190523-10-H3.raw	5.58E7	2	2	713	724
R.IMGPNYIPGEK.K	Y	36.12	1217.6115	11	-0.5	609.8127	2	89.05	3	44376	20190523-10-H3.raw	3.76E7	1	1	411	421
R.ITDGALVVVDC(+57.02)IEGVC(+57.02)VQTETVLR.Q	Y	35.57	2645.3403	24	1.3	882.7886	3	149.65	3	99104	20190523-10-H3.raw	7.16E5	1	1	121	144	Carbamidomethylation
K.QIIATC(+57.02)MNDQKDK.L	Y	33.97	1563.7385	13	-0.9	522.2530	3	66.02	3	25195	20190523-10-H3.raw	1.48E7	3	3	281	293	Carbamidomethylation
R.GGGQVIPTAR.R	Y	33.38	954.5247	10	0.1	478.2697	2	64.82	3	24237	20190523-10-H3.raw	3.47E7	1	1	702	711
K.FSVSPVVR.V	Y	31.35	889.5021	8	0.3	445.7585	2	83.79	3	39939	20190523-10-H3.raw	8.52E7	2	2	483	490
R.IRPVLTVNK.M	Y	31.05	1038.6549	9	0.3	520.3349	2	67.38	3	26378	20190523-10-H3.raw	5.6E6	1	1	151	159
K.RGFVQFC(+57.02)YEPIK.Q	Y	30.31	1542.7653	12	-0.7	515.2620	3	98.92	3	52788	20190523-10-H3.raw	7.2E6	1	1	269	280	Carbamidomethylation
R.LWGENFFDPATRK.W	Y	30.30	1579.7783	13	0.3	527.6002	3	111.27	3	63752	20190523-10-H3.raw	1.94E7	1	1	244	256
K.ELMGKPLMK.R	Y	29.82	1045.5664	9	0.6	349.5296	3	71.92	3	29991	20190523-10-H3.raw	1.01E7	1	1	311	319
K.ILAEEFGWDKDLAKK.I	Y	29.15	1761.9301	15	1.0	441.4902	4	98.55	3	52462	20190523-10-H3.raw	1.95E7	1	1	619	633
K.DKLWPMLAK.L	Y	28.23	1100.6052	9	0.5	367.8759	3	98.97	3	52840	20190523-10-H3.raw	9.11E6	2	2	292	300
R.TVIWMGK.R	Y	27.94	833.4470	7	0.5	417.7310	2	86.89	3	42497	20190523-10-H3.raw	4.4E7	1	1	432	438
K.GVQYLNEIK.D	Y	27.93	1062.5709	9	2.6	532.2941	2	85.45	3	41302	20190523-10-H3.raw	2.31E7	1	1	653	661
R.PGTPLYNIK.A	Y	27.79	1001.5546	9	0.7	501.7849	2	81.15	3	37685	20190523-10-H3.raw	5.24E6	1	1	762	770
R.SKILAEEFGWDKDLAK.K	Y	27.74	1848.9620	16	0.0	463.2478	4	101.46	3	54971	20190523-10-H3.raw	3.21E6	1	1	617	632
R.IRPVLTVNKMDR.C	Y	27.28	1440.8235	12	1.1	361.2135	4	70.83	3	29116	20190523-10-H3.raw	1.34E6	1	1	151	162
K.GLKEAMTPLSEFEDKL	Y	26.71	1806.9073	16	6.0	603.3134	3	122.24	3	73743	20190523-10-H3.raw	4.14E6	1	1	828	843
K.FGVVESK.M	Y	26.49	764.4068	7	-0.4	383.2105	2	64.71	3	24159	20190523-10-H3.raw	6.82E6	1	1	233	239
K.FTADELRR.I	Y	26.36	1006.5195	8	0.6	336.5140	3	67.34	3	26345	20190523-10-H3.raw	1.05E7	1	1	4	11
K.DLQDDFM(+15.99)GGAEIIK.S	Y	25.91	1566.7235	14	0.6	784.3695	2	113.86	3	66093	20190523-10-H3.raw	2.39E5	1	1	544	557	Oxidation (M)
R.IMGPNYIPGEKK.D	Y	25.84	1345.7064	12	0.1	449.5761	3	77.05	3	34242	20190523-10-H3.raw	2.69E7	1	1	411	422
R.IMDYKHNIR.N	Y	25.18	1188.6073	9	-2.1	397.2089	3	60.42	3	20717	20190523-10-H3.raw	1.28E6	1	1	12	20
R.AATSGQAFPQC(+57.02)VFDHWEMMSSDPLEPGTQASVLVADIR.K	Y	25.05	4147.9077	38	4.9	1383.6500	3	151.90	3	101173	20190523-10-H3.raw	0	2	2	787	824	Carbamidomethylation
R.NMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVR.M	Y	24.77	3544.8308	35	4.0	887.2185	4	149.53	3	98993	20190523-10-H3.raw	3.59E5	1	1	21	55
K.SDPMVVC(+57.02)TMEESGEHIVAGAGELHLEIC(+57.02)LK.D	Y	23.79	3310.5342	30	1.9	1104.5208	3	138.49	3	88824	20190523-10-H3.raw	0	1	1	514	543	Carbamidomethylation
R.VIYASQITAK.P	Y	23.71	1092.6179	10	-2.0	547.3151	2	77.13	3	34304	20190523-10-H3.raw	2.06E7	1	1	713	722
K.FTADELR.R	Y	23.35	850.4185	7	0.8	426.2168	2	75.23	3	32727	20190523-10-H3.raw	1.42E7	1	1	4	10
M.VKFTADELR.R	Y	23.10	1077.5818	9	-1.2	360.2008	3	75.25	3	32742	20190523-10-H3.raw	5.41E6	1	1	2	10
K.NDEKELMGKPLMK.R	Y	22.43	1531.7738	13	-4.1	766.8911	2	72.60	3	30580	20190523-10-H3.raw	1.08E6	2	2	307	319
R.GFVQY(sub F)C(+57.02)F(sub Y)EPIKQIIATC(+57.02)MNDQK.D	Y	21.34	2689.2703	22	1.7	897.4322	3	134.21	3	84820	20190523-10-H3.raw	9.76E5	1	1	270	291	Carbamidomethylation
K.SDPVVSFR.E	Y	20.80	905.4606	8	-1.3	453.7370	2	80.19	3	36854	20190523-10-H3.raw	5.49E7	1	1	558	565
total 68 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
R.ENGSLFDVAHMC(+57.02)GLSLK.G	Y	63.06	1876.8811	17	1.4	939.4491	2	121.14	3	72728	20190523-10-H3.raw	7.2E8	4	4	77	93	Carbamidomethylation
R.LEAGLC(+57.02)LYGNDMEQHISPVEAGLTWAIGKR.R	Y	61.11	3327.6379	30	0.6	832.9172	4	134.56	3	85148	20190523-10-H3.raw	6.83E7	3	3	271	300	Carbamidomethylation
R.TGYTGEDGFEISVPDEHAVDLAK.A	Y	60.84	2449.1284	23	0.1	1225.5717	2	114.56	3	66734	20190523-10-H3.raw	8.61E8	9	9	226	248
R.LEAGLC(+57.02)LYGNDMEQHISPVEAGLTWAIGK.R	Y	60.16	3171.5369	29	-2.8	1058.1832	3	142.00	3	92074	20190523-10-H3.raw	1.55E8	7	7	271	299	Carbamidomethylation
K.MVPFAGWSMPIQYKDSIMDSTVNC(+57.02)R.E	Y	58.15	2932.3379	25	1.5	978.4547	3	134.69	3	85280	20190523-10-H3.raw	1.28E8	4	4	52	76	Carbamidomethylation
R.SLLALQGPLAAPVLQHLTKEDLSK.L	Y	57.93	2541.4529	24	2.3	636.3719	4	127.63	3	78756	20190523-10-H3.raw	4.7E7	2	2	182	205
K.LYFGNFQILDINGSTC(+57.02)FLTR.T	Y	57.28	2378.1729	20	1.9	1190.0959	2	152.42	3	101667	20190523-10-H3.raw	2.55E7	5	5	206	225	Carbamidomethylation
R.AEGGFLGADVILQQLK.D	Y	56.96	1657.9038	16	-0.6	829.9587	2	137.40	3	87810	20190523-10-H3.raw	4.82E8	5	5	303	318
R.SHSEVHDESGNKIGEITSGGFSPNLKK.N	Y	56.75	2853.3892	27	0.7	571.6855	5	79.76	3	36481	20190523-10-H3.raw	1.86E8	6	6	337	363
K.GKDC(+57.02)VPFLETLVVADVAGLAPGTGSLTVFTNEK.G	Y	54.88	3404.7537	33	3.0	1135.9286	3	154.25	3	103411	20190523-10-H3.raw	2.67E8	4	4	94	126	Carbamidomethylation
K.SKGGDVSWHIHDER.S	Y	54.52	1621.7596	14	3.1	811.8896	2	60.84	3	21091	20190523-10-H3.raw	8.7E7	3	3	168	181
R.RAEGGFLGADVILQQLKDGPTIR.R	Y	52.30	2453.3389	23	0.4	614.3422	4	127.35	3	78506	20190523-10-H3.raw	5.07E7	3	3	302	324
K.VTDEHIYLVVNAGC(+57.02)R.D	Y	51.31	1744.8567	15	1.0	873.4365	2	93.07	3	47761	20190523-10-H3.raw	2.23E8	4	4	138	152	Carbamidomethylation
K.MVPFAGWSMPIQYK.D	Y	51.29	1653.8047	14	0.1	827.9097	2	132.95	3	83658	20190523-10-H3.raw	3.23E8	4	4	52	65
R.AEGGFLGADVILQQLKDGPTIR.R	Y	50.97	2297.2378	22	-0.5	766.7528	3	137.23	3	87648	20190523-10-H3.raw	4.69E7	3	3	303	324
K.TALYDFHVAHGGK.M	Y	50.79	1414.6993	13	0.7	708.3574	2	75.70	3	33121	20190523-10-H3.raw	7.09E8	5	5	39	51
N.KIGEITSGGFSPNLK.K	Y	49.80	1546.8354	15	0.6	774.4255	2	89.03	3	44364	20190523-10-H3.raw	5.85E7	2	2	348	362
R.DKDLAHIEEHMK.A	Y	49.34	1464.7031	12	1.1	489.2422	3	66.83	3	25904	20190523-10-H3.raw	1.95E8	3	3	153	164
K.GKDC(+57.02)VPFLETLVVADVAGLAPGTGSLTVFTNEKGGAIDDSVITK.V	Y	49.25	4461.2988	44	4.1	1488.1130	3	152.96	3	102179	20190523-10-H3.raw	2.18E7	2	2	94	137	Carbamidomethylation
R.SLLALQGPLAAPVLQHLTK.E	Y	48.27	1969.1724	19	0.8	657.3986	3	128.82	3	79855	20190523-10-H3.raw	1.29E9	9	9	182	200
K.IGEITSGGFSPNLK.K	Y	47.15	1418.7405	14	0.5	710.3779	2	99.40	3	53225	20190523-10-H3.raw	2.32E8	3	3	349	362
K.IGEITSGGFSPNLKK.N	Y	47.13	1546.8354	15	1.0	516.6196	3	86.60	3	42243	20190523-10-H3.raw	3.84E8	4	4	349	363
R.RAEGGFLGADVILQQLK.D	Y	47.01	1814.0050	17	1.3	605.6764	3	123.83	3	75226	20190523-10-H3.raw	1.24E8	3	3	302	318
R.SHSEVHDESGNKIGEITSGGFSPNLK.K	Y	46.97	2725.2942	26	0.3	546.0663	5	87.11	3	42701	20190523-10-H3.raw	2.15E7	2	2	337	362
K.GGDVSWHIHDER.S	Y	46.34	1406.6327	12	0.4	704.3239	2	67.15	3	26171	20190523-10-H3.raw	1.58E8	6	6	170	181
R.RAEGGFLGADVILQQLKDGPTIRR.V	Y	45.98	2609.4402	24	-0.1	653.3672	4	117.99	3	69849	20190523-10-H3.raw	5.09E7	2	2	302	325
R.RVGFFSSGPPAR.S	Y	44.74	1276.6676	12	1.3	426.5637	3	77.83	3	34851	20190523-10-H3.raw	5.89E7	3	3	325	336
R.AEGGFLGADVILQQLKDGPTIRR.V	Y	42.72	2453.3389	23	0.8	614.3425	4	127.69	3	78809	20190523-10-H3.raw	1.95E7	1	1	303	325
K.DLAHIEEHMK.A	Y	41.83	1221.5812	10	3.0	611.7997	2	72.48	3	30477	20190523-10-H3.raw	3.36E7	3	3	155	164
K.DSIMDSTVNC(+57.02)R.E	Y	41.42	1296.5438	11	1.0	649.2798	2	81.52	3	38011	20190523-10-H3.raw	3.85E8	4	4	66	76	Carbamidomethylation
R.ENGSLFDVAHM(+15.99)C(+57.02)GLSLK.G	Y	41.34	1892.8761	17	0.2	947.4455	2	109.44	3	62085	20190523-10-H3.raw	2E7	3	3	77	93	Oxidation (M); Carbamidomethylation
R.RRAEGGFLGADVILQQLK.D	Y	40.57	1970.1061	18	0.5	657.7097	3	112.88	3	65205	20190523-10-H3.raw	3.45E7	3	3	301	318
R.VGFFSSGPPAR.S	Y	39.91	1120.5665	11	-0.2	561.2904	2	91.45	3	46374	20190523-10-H3.raw	5.59E8	3	3	326	336
K.KTALYDFHVAHGGK.M	Y	39.85	1542.7943	14	0.2	386.7059	4	66.73	3	25810	20190523-10-H3.raw	3.04E6	1	1	38	51
R.LEAGLC(+57.02)LYGNDM(+15.99)EQHISPVEAGLTWAIGK.R	Y	37.00	3187.5317	29	-9.8	1063.5074	3	136.94	3	87382	20190523-10-H3.raw	0	1	1	271	299	Carbamidomethylation; Oxidation (M)
K.GGAIDDSVITK.V	Y	35.31	1074.5557	11	0.8	538.2855	2	76.84	3	34106	20190523-10-H3.raw	3.88E8	2	2	127	137
K.M(+15.99)VPFAGWSMPIQYKDSIMDSTVNC(+57.02)R.E	Y	33.36	2948.3330	25	2.7	983.7876	3	130.42	3	81295	20190523-10-H3.raw	6.76E5	1	1	52	76	Oxidation (M); Carbamidomethylation
K.DSIM(+15.99)DSTVNC(+57.02)R.E	Y	32.70	1312.5388	11	2.3	657.2782	2	65.99	3	25174	20190523-10-H3.raw	7.37E6	2	2	66	76	Oxidation (M); Carbamidomethylation
K.M(+15.99)VPFAGWSMPIQYK.D	Y	32.01	1669.7997	14	3.8	835.9103	2	126.50	3	77741	20190523-10-H3.raw	3.84E6	1	1	52	65	Oxidation (M)
K.DC(+57.02)VPFLETLVVADVAGLAPGTGSLTVFTNEK.G	Y	30.93	3219.6372	31	2.8	805.9188	4	157.78	3	106740	20190523-10-H3.raw	3.23E6	1	1	96	126	Carbamidomethylation
F.AGWSMPIQYK.D	Y	30.15	1179.5747	10	1.5	1180.5837	1	103.95	3	57221	20190523-10-H3.raw	8.08E6	1	1	56	65
K.SKGGDVSWHIHDERSLLALQGPLAAPVLQHLTK.E	Y	29.02	3572.9214	33	0.3	596.4943	6	117.13	3	69057	20190523-10-H3.raw	7.77E5	1	1	168	200
K.NIAMGYVK.S	Y	28.35	894.4633	8	0.0	448.2390	2	78.50	3	35407	20190523-10-H3.raw	3.85E8	3	3	364	371
K.GGAIDDSVITKVTDEHIYLVVNAGC(+57.02)R.D	Y	27.97	2801.4019	26	-0.8	934.8071	3	122.86	3	74319	20190523-10-H3.raw	7.26E5	1	1	127	152	Carbamidomethylation
R.ENGSLFDVAH.M	Y	27.02	1087.4934	10	0.2	544.7541	2	94.09	3	48633	20190523-10-H3.raw	2E7	1	1	77	86
K.MPFVATK.Y	Y	26.99	792.4204	7	-0.2	397.2174	2	76.87	3	34124	20190523-10-H3.raw	3.97E8	2	2	397	403
R.GKPYEGSITK.M	Y	26.92	1078.5658	10	-0.3	360.5291	3	54.77	3	16152	20190523-10-H3.raw	6.32E6	1	1	387	396
R.SLLALQGPLAAPVLQHLTKEDLSKLYFGNFQILDINGSTC(+57.02)FLTR.T	Y	26.44	4901.6152	44	0.9	981.3312	5	153.52	3	102714	20190523-10-H3.raw	5.59E6	1	1	182	225	Carbamidomethylation
R.AEGGFLGADVILQQLKDGPTIRRVGFFSSGPPAR.S	Y	25.29	3555.8950	34	-0.1	712.1862	5	135.31	3	85850	20190523-10-H3.raw	1.03E6	1	1	303	336
K.MVPFAGWSM(+15.99)PIQYK.D	Y	25.10	1669.7997	14	-4.8	835.9031	2	121.04	3	72630	20190523-10-H3.raw	1.01E7	1	1	52	65	Oxidation (M)
R.RRAEGGFLGADVILQQLKDGPTIR.R	Y	22.98	2609.4402	24	-1.4	522.8946	5	118.60	3	70426	20190523-10-H3.raw	1.95E6	1	1	301	324
R.DKDLAHIEEH.M	Y	22.65	1205.5676	10	0.7	402.8634	3	60.71	3	20960	20190523-10-H3.raw	1.86E6	1	1	153	162
K.GGDVSWHIHDERSLLALQGPLAAPVLQHLTK.E	Y	21.76	3357.7944	31	-0.2	560.6396	6	123.25	3	74685	20190523-10-H3.raw	3.08E6	1	1	170	200
total 53 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
K.TPGHPENFETPGIEVTTGPLGQGIANAVGLALAEK.H	Y	66.13	3484.7837	35	1.7	1162.6038	3	149.03	3	98520	20190523-10-H3.raw	4.35E8	7	7	175	209
R.ISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHIASFR.A	Y	60.40	3946.9521	37	0.6	790.3982	5	136.11	3	86603	20190523-10-H3.raw	2.2E8	4	4	525	561
R.FVLSAGHGC(+57.02)M(+15.99)LLYALLHLAGYDSVQEEDLK.Q	Y	58.23	3364.6472	30	0.5	842.1695	4	152.79	3	102014	20190523-10-H3.raw	1.07E7	2	2	137	166	Carbamidomethylation; Oxidation (M)
K.SIGINSFGASAPAPLLYKEFGITVEAVVDAAK.S	Y	57.71	3234.7175	32	2.0	1079.2487	3	154.74	3	103877	20190523-10-H3.raw	1.64E7	1	1	707	738
K.SGHPGLPMGC(+57.02)APMAHILYDEVMR.Y	Y	56.65	2538.1641	23	0.0	635.5483	4	121.90	3	73428	20190523-10-H3.raw	1.36E8	4	4	101	123	Carbamidomethylation
R.FVLSAGHGC(+57.02)MLLYALLHLAGYDSVQEEDLK.Q	Y	56.59	3348.6521	30	-0.9	1117.2236	3	153.58	3	102772	20190523-10-H3.raw	3.12E6	1	1	137	166	Carbamidomethylation
K.VVPGFLGGSADLASSNMTLLK.A	Y	54.26	2076.0925	21	1.5	1039.0551	2	133.15	3	83837	20190523-10-H3.raw	2.24E8	4	4	447	467
K.SIGINSFGASAPAPLLYK.E	Y	54.11	1804.9723	18	2.1	903.4953	2	122.85	3	74314	20190523-10-H3.raw	1.52E8	3	3	707	724
R.FNKPDAEVVDHYTYAILGDGC(+57.02)QMEGISNEAC(+57.02)SLAGHWGLGK.L	Y	53.37	4509.0464	41	3.8	902.8199	5	139.55	3	89777	20190523-10-H3.raw	1.17E8	3	3	215	255	Carbamidomethylation
R.VVSFVC(+57.02)WELFDEQSDEYKESVLPSDVSAR.V	Y	52.68	3419.5867	29	-1.6	1140.8677	3	139.47	3	89696	20190523-10-H3.raw	4.02E6	1	1	658	686	Carbamidomethylation
R.NNLGWPYEPFQVPDDVK.S	Y	51.53	2016.9581	17	1.6	673.3277	3	131.46	3	82262	20190523-10-H3.raw	8.67E7	5	5	354	370
R.NNLGWPYEPFQVPDDVKSHWSR.H	Y	50.89	2670.2615	22	0.9	668.5732	4	121.44	3	73000	20190523-10-H3.raw	1.07E7	1	1	354	375
A.AAVETVEPTTDSSIVDKSVNSIR.F	Y	49.53	2417.2285	23	0.2	806.7502	3	99.73	3	53500	20190523-10-H3.raw	4.53E7	3	3	67	89
R.AMPNTLMFRPADGNETAGAYK.I	Y	48.74	2254.0510	21	1.2	752.3585	3	99.38	3	53208	20190523-10-H3.raw	1.79E8	4	4	562	582
K.VTTTIGYGSPNKANSYSVHGAALGEK.E	N	48.58	2621.3086	26	4.0	656.3370	4	81.90	3	38339	20190523-10-H3.raw	1.07E7	1	1	322	347
K.GGYTISDDSSGNKPDVILIGTGSELEIAAQAAEVLRK.D	Y	48.32	3773.9321	37	3.5	944.4936	4	140.75	3	90899	20190523-10-H3.raw	4.01E7	2	2	615	651
K.ANSYSVHGAALGEK.E	N	47.31	1402.6841	14	0.8	468.5690	3	66.14	3	25303	20190523-10-H3.raw	9.66E7	3	3	334	347
R.HTPEGATLESDWSAK.F	Y	47.26	1627.7478	15	1.3	814.8823	2	79.68	3	36405	20190523-10-H3.raw	1.35E8	4	4	376	390
K.ANSYSVHGAALGEKEVEATR.N	N	46.77	2088.0234	20	-0.4	697.0148	3	74.71	3	32286	20190523-10-H3.raw	8.7E6	2	2	334	353
R.EHGMGAIC(+57.02)NGIALHSPGLIPY.C	Y	45.97	2206.0664	21	-0.6	736.3623	3	117.86	3	69729	20190523-10-H3.raw	1.5E7	1	1	488	508	Carbamidomethylation
K.ALPTYTPESPGDATR.N	Y	45.82	1574.7576	15	1.4	788.3871	2	86.68	3	42314	20190523-10-H3.raw	1.92E8	2	2	420	434
R.VSIEAASTFGWGK.I	Y	45.76	1351.6771	13	-1.0	676.8452	2	110.20	3	62791	20190523-10-H3.raw	2.93E7	1	1	687	699
K.SGHPGLPMGC(+57.02)APMAH.I	Y	44.79	1518.6530	15	1.7	760.3350	2	80.71	3	37294	20190523-10-H3.raw	5.36E7	2	2	101	115	Carbamidomethylation
K.KYPEEASELKSIITGELPAGWEK.A	Y	44.60	2574.3215	23	-0.2	644.5875	4	123.60	3	75011	20190523-10-H3.raw	7.56E6	2	2	397	419
K.LPHLPGTSIEGVEK.G	Y	43.26	1475.7983	14	0.1	492.9401	3	92.47	3	47238	20190523-10-H3.raw	7E7	3	3	601	614
K.GGYTISDDSSGNKPDVILIGTGSELEIAAQAAEVLR.K	Y	42.99	3645.8372	36	0.9	1216.2875	3	149.86	3	99291	20190523-10-H3.raw	8.2E6	3	3	615	650
R.NLSQQC(+57.02)LNALAK.V	N	42.68	1358.6976	12	3.9	680.3588	2	87.50	3	43011	20190523-10-H3.raw	4.67E7	2	2	435	446	Carbamidomethylation
R.FEALGWHVIWVK.N	N	40.96	1483.7976	12	6.2	742.9107	2	124.16	3	75541	20190523-10-H3.raw	3.15E7	3	3	283	294
K.VTTTIGYGSPNK.A	N	40.47	1236.6350	12	2.5	619.3264	2	71.13	3	29371	20190523-10-H3.raw	9.54E7	2	2	322	333
K.SIITGELPAGWEK.A	Y	40.11	1399.7347	13	0.5	700.8750	2	110.46	3	63030	20190523-10-H3.raw	3.86E7	2	2	407	419
A.AAVETVEPTTDSSIVDK.S	Y	38.97	1760.8679	17	1.6	881.4426	2	86.99	3	42583	20190523-10-H3.raw	1.28E8	2	2	67	83
K.EFGITVEAVVDAAK.S	Y	37.97	1447.7559	14	0.5	724.8856	2	126.56	3	77797	20190523-10-H3.raw	2.6E6	1	1	725	738
R.QKLPHLPGTSIEGVEK.G	Y	37.11	1731.9519	16	0.0	578.3246	3	84.23	3	40308	20190523-10-H3.raw	1.18E8	4	4	599	614
K.KYPEEASELK.S	Y	34.31	1192.5975	10	1.2	398.5403	3	63.41	3	23098	20190523-10-H3.raw	1.08E8	5	5	397	406
A.AVETVEPTTDSSIVDKSVNSIR.F	Y	33.97	2346.1914	22	0.1	783.0712	3	98.15	3	52108	20190523-10-H3.raw	1.74E6	1	1	68	89
K.TVTDKPTLIK.V	Y	33.36	1114.6598	10	1.1	558.3378	2	66.09	3	25256	20190523-10-H3.raw	1.06E8	3	3	312	321
K.TPSILALSR.Q	Y	30.75	956.5654	9	0.2	479.2901	2	95.29	3	49692	20190523-10-H3.raw	9.58E7	1	1	590	598
N.TLMFRPADGNETAGAYK.I	Y	30.65	1840.8777	17	1.5	614.6341	3	86.39	3	42069	20190523-10-H3.raw	6.48E6	1	1	566	582
R.VVSFVC(+57.02)WELY(sub F)DEQSDEF(sub Y)KESVLPSDVSAR.V	Y	30.44	3419.5867	29	1.2	1140.8708	3	139.83	3	90041	20190523-10-H3.raw	0	1	1	658	686	Carbamidomethylation
K.NPYWFNR.D	N	30.38	995.4613	7	-0.2	498.7378	2	92.05	3	46891	20190523-10-H3.raw	7.94E7	2	2	128	134
K.ESVLPSDVSAR.V	N	30.25	1158.5880	11	-0.7	580.3009	2	80.39	3	37023	20190523-10-H3.raw	2.48E7	1	1	676	686
Y.C(+57.02)ATFFVFTDYMR.G	N	30.21	1556.6792	12	-0.3	779.3467	2	137.06	3	87485	20190523-10-H3.raw	3.79E6	1	1	509	520	Carbamidomethylation
R.EHGMGAIC(+57.02)NGIALHSPGLIPYC(+57.02)ATFFVFTDYMR.G	Y	29.82	3744.7349	33	-0.5	937.1905	4	149.23	3	98714	20190523-10-H3.raw	2.2E6	1	1	488	520	Carbamidomethylation
Y.AILGDGC(+57.02)QMEGISNEAC(+57.02)SLAGHWGLGK.L	Y	29.56	2830.2837	27	1.2	944.4363	3	131.19	3	82018	20190523-10-H3.raw	1.06E6	1	1	229	255	Carbamidomethylation
A.AVETVEPTTDSSIVDK.S	Y	28.16	1689.8308	16	-0.8	845.9220	2	84.18	3	40260	20190523-10-H3.raw	3.92E6	1	1	68	83
K.YPEEASELK.S	Y	27.99	1064.5026	9	1.5	533.2593	2	71.04	3	29299	20190523-10-H3.raw	1.1E7	1	1	398	406
R.FLAIDAVEK.A	N	25.42	1004.5542	9	2.1	503.2854	2	96.27	3	50579	20190523-10-H3.raw	1.28E8	1	1	90	98
R.KTPSILALSR.Q	Y	24.50	1084.6604	10	0.1	543.3375	2	81.19	3	37718	20190523-10-H3.raw	4.97E7	3	3	589	598
K.AFGDFQK.A	Y	23.29	811.3864	7	-0.2	406.7004	2	73.78	3	31527	20190523-10-H3.raw	4.55E7	1	1	468	474
R.ISALSEAGVIYVMTHDSIGLGEDGPTHQPIEH.I	N	21.62	3372.6296	32	0.2	844.1649	4	136.01	3	86504	20190523-10-H3.raw	1.55E7	1	1	525	556
R.ISALSEAGVIF(sub Y)VM(+15.99)THDSIGLGEDGPTHQPIEH.I	N	21.21	3372.6296	32	-2.5	844.1625	4	135.67	3	86188	20190523-10-H3.raw	1.55E7	1	1	525	556	Oxidation (M)
H.ILYDEVMR.Y	Y	20.22	1037.5215	8	-0.6	519.7677	2	93.70	3	48319	20190523-10-H3.raw	5.35E7	1	1	116	123
total 52 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
R.EAMDKLVEVLLEKETIGGDEFR.A	Y	62.87	2520.2781	22	1.5	841.1013	3	138.51	3	88844	20190523-10-H3.raw	4.41E7	2	2	642	663
R.TPGFSGADLANLLNEAAILAGR.R	N	62.65	2170.1382	22	0.6	1086.0770	2	155.26	3	104371	20190523-10-H3.raw	1.36E8	2	2	428	449
R.SGGGMGGPGGPGNPLQFGQSK.A	Y	60.44	1885.8740	21	-2.0	943.9424	2	96.81	3	50983	20190523-10-H3.raw	3.87E7	2	2	193	213
R.QMVTTFGMSDIGPWSLMDSSAQSDVIMR.M	Y	59.02	3089.3967	28	-1.0	1545.7041	2	152.97	3	102189	20190523-10-H3.raw	1.6E7	2	2	576	603
R.AAEEIIFGDSEVTTGAVGDLQQITGLAR.Q	Y	58.29	2860.4453	28	-1.2	954.4879	3	148.29	3	97833	20190523-10-H3.raw	3.45E7	4	4	548	575
R.EQTLNQLLTEMDGFEGNTGVIVVAATNR.A	N	57.61	3019.4919	28	2.5	1510.7570	2	153.02	3	102239	20190523-10-H3.raw	1.05E7	2	2	347	374
K.FQMEPNTGVTFDDVAGVDEAKQDFMEVVEFLK.K	N	55.13	3634.6846	32	1.5	1212.5706	3	155.35	3	104454	20190523-10-H3.raw	1.8E7	2	2	216	247
K.ENAPC(+57.02)IVFVDEIDAVGR.Q	N	53.91	1902.9146	17	0.4	952.4649	2	134.45	3	85046	20190523-10-H3.raw	4.05E7	1	1	317	333	Carbamidomethylation
K.EIDDSIDRIVAGMEGTVMTDGK.S	N	53.52	2351.0984	22	0.9	1176.5575	2	141.17	3	91300	20190523-10-H3.raw	1.97E6	1	1	459	480
K.VDLYENGTIAIVEAVSPELGNR.V	N	53.11	2358.2065	22	-0.4	1180.1101	2	143.50	3	93451	20190523-10-H3.raw	8.03E6	5	5	109	130
K.SLVAYHEVGHAVC(+57.02)GTLTPGHDAVQK.V	Y	52.49	2645.3020	25	3.4	662.3350	4	85.57	3	41407	20190523-10-H3.raw	1.62E8	5	5	483	507	Carbamidomethylation
K.KLSDSAYEIALSHIK.N	Y	52.10	1673.8988	15	0.7	419.4823	4	99.37	3	53199	20190523-10-H3.raw	7.48E7	3	3	624	638
K.AKENAPC(+57.02)IVFVDEIDAVGR.Q	N	52.06	2102.0466	19	1.0	701.6902	3	119.68	3	71388	20190523-10-H3.raw	2.82E7	3	3	315	333	Carbamidomethylation
R.RSGGGMGGPGGPGNPLQFGQSK.A	Y	52.01	2041.9751	22	2.8	681.6675	3	86.35	3	42039	20190523-10-H3.raw	5.27E6	1	1	192	213
K.AKFQMEPNTGVTFDDVAGVDEAKQDFMEVVEFLKKPER.F	N	51.96	4344.1079	38	1.9	725.0266	6	146.23	3	95941	20190523-10-H3.raw	6.29E6	1	1	214	251
R.AILSEFTEIPPENR.V	N	48.77	1614.8253	14	1.0	808.4208	2	113.14	3	65438	20190523-10-H3.raw	4.36E7	6	6	664	677
K.FQMEPNTGVTFDDVAGVDEAK.Q	N	47.67	2269.0208	21	0.3	1135.5179	2	118.25	3	70097	20190523-10-H3.raw	1.02E7	2	2	216	236
K.LSDSAYEIALSHIK.N	Y	47.18	1545.8038	14	0.3	516.2754	3	104.85	3	58029	20190523-10-H3.raw	8.76E7	2	2	625	638
R.GTGIGGGNDEREQTLNQLLTEMDGFEGNTGVIVVAATNR.A	N	45.59	4032.9446	39	1.9	1009.2454	4	149.40	3	98869	20190523-10-H3.raw	7.75E6	1	1	336	374
R.VNKVDLYENGTIAIVEAVSPELGNR.V	Y	45.38	2699.4128	25	-2.3	900.8094	3	132.87	3	83581	20190523-10-H3.raw	1.19E7	2	2	106	130
R.VRVQLPGLSQELLQK.L	N	45.32	1707.0043	15	0.4	570.0089	3	109.27	3	61932	20190523-10-H3.raw	3.4E7	3	3	134	148
R.IVAGMEGTVMTDGK.S	N	43.81	1407.6738	14	-1.0	704.8435	2	90.29	3	45376	20190523-10-H3.raw	0	1	1	467	480
R.VNKVDLYENGTIAIVEAVSPELGNRVER.V	Y	43.65	3083.6250	28	3.5	771.9162	4	127.65	3	78774	20190523-10-H3.raw	5.89E6	1	1	106	133
R.VPSSTTTTPASAPTPAAV	Y	43.59	1654.8413	18	0.6	828.4285	2	90.23	3	45327	20190523-10-H3.raw	2.43E7	3	3	678	695
R.GLTWFIPSDDPTLISK.Q	N	43.45	1788.9298	16	1.6	895.4736	2	137.78	3	88153	20190523-10-H3.raw	2.32E8	1	1	518	533
K.KFDNDVSLEIIAMR.T	Y	43.02	1649.8446	14	-0.1	550.9554	3	113.42	3	65695	20190523-10-H3.raw	4.19E7	2	2	414	427
M.RTPGFSGADLANLLNEAAILAGR.R	N	42.82	2326.2393	23	2.4	776.4222	3	151.32	3	100634	20190523-10-H3.raw	6.24E6	1	1	427	449
K.FQM(+15.99)EPNTGVTFDDVAGVDEAKQDFMEVVEFLK.K	N	41.86	3650.6797	32	0.9	1217.9016	3	154.90	3	104032	20190523-10-H3.raw	0	1	1	216	247	Oxidation (M)
K.QDFMEVVEFLK.K	N	41.49	1383.6744	11	-1.7	692.8433	2	141.50	3	91601	20190523-10-H3.raw	2.13E7	1	1	237	247
K.LAEDIDSAVKK.L	Y	41.20	1187.6398	11	0.7	594.8276	2	68.52	3	27303	20190523-10-H3.raw	2.13E7	2	2	614	624
R.VQLPGLSQELLQK.L	N	39.43	1451.8347	13	1.1	726.9254	2	114.66	3	66830	20190523-10-H3.raw	2.55E8	3	3	136	148
R.QVSVDVPDVK.G	N	38.47	1084.5764	10	0.4	543.2957	2	84.38	3	40432	20190523-10-H3.raw	9.16E7	1	1	391	400
R.TPGFSGADLANLLNEAAILAGRR.A	N	38.39	2326.2393	23	0.0	582.5671	4	152.50	3	101742	20190523-10-H3.raw	8.09E7	2	2	428	450
R.EAMDKLVEVLLEK.E	Y	34.97	1515.8218	13	-0.1	506.2812	3	129.86	3	80788	20190523-10-H3.raw	6.65E6	1	1	642	654
R.AILSEFTEIPPENRVPSSTTTTPASAPTPAAV	Y	34.27	3251.6560	32	-0.1	1084.8925	3	124.33	3	75696	20190523-10-H3.raw	5.63E7	4	4	664	695
K.LAEDIDSAVK.K	Y	32.98	1059.5448	10	0.6	530.7800	2	77.33	3	34452	20190523-10-H3.raw	4.49E7	1	1	614	623
K.GVLLIGPPGTGK.T	Y	32.52	1107.6652	12	1.6	554.8408	2	98.85	3	52723	20190523-10-H3.raw	1.44E8	3	3	262	273
R.FLEYLDKDR.V	Y	31.20	1197.6029	9	0.6	400.2085	3	88.16	3	43584	20190523-10-H3.raw	7.99E7	1	1	97	105
R.IVAGM(+15.99)EGTVMTDGK.S	N	31.10	1423.6687	14	5.2	712.8453	2	74.41	3	32024	20190523-10-H3.raw	6.18E5	1	1	467	480	Oxidation (M)
R.ADILDSALLRPGR.F	N	29.84	1395.7833	13	-0.2	466.2683	3	105.07	3	58231	20190523-10-H3.raw	1.49E8	4	4	375	387
K.ETIGGDEFR.A	Y	29.43	1022.4669	9	1.5	512.2415	2	76.70	3	33984	20190523-10-H3.raw	5.27E7	1	1	655	663
K.FQMEPNTGVTFDDVAGVDEAKQDFM(+15.99)EVVEFLK.K	N	29.23	3650.6797	32	-0.3	1217.9001	3	154.40	3	103548	20190523-10-H3.raw	5.1E6	1	1	216	247	Oxidation (M)
K.FQM(+15.99)EPNTGVTFDDVAGVDEAKQDFM(+15.99)EVVEFLK.K	N	27.78	3666.6746	32	2.5	1223.2352	3	153.81	3	102991	20190523-10-H3.raw	7.54E5	1	1	216	247	Oxidation (M)
K.EIDDSIDR.I	N	26.96	961.4352	8	2.6	481.7261	2	67.15	3	26174	20190523-10-H3.raw	2.46E7	1	1	459	466
K.KFDNDVSLEIIAM(+15.99)R.T	Y	25.30	1665.8396	14	-1.9	556.2861	3	103.89	3	57179	20190523-10-H3.raw	0	1	1	414	427	Oxidation (M)
R.ADILDSALLRPGRFDR.Q	N	25.02	1813.9799	16	1.2	605.6680	3	107.56	3	60435	20190523-10-H3.raw	1.07E8	2	2	375	390
R.IVGGLGGR.A	N	20.13	727.4340	8	0.8	364.7246	2	64.14	3	23683	20190523-10-H3.raw	2.86E7	1	1	540	547
total 47 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
K.YC(+57.02)PHALINMISNPVNSTVPIAAEIFK.K	Y	68.39	2898.4771	26	0.7	1450.2468	2	146.70	3	96371	20190523-10-H3.raw	3.84E8	7	7	136	161	Carbamidomethylation
K.LNPLVSSLSLYDIANTPGVAADVGHINTR.S	N	65.58	3006.5774	29	3.4	1504.3010	2	138.14	3	88487	20190523-10-H3.raw	2.11E9	12	12	51	79
K.NGVEEVLDLGPLSDFEKEGLEALKPELK.S	Y	59.78	3067.5964	28	-0.1	1023.5394	3	150.27	3	99664	20190523-10-H3.raw	1.17E9	8	8	302	329
K.YC(+57.02)PHALINM(+15.99)ISNPVNSTVPIAAEIFK.K	Y	59.08	2914.4722	26	1.8	972.4998	3	136.50	3	86969	20190523-10-H3.raw	3.25E7	2	2	136	161	Carbamidomethylation; Oxidation (M)
K.GLNGVPDVIEC(+57.02)SYVQSTITELPFFASK.V	Y	58.74	2970.4685	27	0.4	1486.2422	2	153.87	3	103044	20190523-10-H3.raw	6.44E7	1	1	270	296	Carbamidomethylation
K.YC(+57.02)PHALINMISNPVNSTVPIAAEIFKK.A	Y	57.89	3026.5720	27	1.0	1009.8657	3	137.23	3	87643	20190523-10-H3.raw	7.71E8	10	10	136	162	Carbamidomethylation
K.ANVPVAEVNVPVIGGHAGVTILPLFSQATPQANLSSDILTALTKR.T	Y	57.37	4578.5171	45	-0.1	1527.1794	3	153.06	3	102279	20190523-10-H3.raw	1.49E8	3	3	190	234
K.ANVPVAEVNVPVIGGHAGVTILPLFSQATPQANLSSDILTALTK.R	Y	55.63	4422.4160	44	-3.4	1475.1409	3	154.44	3	103591	20190523-10-H3.raw	5.9E8	2	2	190	233
K.NGVEEVLDLGPLSDFEK.E	N	55.57	1859.9152	17	-0.8	930.9641	2	140.42	3	90593	20190523-10-H3.raw	6.19E8	6	6	302	318
R.LGKNGVEEVLDLGPLSDFEKEGLEALKPELK.S	Y	55.12	3365.7969	31	1.8	674.1678	5	143.26	3	93239	20190523-10-H3.raw	3.02E8	5	5	299	329
K.VAILGAAGGIGQPLALLMK.L	Y	53.60	1792.0645	19	0.0	897.0395	2	145.28	3	95081	20190523-10-H3.raw	6.07E8	5	5	32	50
K.NGVEEVLDLGPLSDFEKEGLEALK.P	N	52.53	2600.3220	24	2.3	867.7833	3	151.97	3	101236	20190523-10-H3.raw	1.25E7	1	1	302	325
K.VAILGAAGGIGQPLALLM(+15.99)K.L	Y	52.45	1808.0593	19	0.9	905.0377	2	135.35	3	85893	20190523-10-H3.raw	7.35E7	4	4	32	50	Oxidation (M)
H.ALINMISNPVNSTVPIAAEIFKK.A	Y	49.79	2469.3665	23	0.9	824.1302	3	140.47	3	90641	20190523-10-H3.raw	9.93E7	3	3	140	162
R.SEVVGYMGDDNLAK.A	Y	49.45	1496.6816	14	0.9	749.3488	2	91.53	3	46438	20190523-10-H3.raw	4.78E8	5	5	80	93
K.EGLEALKPELK.S	Y	47.82	1225.6918	11	0.0	613.8531	2	87.03	3	42623	20190523-10-H3.raw	4.36E8	4	4	319	329
K.ALEGADLVIIPAGVPR.K	N	47.75	1589.9141	16	1.3	795.9653	2	124.49	3	75847	20190523-10-H3.raw	7.33E8	5	5	94	109
H.AGVTILPLFSQATPQANLSSDILTALTK.R	Y	47.71	2869.5801	28	0.5	1435.7980	2	155.63	3	104723	20190523-10-H3.raw	2.08E7	2	2	206	233
H.ALINMISNPVNSTVPIAAEIFK.K	Y	46.71	2341.2715	22	0.7	781.4316	3	152.36	3	101605	20190523-10-H3.raw	5.59E7	2	2	140	161
R.KVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTR.S	Y	45.77	4908.7261	49	-1.9	982.7506	5	154.64	3	103785	20190523-10-H3.raw	0	1	1	31	79
R.SEVVGYMGDDNLAKALEGADLVIIPAGVPR.K	Y	45.19	3068.5852	30	2.6	1023.8716	3	148.39	3	97932	20190523-10-H3.raw	1.29E6	1	1	80	109
R.DDLFNINAGIVK.N	N	45.00	1317.6929	12	1.1	659.8544	2	121.51	3	73065	20190523-10-H3.raw	4.19E8	6	6	116	127
L.VSSLSLYDIANTPGVAADVGHINTR.S	N	44.56	2569.3135	25	-0.3	857.4449	3	121.12	3	72704	20190523-10-H3.raw	4.4E6	1	1	55	79
R.KVAILGAAGGIGQPLALLMK.L	Y	43.61	1920.1594	20	1.1	641.0611	3	131.38	3	82194	20190523-10-H3.raw	3.62E7	2	2	31	50
N.MISNPVNSTVPIAAEIFK.K	N	43.13	1930.0233	18	2.5	966.0214	2	133.25	3	83937	20190523-10-H3.raw	6.11E6	1	1	144	161
R.SEVVGYM(+15.99)GDDNLAK.A	Y	42.74	1512.6766	14	1.0	757.3463	2	81.04	3	37583	20190523-10-H3.raw	1.48E7	1	1	80	93	Oxidation (M)
A.KYC(+57.02)PHALINMISNPVNSTVPIAAEIFK.K	Y	42.40	3026.5720	27	1.3	757.6512	4	136.19	3	86672	20190523-10-H3.raw	1.77E7	2	2	135	161	Carbamidomethylation
K.NGVEEVLDLGPLSDY(sub F)EKEGLEALKPELK.S	Y	39.72	3083.5913	28	2.1	771.9067	4	144.11	3	94019	20190523-10-H3.raw	5.56E6	1	1	302	329
N.LSSDILTALTK.R	Y	38.39	1160.6653	11	-0.2	581.3398	2	115.41	3	67473	20190523-10-H3.raw	1.38E7	1	1	223	233
K.LFGVTTLDVVR.A	N	37.82	1218.6971	11	0.8	610.3563	2	119.06	3	70865	20190523-10-H3.raw	5.36E8	3	3	171	181
K.KLFGVTTLDVVR.A	N	37.13	1346.7921	12	0.4	449.9382	3	103.28	3	56605	20190523-10-H3.raw	2.05E8	2	2	170	181
R.TQDGGTEVVEAK.A	N	36.22	1232.5884	12	-0.4	617.3012	2	59.82	3	20241	20190523-10-H3.raw	2.22E8	3	3	235	246
K.RTQDGGTEVVEAK.A	N	33.85	1388.6896	13	0.7	463.9041	3	54.12	3	15694	20190523-10-H3.raw	8.35E6	2	2	234	246
H.ALINM(+15.99)ISNPVNSTVPIAAEIFK.K	Y	32.35	2357.2664	22	1.2	1179.6418	2	143.28	3	93252	20190523-10-H3.raw	3.59E5	1	1	140	161	Oxidation (M)
R.KPGMTRDDLFNINAGIVK.N	N	31.27	1988.0513	18	1.8	663.6922	3	99.30	3	53138	20190523-10-H3.raw	1.54E7	2	2	110	127
K.LNPLVSSLSLYDIANTPGVAADVGH.I	N	31.26	2522.3015	25	-0.1	1262.1580	2	146.48	3	96174	20190523-10-H3.raw	3.5E5	1	1	51	75
L.FSQATPQANLSSDILTALTK.R	Y	29.71	2105.1003	20	-0.1	1053.5574	2	136.12	3	86608	20190523-10-H3.raw	6E6	1	1	214	233
Y.AGALFADAC(+57.02)LK.G	N	29.07	1135.5696	11	-1.3	568.7913	2	96.31	3	50620	20190523-10-H3.raw	1.13E7	1	1	259	269	Carbamidomethylation
K.ANVPVAEVNVPVIGGH.A	Y	27.21	1570.8467	16	-0.9	786.4299	2	111.52	3	63980	20190523-10-H3.raw	1.25E7	1	1	190	205
K.ANVPVAEVNVPVIGGHAGVTILPL.F	Y	25.57	2335.3264	24	0.0	1168.6705	2	144.35	3	94235	20190523-10-H3.raw	6.83E5	1	1	190	213
F.SSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTR.S	Y	24.01	5708.1084	57	5.9	952.3643	6	153.48	3	102679	20190523-10-H3.raw	2.21E6	1	1	23	79
F.SSGSVPERKVAILGAAGGIGQPLALLMK.L	Y	21.58	2719.5417	28	3.6	680.8951	4	123.75	3	75158	20190523-10-H3.raw	8.41E5	1	1	23	50
N.INAGIVK.N	N	21.31	713.4435	7	0.2	357.7291	2	63.69	3	23332	20190523-10-H3.raw	2.47E7	1	1	121	127
K.EGLEALK.P	N	20.96	758.4174	7	-1.2	380.2155	2	71.28	3	29475	20190523-10-H3.raw	8.97E6	1	1	319	325
K.ANVPVAEVNVPVIGGHAGVTILPLFSQATPQAN.L	Y	20.96	3279.7615	33	-1.2	1094.2598	3	149.82	3	99260	20190523-10-H3.raw	6.56E6	1	1	190	222
R.TFYAGK.A	N	20.62	685.3435	6	0.7	343.6793	2	58.23	3	18951	20190523-10-H3.raw	2.21E6	1	1	184	189
K.NLC(+57.02)TAIAK.Y	Y	20.17	889.4691	8	0.5	445.7420	2	68.19	3	27016	20190523-10-H3.raw	1.08E8	1	1	128	135	Carbamidomethylation
total 47 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
K.LTVEPAEGGEQSILEADVVLVSAGR.T	Y	64.95	2538.3176	25	0.8	1270.1671	2	138.32	3	88665	20190523-10-H3.raw	4.58E7	10	10	290	314
R.LGSEVTVVEFAGDIVPSMDGEIRK.Q	Y	59.52	2547.2891	24	1.8	850.1052	3	133.26	3	83943	20190523-10-H3.raw	6.41E7	4	4	236	259
R.LGSEVTVVEFAGDIVPSMDGEIR.K	Y	57.38	2419.1941	23	-0.7	807.4047	3	145.00	3	94836	20190523-10-H3.raw	1.51E7	5	5	236	258
R.FLSNVPGVYAIGDVIPGPMLAHK.A	Y	56.63	2394.2769	23	0.2	799.0997	3	136.13	3	86619	20190523-10-H3.raw	2.5E8	7	7	342	364
R.GALGGTC(+57.02)LNVGC(+57.02)IPSK.A	N	56.18	1602.7858	16	1.3	802.4012	2	98.14	3	52101	20190523-10-H3.raw	3.16E8	4	4	76	91	Carbamidomethylation
R.FLSNVPGVYAIGDVIPGPMLAHKAEEDGVAC(+57.02)VEFIAGK.H	Y	55.86	3970.0007	38	3.2	993.5106	4	146.35	3	96049	20190523-10-H3.raw	3.68E7	2	2	342	379	Carbamidomethylation
K.AEEDGVAC(+57.02)VEFIAGK.H	N	53.86	1593.7344	15	1.0	797.8752	2	105.76	3	58832	20190523-10-H3.raw	8.44E7	6	6	365	379	Carbamidomethylation
K.FISPNEVSVETIDGGNTIVK.G	Y	53.73	2118.0845	20	1.1	1060.0507	2	116.94	3	68876	20190523-10-H3.raw	2.36E8	3	3	157	176
R.ILVNDRFLSNVPGVYAIGDVIPGPMLAHK.A	Y	53.37	3104.6843	29	1.8	777.1797	4	139.43	3	89660	20190523-10-H3.raw	2.01E7	2	2	336	364
K.VSSVEVDLPAMLAQKDNAVK.N	Y	53.14	2113.1089	20	-1.0	1057.5607	2	110.99	3	63499	20190523-10-H3.raw	2.81E7	3	3	114	133
K.HGHVDYDKVPGVVYTHPEVASVGK.T	Y	53.02	2589.2976	24	2.2	518.8679	5	82.76	3	39124	20190523-10-H3.raw	2.48E8	6	6	380	403
K.VSSVEVDLPAMLAQK.D	N	52.80	1585.8385	15	0.8	793.9272	2	119.63	3	71340	20190523-10-H3.raw	4.02E8	4	4	114	128
F.ASSGSDENDVVIIGGGPGGYVAAIK.A	Y	52.26	2332.1545	25	0.7	1167.0853	2	117.69	3	69563	20190523-10-H3.raw	1.34E8	3	3	37	61
K.RGALGGTC(+57.02)LNVGC(+57.02)IPSK.A	N	50.52	1758.8868	17	0.0	587.3029	3	87.66	3	43151	20190523-10-H3.raw	3.97E7	2	2	75	91	Carbamidomethylation
K.ILADKETDKILGVHIMAPNAGELIHEAVLAINYDASSEDIAR.V	Y	50.29	4515.3320	42	1.1	904.0747	5	146.40	3	96097	20190523-10-H3.raw	1.13E8	5	5	440	481
K.KIVSSTGALSLSEVPK.K	Y	49.64	1614.9192	16	2.3	808.4687	2	89.08	3	44414	20190523-10-H3.raw	1.94E7	2	2	200	215
K.EAAMATYDKPIHI	Y	48.59	1458.7177	13	2.1	730.3676	2	89.01	3	44339	20190523-10-H3.raw	1.79E8	2	2	495	507
R.TPFTSGLDLEKIGVETDKAGR.I	Y	48.36	2233.1589	21	1.3	559.2977	4	106.21	3	59242	20190523-10-H3.raw	2.39E7	2	2	315	335
R.VC(+57.02)HAHPTMSEALK.E	N	48.12	1479.6963	13	0.6	494.2397	3	59.80	3	20226	20190523-10-H3.raw	2.99E8	8	8	482	494	Carbamidomethylation
K.ILGVHIMAPNAGELIHEAVLAINYDASSEDIAR.V	Y	45.84	3501.7925	33	-0.9	701.3651	5	152.17	3	101428	20190523-10-H3.raw	7.83E6	2	2	449	481
K.TKVVSVDSSSDGVK.L	Y	45.48	1406.7252	14	1.4	469.9164	3	60.76	3	21011	20190523-10-H3.raw	2.06E7	2	2	276	289
R.TPFTSGLDLEK.I	N	44.93	1206.6132	11	0.5	604.3141	2	99.24	3	53076	20190523-10-H3.raw	3.45E8	2	2	315	325
R.TPFTSGLDLEKIGVETDK.A	N	44.00	1948.9993	18	-0.6	650.6733	3	113.09	3	65397	20190523-10-H3.raw	6.07E6	1	1	315	332
K.IVSSTGALSLSEVPKK.L	Y	43.80	1614.9192	16	0.8	539.3141	3	86.37	3	42052	20190523-10-H3.raw	5.37E7	1	1	201	216
K.IVSSTGALSLSEVPK.K	Y	43.59	1486.8242	15	0.9	744.4200	2	100.11	3	53807	20190523-10-H3.raw	1.09E8	2	2	201	215
R.VC(+57.02)HAHPTMSEALKEAAMATYDKPIHI	Y	43.26	2920.4033	26	-0.4	487.7410	6	106.13	3	59168	20190523-10-H3.raw	3.59E7	4	4	482	507	Carbamidomethylation
K.VPGVVYTHPEVASVGK.T	Y	41.56	1637.8777	16	0.9	546.9670	3	83.52	3	39699	20190523-10-H3.raw	4.47E7	1	1	388	403
K.HIIVATGSDVK.S	N	40.01	1138.6346	11	0.9	380.5525	3	62.24	3	22134	20190523-10-H3.raw	2.04E8	5	5	179	189
K.VVSVDSSSDGVK.L	Y	39.89	1177.5826	12	1.0	589.7992	2	64.36	3	23869	20190523-10-H3.raw	1.6E8	2	2	278	289
R.VGKFPFMANSR.A	N	38.92	1252.6387	11	0.3	418.5536	3	85.23	3	41117	20190523-10-H3.raw	5.05E7	3	3	417	427
K.GKHIIVATGSDVK.S	N	37.89	1323.7510	13	0.6	442.2579	3	56.38	3	17403	20190523-10-H3.raw	8.44E6	2	2	177	189
A.SSGSDENDVVIIGGGPGGYVAAIK.A	Y	36.98	2261.1174	24	0.9	1131.5670	2	117.94	3	69798	20190523-10-H3.raw	1.73E6	1	1	38	61
K.AIDNAEGLVK.I	Y	36.63	1028.5502	10	0.5	515.2826	2	77.53	3	34611	20190523-10-H3.raw	2.11E8	2	2	430	439
K.SLPGITIDEK.K	N	35.67	1071.5812	10	0.9	536.7983	2	92.60	3	47347	20190523-10-H3.raw	1.83E8	3	3	190	199
K.SLPGITIDEKK.I	N	34.94	1199.6761	11	0.1	400.8994	3	79.78	3	36500	20190523-10-H3.raw	1.23E8	3	3	190	200
K.HGHVDYDKVPGVVYTHPEVASVGKTEEQLKK.E	Y	34.34	3445.7629	31	1.0	493.2596	7	83.82	3	39975	20190523-10-H3.raw	1.94E7	2	2	380	410
K.IVSSTGALSLSEVPKKLIVIGAGYIGLEMGSVWGR.L	Y	31.43	3586.9795	35	-3.6	897.7490	4	154.11	3	103279	20190523-10-H3.raw	1.69E6	1	1	201	235
R.AKAIDNAEGLVK.I	Y	30.83	1227.6823	12	0.3	410.2348	3	71.02	3	29273	20190523-10-H3.raw	8.44E6	2	2	428	439
K.FPFMANSR.A	N	28.85	968.4538	8	0.5	485.2344	2	93.08	3	47766	20190523-10-H3.raw	6.05E7	2	2	420	427
R.ILVNDRFLSNVPGVYAIGDVIPGPMLAHKAEEDGVAC(+57.02)VEFIAGK.H	Y	28.57	4680.4082	44	0.3	937.0892	5	146.95	3	96613	20190523-10-H3.raw	5.15E6	1	1	336	379	Carbamidomethylation
K.IGVETDKAGR.I	Y	28.04	1044.5564	10	-1.6	349.1922	3	54.81	3	16180	20190523-10-H3.raw	8.51E5	1	1	326	335
R.GIEGLFK.K	Y	25.90	762.4276	7	0.6	382.2213	2	95.97	3	50290	20190523-10-H3.raw	9.65E7	2	2	138	144
R.FLSNVPGVYAIGDVIPGPMLAH.K	Y	25.38	2266.1819	22	2.9	756.4034	3	149.45	3	98916	20190523-10-H3.raw	5.81E6	2	2	342	363
K.ILGVHIMAPNAGELIH.E	Y	24.56	1683.9130	16	0.3	562.3118	3	114.21	3	66408	20190523-10-H3.raw	2.82E6	1	1	449	464
A.LLHSSHMYHEAK.H	N	24.55	1451.6980	12	-0.1	363.9317	4	55.72	3	16863	20190523-10-H3.raw	0	1	1	93	104
K.ALLHSSHMYHEAK.H	N	23.77	1522.7351	13	-0.5	305.5541	5	55.92	3	17027	20190523-10-H3.raw	4.24E7	2	2	92	104
K.VSSVEVDLPAM(+15.99)LAQK.D	N	21.81	1601.8334	15	0.6	801.9244	2	105.01	3	58177	20190523-10-H3.raw	1.08E6	1	1	114	128	Oxidation (M)
total 47 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
R.NVAAGMTGGLAYLLDEDDTLLPK.I	Y	60.33	2376.1882	23	3.1	1189.1051	2	151.30	3	100609	20190523-10-H3.raw	1.56E7	4	4	1519	1541
K.GNADIIQISGHDGGTGASPISSIK.H	Y	59.22	2294.1501	24	-0.8	1148.0814	2	100.34	3	53992	20190523-10-H3.raw	2.56E7	2	2	1151	1174
R.TPEEALMILVPEAYK.N	Y	58.95	1702.8851	15	0.4	852.4502	2	137.79	3	88164	20190523-10-H3.raw	3.46E7	5	5	396	410
K.GQMEAWDGPALLLFSDGK.T	Y	58.15	1933.9243	18	0.6	967.9700	2	146.03	3	95751	20190523-10-H3.raw	1.77E7	1	1	431	448
K.TQHLDLSYLLSSVGTPSLSSTEIR.K	Y	55.19	2603.3442	24	-3.2	1302.6753	2	137.32	3	87732	20190523-10-H3.raw	8.16E7	3	3	1313	1336
K.HAGGPWELGLTETHQTLIANGLR.E	Y	54.58	2470.2717	23	1.8	618.5763	4	111.92	3	64342	20190523-10-H3.raw	2.77E7	4	4	1175	1197
R.FLGHNGEINTIQGNLNWMQSR.E	Y	54.45	2428.1707	21	-1.2	1215.0912	2	113.71	3	65965	20190523-10-H3.raw	6.44E7	3	3	333	353
R.GNILELGPENASQVILSNPVLNEGALEELMKDQYLKPK.V	Y	52.27	4163.1821	38	3.7	1041.8066	4	152.39	3	101637	20190523-10-H3.raw	6.99E7	3	3	635	672
R.KQEVHTNGPVLDDDILADPLVIDAIENEK.V	Y	49.54	3199.6248	29	2.4	800.9154	4	131.18	3	82014	20190523-10-H3.raw	2.12E7	3	3	1337	1365
R.WKPLTDVVDGYSPTLPHLK.G	Y	48.99	2165.1521	19	1.6	722.7258	3	115.34	3	67407	20190523-10-H3.raw	5.83E6	2	2	1012	1030
K.GMAGGEIVVTPVEK.I	Y	48.94	1385.7224	14	1.1	693.8693	2	91.05	3	46027	20190523-10-H3.raw	2.73E7	2	2	1436	1449
R.FGVTPTFLVNADQLEIK.V	N	48.80	1891.0090	17	1.5	946.5132	2	135.61	3	86139	20190523-10-H3.raw	6.14E6	3	3	1050	1066
K.GLQNGDIATSAIK.Q	Y	46.09	1286.6830	13	0.3	644.3489	2	82.43	3	38820	20190523-10-H3.raw	3.32E7	1	1	1031	1043
R.LEPTRPSIPIMLAVGAVHQHLIQNGLR.M	Y	45.88	2959.6541	27	0.0	592.9381	5	124.66	3	76004	20190523-10-H3.raw	3.58E7	3	3	719	745
R.SEALGLFYLDLQNELYESPFAIYHR.R	Y	45.75	2987.4705	25	-1.1	996.8297	3	154.26	3	103418	20190523-10-H3.raw	2.97E6	1	1	291	315
K.PGVPLISPPPHHDIYSIEDLAQLIFDLHQINPNAK.V	Y	45.03	3898.0417	35	2.3	780.6174	5	152.43	3	101670	20190523-10-H3.raw	2.06E7	2	2	1096	1130
R.TSDNFVYVASEVGVVPVDEAK.V	Y	44.43	2224.0898	21	-0.3	1113.0519	2	125.43	3	76731	20190523-10-H3.raw	2.28E6	1	1	467	487
K.ALYYLC(+57.02)EAADDAVR.S	Y	43.82	1628.7504	14	0.7	815.3831	2	110.49	3	63065	20190523-10-H3.raw	4.42E6	1	1	691	704	Carbamidomethylation
K.TQHLDLSYLLSSVGTPSLSSTEIRK.Q	Y	43.68	2731.4392	25	4.7	911.4913	3	127.30	3	78458	20190523-10-H3.raw	4.45E5	2	2	1313	1337
K.IGFVPEEATIVGNTC(+57.02)LYGATGGQIFAR.G	Y	43.36	2840.4167	27	4.6	947.8172	3	140.81	3	90961	20190523-10-H3.raw	4.11E6	3	3	1450	1476	Carbamidomethylation
R.SGSQLLVLSDR.S	Y	43.18	1173.6354	11	-0.1	587.8249	2	93.67	3	48288	20190523-10-H3.raw	1.73E7	1	1	705	715
R.SSKPGVPLISPPPHHDIYSIEDLAQLIFDLHQINPNAK.V	Y	43.13	4200.2007	38	-0.9	841.0466	5	145.05	3	94880	20190523-10-H3.raw	1.04E7	1	1	1093	1130
K.LVAEAGIGTVASGVAK.G	Y	42.03	1441.8140	16	1.8	721.9156	2	94.15	3	48689	20190523-10-H3.raw	3.18E7	2	2	1135	1150
R.KQEVHTNGPVLDDDILADPLVIDAIENEKVVEK.T	Y	41.24	3654.8992	33	-2.4	914.7299	4	129.28	3	80269	20190523-10-H3.raw	8.91E6	2	2	1337	1369
K.ISGLTFDELAR.E	Y	40.03	1220.6400	11	-0.1	611.3272	2	110.08	3	62677	20190523-10-H3.raw	2.67E7	2	2	863	873
R.GSDSANLDSAAEIMIR.S	Y	39.63	1648.7726	16	-2.7	825.3914	2	109.87	3	62482	20190523-10-H3.raw	5.56E6	1	1	377	392
K.LHTGVGMIFLPQDDTFMQEAK.Q	Y	39.07	2377.1445	21	3.7	793.3917	3	125.14	3	76458	20190523-10-H3.raw	1.78E7	1	1	175	195
K.YPEVVDFYDYYK.G	Y	38.75	1599.7133	12	1.0	800.8647	2	125.57	3	76865	20190523-10-H3.raw	9.45E6	1	1	419	430
R.IC(+57.02)HTNNC(+57.02)PVGVASQR.E	N	37.91	1711.7882	15	2.1	856.9032	2	60.41	3	20709	20190523-10-H3.raw	3.48E7	2	2	1242	1256	Carbamidomethylation
K.DALIALGC(+57.02)MEHR.G	N	37.77	1384.6592	12	-2.6	462.5591	3	99.40	3	53223	20190523-10-H3.raw	1.99E7	2	2	125	136	Carbamidomethylation
K.VAQGAKPGEGGQLPGK.K	N	37.18	1492.7997	16	2.7	498.6085	3	58.20	3	18924	20190523-10-H3.raw	9.11E6	1	1	1067	1082
R.LGPGMMIAVDLVNGQVYENTEVK.K	Y	36.36	2476.2341	23	0.4	826.4190	3	141.19	3	91317	20190523-10-H3.raw	1.42E6	1	1	494	516
R.ENEIRPFGNPR.G	Y	35.88	1327.6632	11	1.6	443.5624	3	71.75	3	29847	20190523-10-H3.raw	2.07E7	1	1	366	376
K.EGLQVLGWR.E	Y	35.78	1056.5717	9	0.9	529.2936	2	110.20	3	62790	20190523-10-H3.raw	1.61E7	1	1	205	213
K.IPTVTIEQAQK.N	Y	35.74	1226.6870	11	-1.7	614.3497	2	82.79	3	39145	20190523-10-H3.raw	3.3E7	1	1	801	811
K.IAKEDSTDDIER.E	Y	35.57	1390.6576	12	-0.7	464.5595	3	58.60	3	19271	20190523-10-H3.raw	7.11E6	1	1	240	251
R.ETHEAIAIAMNR.I	Y	35.47	1354.6663	12	0.9	452.5631	3	77.13	3	34306	20190523-10-H3.raw	1.5E7	1	1	984	995
K.VEPAVAIVQR.F	Y	35.30	1080.6292	10	0.3	541.3220	2	82.30	3	38706	20190523-10-H3.raw	2.54E7	2	2	961	970
K.SSTVMENEEILR.S	Y	34.58	1406.6711	12	-1.2	704.3420	2	89.14	3	44463	20190523-10-H3.raw	0	1	1	543	554
K.SNSGEGGEDPIR.W	N	34.51	1216.5320	12	-0.2	609.2731	2	59.89	3	20289	20190523-10-H3.raw	8.12E6	2	2	1000	1011
R.EVPVNVPIVGK.N	Y	34.03	1149.6758	11	-0.7	575.8448	2	97.47	3	51517	20190523-10-H3.raw	1.01E7	2	2	214	224
R.FAQVTNPAIDPLREGLVMSLEVNIGKR.G	N	33.36	2966.6011	27	1.3	989.8755	3	133.53	3	84191	20190523-10-H3.raw	6.63E6	2	2	608	634
R.VTAPAGELQLK.S	Y	32.61	1125.6393	11	0.7	563.8273	2	83.62	3	39787	20190523-10-H3.raw	3.52E7	1	1	1552	1562
K.QVIENIFEK.E	Y	31.79	1118.5972	9	2.3	560.3071	2	98.96	3	52825	20190523-10-H3.raw	2.39E7	1	1	196	204
R.ETMPNIQQVFVK.I	Y	30.85	1432.7384	12	-1.0	717.3758	2	110.92	3	63431	20190523-10-H3.raw	2.72E7	1	1	228	239
K.GATILNEWEK.Y	Y	30.84	1159.5873	10	1.0	580.8015	2	97.69	3	51706	20190523-10-H3.raw	7.53E6	2	2	1577	1586
K.EQSLAPFDK.L	Y	30.66	1033.5079	9	1.6	517.7621	2	81.12	3	37655	20190523-10-H3.raw	1.5E7	1	1	166	174
R.FC(+57.02)TGGMSLGAISR.E	N	29.83	1355.6326	13	-3.7	678.8210	2	100.82	3	54407	20190523-10-H3.raw	2.35E7	1	1	971	983	Carbamidomethylation
K.VLSTYFDIR.K	Y	29.61	1112.5865	9	2.5	557.3019	2	107.75	3	60609	20190523-10-H3.raw	9.9E6	1	1	673	681
R.ETLSFWVK.A	Y	29.34	1008.5280	8	3.2	505.2729	2	109.46	3	62104	20190523-10-H3.raw	1.21E7	1	1	874	881
K.SLIEAHVEK.T	Y	28.88	1024.5553	9	2.7	513.2863	2	64.93	3	24328	20190523-10-H3.raw	2.87E7	3	3	1563	1571
K.RLENFGFIQFRPGGEYHSNNPEMSK.L	Y	28.05	2953.3928	25	-3.0	591.6841	5	100.15	3	53841	20190523-10-H3.raw	6.53E6	1	1	890	914
R.ISSFNPYGK.W	Y	27.47	1011.5025	9	0.3	506.7587	2	78.78	3	35653	20190523-10-H3.raw	2.56E7	2	2	519	527
K.SETAYAVYQQHLSNRPVNVLR.D	Y	27.37	2444.2561	21	0.3	612.0715	4	93.60	3	48232	20190523-10-H3.raw	3.47E7	2	2	924	944
K.YLPLFWQLVPPSEEDTPEASAAYVR.T	Y	26.70	2877.4224	25	-0.5	960.1476	3	152.74	3	101966	20190523-10-H3.raw	1.29E7	1	1	1587	1611
R.LIGESNDYVGK.G	Y	25.50	1193.5928	11	4.5	597.8063	2	77.61	3	34680	20190523-10-H3.raw	2.96E7	1	1	1425	1435
R.WPLAQPMR.F	Y	25.46	997.5167	8	-0.4	499.7654	2	93.61	3	48240	20190523-10-H3.raw	2.44E7	2	2	325	332
R.FLKPVNFK.S	Y	24.40	991.5854	8	0.1	331.5358	3	77.19	3	34352	20190523-10-H3.raw	2.9E7	1	1	535	542
H.MLYDYFK.Q	N	23.85	978.4521	7	-0.2	490.2332	2	106.58	3	59577	20190523-10-H3.raw	9.67E6	1	1	599	605
K.EQSLAPFDKLHTGVGMIFLPQDDTFMQEAK.Q	Y	21.96	3392.6421	30	0.2	849.1680	4	135.97	3	86475	20190523-10-H3.raw	1.11E7	1	1	166	195
K.AAVWNGRENEIRPFGNPR.G	Y	21.50	2082.0508	18	1.5	521.5208	4	86.71	3	42343	20190523-10-H3.raw	8.02E6	1	1	359	376
R.ELYIC(+57.02)R.K	N	20.20	852.4164	6	0.5	427.2157	2	75.04	3	32568	20190523-10-H3.raw	1.01E7	1	1	252	257	Carbamidomethylation
total 62 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
N.FKEEDGIDYAAVTVQLPGGERVPFLFTVK.Q	N	66.05	3224.6755	29	1.5	1075.9008	3	137.84	3	88212	20190523-10-H3.raw	1.84E8	7	7	188	216
K.SKPETGEVIGVFESLQPSDTDLGAK.V	N	64.56	2603.2966	25	1.4	1302.6573	2	121.88	3	73413	20190523-10-H3.raw	1.71E9	8	8	292	316
N.FKEEDGIDYAAVTVQLPGGER.V	N	61.94	2293.1226	21	1.3	1147.5701	2	111.21	3	63702	20190523-10-H3.raw	1.72E8	4	4	188	208
K.GTGTANQC(+57.02)PTIDGGSETFSFKPGK.Y	Y	61.59	2456.1277	24	0.9	1229.0723	2	92.94	3	47641	20190523-10-H3.raw	1.86E9	8	8	107	130	Carbamidomethylation
K.GTGTANQC(+57.02)PTIDGGSETFSFK.P	N	59.00	2173.9585	21	0.4	1087.9869	2	101.08	3	54620	20190523-10-H3.raw	5.12E8	7	7	107	127	Carbamidomethylation
K.EEDGIDYAAVTVQLPGGER.V	N	58.62	2017.9592	19	0.2	1009.9871	2	117.92	3	69779	20190523-10-H3.raw	5.1E7	4	4	190	208
K.SKPETGEVIGVFESLQPSDTDLGAKVPK.D	N	56.31	2927.5127	28	0.9	976.8457	3	118.22	3	70063	20190523-10-H3.raw	3.21E8	4	4	292	319
K.KFC(+57.02)FEPTSFTVK.A	N	55.20	1489.7275	12	0.5	745.8714	2	101.46	3	54965	20190523-10-H3.raw	5.72E8	4	4	135	146	Carbamidomethylation
R.GGSTGYDNAVALPAGGRGDEEELVKENVK.N	Y	52.83	2931.4209	29	1.4	978.1489	3	94.89	3	49341	20190523-10-H3.raw	7.62E8	4	4	248	276
R.GGSTGYDNAVALPAGGR.G	N	52.46	1561.7484	17	0.2	781.8817	2	84.73	3	40723	20190523-10-H3.raw	4.39E8	5	5	248	264
R.GGSTGYDNAVALPAGGRGDEEELVK.E	Y	52.31	2461.1721	25	0.3	821.3983	3	95.07	3	49501	20190523-10-H3.raw	2.44E8	4	4	248	272
K.FC(+57.02)FEPTSFTVKADSVSK.N	N	52.30	1948.9241	17	-0.6	650.6483	3	107.06	3	59986	20190523-10-H3.raw	3.39E7	2	2	136	152	Carbamidomethylation
K.QLDASGKPDSFTGK.F	Y	50.20	1449.7100	14	0.6	725.8627	2	67.22	3	26230	20190523-10-H3.raw	6.57E8	4	4	217	230
R.GGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLK.V	Y	49.69	4116.0610	41	1.2	1030.0238	4	116.01	3	68015	20190523-10-H3.raw	1.7E8	3	3	248	288
R.LTYTLDEIEGPFEVASDGSVNFK.E	Y	49.09	2530.2114	23	1.4	1266.1147	2	146.21	3	95921	20190523-10-H3.raw	2.03E7	18	18	167	189
R.GDEEELVKENVK.N	Y	48.83	1387.6830	12	0.9	694.8494	2	73.13	3	31017	20190523-10-H3.raw	2.92E7	2	2	265	276
K.GRGGSTGYDNAVALPAGGR.G	N	48.03	1774.8710	19	0.9	592.6315	3	75.83	3	33239	20190523-10-H3.raw	2.84E7	1	1	246	264
K.GRGGSTGYDNAVALPAGGRGDEEELVKENVK.N	Y	48.00	3144.5435	31	0.4	629.9162	5	88.87	3	44207	20190523-10-H3.raw	3.18E8	3	3	246	276
K.GRGGSTGYDNAVALPAGGRGDEEELVK.E	Y	46.77	2674.2947	27	0.7	669.5814	4	87.53	3	43037	20190523-10-H3.raw	6E7	2	2	246	272
K.GTGTANQC(+57.02)PTIDGGSETFSFKPGKYAGK.K	Y	44.47	2875.3447	28	1.5	719.8445	4	91.06	3	46044	20190523-10-H3.raw	1.58E7	1	1	107	134	Carbamidomethylation
K.FC(+57.02)FEPTSFTVK.A	N	41.54	1361.6326	11	0.3	681.8237	2	114.24	3	66438	20190523-10-H3.raw	1.07E9	4	4	136	146	Carbamidomethylation
K.QLDASGKPDSFTGKFLVPSYR.G	Y	41.33	2312.1799	21	-0.2	579.0521	4	102.20	3	55637	20190523-10-H3.raw	2.46E7	1	1	217	237
V.KGTGTANQC(+57.02)PTIDGGSETFSFKPGK.Y	Y	40.64	2584.2227	25	2.8	647.0648	4	85.37	3	41233	20190523-10-H3.raw	7.44E6	1	1	106	130	Carbamidomethylation
K.EEDGIDYAAVTVQLPGGERVPFLFTVK.Q	N	40.06	2949.5122	27	3.6	984.1815	3	145.87	3	95601	20190523-10-H3.raw	7.35E6	1	1	190	216
K.TYMEVKGTGTANQC(+57.02)PTIDGGSETFSFK.P	N	39.63	2925.3162	27	-0.6	976.1121	3	103.56	3	56870	20190523-10-H3.raw	4.28E6	1	1	101	127	Carbamidomethylation
K.GTGTANQC(+57.02)PTIDGGSETY(sub F)SFKPGK.Y	Y	39.15	2472.1226	24	1.5	825.0494	3	87.65	3	43141	20190523-10-H3.raw	3.74E6	2	2	107	130	Carbamidomethylation
K.SKPETGEVIGVFESLQPSDTDLGAKVPKDVK.I	N	38.66	3269.7029	31	0.7	654.9483	5	113.40	3	65678	20190523-10-H3.raw	4.73E7	2	2	292	322
K.NTAASVGEITLK.V	N	37.69	1202.6506	12	1.6	602.3336	2	86.85	3	42471	20190523-10-H3.raw	1.37E9	5	5	277	288
R.VPFLFTVK.Q	N	37.36	949.5637	8	-0.1	475.7891	2	115.45	3	67504	20190523-10-H3.raw	1.33E9	2	2	209	216
K.NAPPEFQNTK.L	Y	37.25	1144.5513	10	0.8	573.2834	2	63.31	3	23015	20190523-10-H3.raw	6.18E8	5	5	153	162
K.IQGVWYGQLE	N	35.98	1191.5924	10	0.2	596.8036	2	121.02	3	72611	20190523-10-H3.raw	2.77E8	4	4	323	332
K.RLTYDEIQSK.T	N	34.58	1251.6459	10	0.3	626.8304	2	67.18	3	26202	20190523-10-H3.raw	4.59E8	3	3	91	100
R.LTYDEIQSK.T	N	34.23	1095.5448	9	0.4	548.7799	2	75.60	3	33034	20190523-10-H3.raw	3.71E8	2	2	92	100
R.LTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGER.V	Y	29.70	4530.1602	42	2.0	1511.0637	3	155.09	3	104208	20190523-10-H3.raw	1E6	4	4	167	208
R.GSSFLDPK.G	N	28.20	849.4232	8	0.2	425.7190	2	74.35	3	31971	20190523-10-H3.raw	5.32E8	3	3	238	245
V.KGTGTANQC(+57.02)PTIDGGSETFSFK.P	N	27.74	2302.0535	22	0.6	768.3589	3	90.65	3	45686	20190523-10-H3.raw	1.64E5	1	1	106	127	Carbamidomethylation
K.FLVPSYR.G	N	25.65	880.4807	7	0.5	441.2478	2	92.24	3	47041	20190523-10-H3.raw	1.55E9	2	2	231	237
K.TYMEVK.G	N	25.06	769.3680	6	-0.1	385.6913	2	62.15	3	22070	20190523-10-H3.raw	4.57E7	1	1	101	106
R.GDEEELVK.E	Y	22.48	917.4341	8	0.7	459.7247	2	64.37	3	23872	20190523-10-H3.raw	3.65E7	1	1	265	272
K.KFC(+57.02)FEPTSF.T	N	20.32	1161.5165	9	0.3	581.7657	2	110.02	3	62621	20190523-10-H3.raw	1.48E7	1	1	135	143	Carbamidomethylation
total 40 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
R.LGMGTNMYPSAALLGTDKDSNIASIPVEELIEK.A	Y	60.83	3476.7417	33	-0.3	1159.9208	3	142.32	3	92363	20190523-10-H3.raw	7.41E7	3	3	525	557
R.VENQDAIDAAMVGMLADPK.E	N	58.27	1986.9390	19	1.0	994.4777	2	129.67	3	80612	20190523-10-H3.raw	6.68E7	4	4	368	386
R.LLEGDPLKVDQSALTGESLPVTK.H	N	57.99	2409.3003	23	1.5	1205.6592	2	116.23	3	68224	20190523-10-H3.raw	2.56E8	3	3	168	190
R.MTAIEEMAGMDVLC(+57.02)SDKTGTLTLNK.L	N	56.51	2728.2791	25	2.8	910.4362	3	127.79	3	78905	20190523-10-H3.raw	2.63E7	2	2	314	338	Carbamidomethylation
K.KADIGIAVADATDAAR.G	N	56.00	1556.8158	16	0.4	779.4155	2	89.06	3	44389	20190523-10-H3.raw	6.06E7	2	2	598	613
R.MTAIEEMAGMDVLC(+57.02)SDK.T	N	54.98	1899.8086	17	0.1	950.9116	2	127.98	3	79079	20190523-10-H3.raw	2.19E7	2	2	314	330	Carbamidomethylation
K.ESPGGPWEFVGLLPLFDPPR.H	Y	54.93	2209.1206	20	3.2	1105.5712	2	156.92	3	105936	20190523-10-H3.raw	1.91E7	2	2	471	490
R.GASDIVLTEPGLSVIISAVLTSR.A	N	54.26	2297.2842	23	0.7	766.7692	3	157.21	3	106208	20190523-10-H3.raw	1.56E7	4	4	614	636
K.HIVGMTGDGVNDAPALK.K	N	51.42	1693.8457	17	0.1	565.6226	3	85.97	3	41718	20190523-10-H3.raw	5.41E7	3	3	581	597
R.KHIVGMTGDGVNDAPALK.K	N	50.66	1821.9407	18	0.9	608.3214	3	75.25	3	32744	20190523-10-H3.raw	3.02E7	2	2	580	597
K.QGEIEAVVIATGVHTFFGK.A	N	48.62	2002.0524	19	0.4	1002.0339	2	140.99	3	91125	20190523-10-H3.raw	9.87E7	6	6	204	222
K.LSVDKNLVEVFC(+57.02)K.G	N	47.84	1549.8174	13	-0.8	517.6127	3	108.06	3	60905	20190523-10-H3.raw	2.68E7	1	1	339	351	Carbamidomethylation
R.DGKWSEQEAAILVPGDIVSIK.L	N	47.80	2254.1843	21	-0.5	1128.0989	2	127.19	3	78366	20190523-10-H3.raw	2.55E5	1	1	137	157
K.WSEQEAAILVPGDIVSIK.L	N	47.52	1954.0411	18	0.2	978.0280	2	133.13	3	83824	20190523-10-H3.raw	1.13E8	3	3	140	157
K.ESPGGPWEFVGLLPLFDPPRHDSAETIR.R	Y	47.02	3118.5510	28	1.4	780.6461	4	149.23	3	98706	20190523-10-H3.raw	3.23E7	2	2	471	498
K.VDQSALTGESLPVTK.H	N	46.05	1543.8093	15	-0.5	772.9116	2	93.01	3	47707	20190523-10-H3.raw	5.12E7	1	1	176	190
R.EVHFLPFNPVDKR.T	N	45.43	1596.8412	13	-0.3	533.2875	3	97.26	3	51334	20190523-10-H3.raw	5.52E7	6	6	394	406
K.TKESPGGPWEFVGLLPLFDPPRHDSAETIR.R	Y	44.26	3347.6938	30	1.1	670.5468	5	137.46	3	87862	20190523-10-H3.raw	6.99E6	1	1	469	498
K.GVEKDQVLLFAAMASR.V	N	44.07	1733.9133	16	6.3	867.9694	2	116.97	3	68898	20190523-10-H3.raw	5.58E7	3	3	352	367
K.HIVGMTGDGVNDAPALKK.A	N	43.63	1821.9407	18	1.7	456.4932	4	76.15	3	33522	20190523-10-H3.raw	7.87E6	1	1	581	598
R.TALTYIDSDGNWHR.V	N	43.21	1647.7642	14	0.6	824.8898	2	93.19	3	47872	20190523-10-H3.raw	1.2E8	3	3	407	420
K.GAPEQILDLANARPDLR.K	Y	42.96	1847.9854	17	-0.1	617.0023	3	112.64	3	64993	20190523-10-H3.raw	1.4E7	4	4	424	440
K.IPIEEVFQQLK.C	N	42.92	1342.7496	11	0.6	672.3825	2	125.35	3	76658	20190523-10-H3.raw	7.56E7	3	3	17	27
K.AAHLVDSTNQVGHFQK.V	N	42.62	1750.8750	16	-0.2	584.6321	3	69.48	3	28059	20190523-10-H3.raw	9.28E7	5	5	223	238
K.VLRDGKWSEQEAAILVPGDIVSIK.L	N	41.87	2622.4380	24	2.4	656.6183	4	117.12	3	69041	20190523-10-H3.raw	1.2E7	2	2	134	157
R.EGLTTQEGEDR.I	N	41.19	1233.5472	11	1.6	617.7819	2	60.64	3	20899	20190523-10-H3.raw	6.5E7	2	2	31	41
R.EVHFLPFNPVDK.R	N	40.29	1440.7401	12	0.3	481.2541	3	108.00	3	60853	20190523-10-H3.raw	2.01E7	1	1	394	405
R.RLGMGTNMYPSAALLGTDKDSNIASIPVEELIEK.A	Y	39.22	3632.8430	34	1.2	909.2191	4	133.24	3	83930	20190523-10-H3.raw	7.3E6	1	1	524	557
K.ADGFAGVFPEHKYEIVK.K	N	38.79	1905.9624	17	2.3	636.3295	3	98.12	3	52080	20190523-10-H3.raw	8.65E7	2	2	558	574
K.ADGFAGVFPEHK.Y	N	38.48	1273.6091	12	0.0	425.5437	3	88.66	3	44031	20190523-10-H3.raw	1.41E8	2	2	558	569
K.EDVNIFPEK.G	Y	37.67	1089.5342	9	1.2	545.7750	2	91.74	3	46623	20190523-10-H3.raw	4.29E7	2	2	889	897
R.LGMGTNMYPSAALLGTDK.D	Y	37.06	1838.8906	18	1.0	920.4536	2	118.01	3	69864	20190523-10-H3.raw	1.03E7	1	1	525	542
K.ADGFAGVFPEHKYEIVKK.L	N	36.27	2034.0574	18	-1.8	407.8180	5	88.11	3	43544	20190523-10-H3.raw	1.23E7	1	1	558	575
R.IVIFGPNKLEEK.K	Y	36.01	1385.7917	12	0.2	462.9380	3	90.80	3	45810	20190523-10-H3.raw	6.34E7	2	2	42	53
K.VLRDGKWSEQEAAILVPGDIVSIKLGDIIPADAR.L	N	35.93	3643.9937	34	0.7	729.8065	5	135.72	3	86233	20190523-10-H3.raw	1.39E6	1	1	134	167
K.ESPGGPWEFVGLLPLFDPPRHDSAETIRR.A	Y	35.17	3274.6523	29	0.6	655.9381	5	140.87	3	91017	20190523-10-H3.raw	1.93E7	1	1	471	499
K.LGDIIPADAR.L	N	33.85	1039.5662	10	0.7	520.7907	2	87.72	3	43201	20190523-10-H3.raw	1.72E8	1	1	158	167
R.TLHGLQPKEDVNIFPEK.G	Y	33.26	1964.0366	17	2.5	492.0177	4	90.73	3	45752	20190523-10-H3.raw	5.02E6	1	1	881	897
K.MITGDQLAIGK.E	N	33.13	1145.6115	11	2.1	573.8142	2	89.55	3	44791	20190523-10-H3.raw	1.1E8	2	2	509	519
R.EGLTTQEGEDRIVIFGPNKLEEK.K	Y	33.06	2601.3286	23	-1.8	651.3383	4	102.21	3	55648	20190523-10-H3.raw	6.12E6	1	1	31	53
R.ELSEIAEQAK.R	N	32.99	1116.5662	10	1.6	559.2913	2	74.40	3	32015	20190523-10-H3.raw	8.78E7	1	1	902	911
R.ELSEIAEQAKR.R	N	32.41	1272.6674	11	0.3	425.2299	3	68.54	3	27319	20190523-10-H3.raw	2E7	2	2	902	912
K.VLSC(+57.02)IDKYAER.G	Y	32.16	1352.6758	11	0.2	451.8993	3	78.50	3	35411	20190523-10-H3.raw	1.89E7	2	2	443	453	Carbamidomethylation
R.AGIREVHFLPFNPVDKR.T	N	31.94	1994.0850	17	1.4	399.8248	5	95.63	3	49990	20190523-10-H3.raw	1.43E7	2	2	390	406
K.TGTLTLNK.L	N	31.81	846.4811	8	1.5	424.2484	2	63.83	3	23435	20190523-10-H3.raw	8.7E6	1	1	331	338
R.LSQQGAITK.R	N	31.21	944.5291	9	0.6	473.2721	2	55.61	3	16775	20190523-10-H3.raw	1.87E6	1	1	304	312
R.EAQWAQAQR.T	N	30.94	1086.5206	9	3.1	544.2693	2	63.20	3	22919	20190523-10-H3.raw	7.98E5	1	1	872	880
K.DQVLLFAAMASR.V	N	29.91	1320.6860	12	-2.1	661.3489	2	128.74	3	79782	20190523-10-H3.raw	1.9E6	1	1	356	367
R.VKPSPTPDSWK.L	N	29.57	1240.6451	11	1.0	414.5561	3	66.43	3	25545	20190523-10-H3.raw	4.21E7	4	4	695	705
K.AWASLFDNR.T	Y	29.49	1078.5195	9	0.0	540.2670	2	108.65	3	61396	20190523-10-H3.raw	2.59E7	1	1	849	857
K.NLVEVFC(+57.02)K.G	N	29.27	1007.5110	8	-0.3	504.7626	2	96.47	3	50750	20190523-10-H3.raw	5.65E7	1	1	344	351	Carbamidomethylation
K.GLDIDTAGHHYTV	Y	28.09	1397.6575	13	-4.6	699.8328	2	89.06	3	44391	20190523-10-H3.raw	8.77E6	1	1	937	949
R.KHIVGMTGDGVNDAPALKK.A	N	27.22	1950.0356	19	-0.2	391.0143	5	68.12	3	26961	20190523-10-H3.raw	8.75E6	2	2	580	598
R.LLEGDPLK.V	N	26.58	883.5015	8	0.7	442.7583	2	83.75	3	39907	20190523-10-H3.raw	5.96E7	1	1	168	175
R.IVIFGPNK.L	Y	25.57	886.5276	8	-0.2	444.2710	2	87.24	3	42802	20190523-10-H3.raw	1.16E7	1	1	42	49
K.GAPEQILDLANARPDLRK.K	Y	24.69	1976.0802	18	-0.7	495.0270	4	102.49	3	55893	20190523-10-H3.raw	1.37E7	1	1	424	441
R.IVIFGPNKLEEKK.E	Y	23.81	1513.8867	13	1.3	379.4795	4	80.70	3	37285	20190523-10-H3.raw	6.3E6	1	1	42	54
R.ALNLGVNVK.M	N	23.15	926.5549	9	-1.8	464.2839	2	85.11	3	41019	20190523-10-H3.raw	6.81E7	1	1	500	508
total 58 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
K.AAGATWIQLDEPVLVMDLEGQK.L	Y	61.48	2383.2092	22	1.5	795.4116	3	148.49	3	98017	20190523-10-H3.raw	6.68E7	3	3	197	218
R.NIWANDFAASLSTLQALEGIVGKDK.L	Y	60.56	2660.3809	25	0.8	887.8016	3	154.74	3	103876	20190523-10-H3.raw	1.37E7	2	2	297	321
K.MLAVLEQNILWVNPDC(+57.02)GLK.T	N	59.57	2212.1384	19	-0.1	1107.0764	2	144.56	3	94429	20190523-10-H3.raw	1.46E8	7	7	718	736	Carbamidomethylation
R.HETC(+57.02)YQIALAIKDEVEDLEK.G	N	57.19	2403.1628	20	0.6	802.0621	3	129.39	3	80373	20190523-10-H3.raw	2.97E7	3	3	577	596	Carbamidomethylation
R.NIWANDFAASLSTLQALEGIVGK.D	Y	56.21	2417.2590	23	6.3	1209.6444	2	157.04	3	106050	20190523-10-H3.raw	3.08E7	2	2	297	319
K.LVVSTSC(+57.02)SLLHTAVDLINETKLDDEIK.S	Y	56.19	3012.5688	27	1.4	1005.1983	3	141.96	3	92033	20190523-10-H3.raw	2.11E6	1	1	322	348	Carbamidomethylation
K.ALAGQKDEALFSANAAALASR.R	Y	55.16	2074.0806	21	1.5	692.3685	3	102.15	3	55596	20190523-10-H3.raw	1.25E8	3	3	367	387
K.ALGVDTVPVLVGPVSYLLLSK.A	Y	55.13	2139.2554	21	-0.9	714.0917	3	154.84	3	103972	20190523-10-H3.raw	2.17E8	3	3	146	166
K.LNLPILPTTTIGSFPQTVELR.R	N	54.13	2309.2993	21	1.5	770.7749	3	146.08	3	95798	20190523-10-H3.raw	1.36E8	5	5	427	447
K.WFDTNYHYIVPELGPEVNFSYASHK.A	Y	54.13	3012.4082	25	0.8	1005.1441	3	129.40	3	80376	20190523-10-H3.raw	1.28E8	5	5	112	136
K.KLNLPILPTTTIGSFPQTVELR.R	N	53.28	2437.3943	22	1.5	813.4733	3	133.76	3	84410	20190523-10-H3.raw	1.12E8	3	3	426	447
K.LVVSTSC(+57.02)SLLHTAVDLINETK.L	N	50.12	2299.2092	21	1.3	767.4113	3	136.92	3	87358	20190523-10-H3.raw	8.06E7	3	3	322	342	Carbamidomethylation
K.VVDLQEELDIDVLVHGEPER.N	Y	49.96	2303.1646	20	2.1	768.7304	3	128.47	3	79539	20190523-10-H3.raw	4.17E5	1	1	474	493
K.YGAGIGPGVYDIHSPR.I	N	49.86	1657.8212	16	0.4	829.9182	2	91.32	3	46266	20190523-10-H3.raw	2.83E8	4	4	689	704
K.FIPSNTFAHYDQVLDTTAMLGAVPPR.Y	Y	49.15	2860.4216	26	1.6	954.4827	3	133.98	3	84608	20190523-10-H3.raw	1.97E8	8	8	56	81
K.AMTVFWSAMAQSMTSRPMK.G	Y	48.52	2159.9988	19	-0.5	721.0065	3	126.20	3	77462	20190523-10-H3.raw	1.93E7	2	2	537	555
K.GMLTGPVTILNWSFVR.N	N	47.87	1789.9548	16	-0.2	895.9846	2	150.22	3	99622	20190523-10-H3.raw	7.96E7	4	4	556	571
R.C(+57.02)VKPPVIYGDVSRPK.A	N	46.96	1713.9236	15	0.5	572.3154	3	75.89	3	33290	20190523-10-H3.raw	1.62E8	5	5	522	536	Carbamidomethylation
K.FALESFWDGKSTAEDLQK.V	Y	45.02	2070.9897	18	0.9	691.3378	3	118.22	3	70065	20190523-10-H3.raw	3.12E7	2	2	19	36
K.SEHAFYLDWAVHSFR.I	Y	43.45	1863.8693	15	0.1	466.9746	4	115.23	3	67314	20190523-10-H3.raw	3.63E7	3	3	618	632
K.GVTAFGFDLVR.G	N	41.97	1180.6240	11	2.6	591.3208	2	122.44	3	73931	20190523-10-H3.raw	1.26E8	3	3	260	270
K.LDDEIKSWLAFAAQK.V	Y	41.56	1733.8988	15	-0.2	578.9734	3	130.58	3	81453	20190523-10-H3.raw	1.47E6	1	1	343	357
R.GNASVPAMEMTK.W	N	41.38	1234.5686	12	0.5	618.2919	2	78.45	3	35367	20190523-10-H3.raw	1.25E8	2	2	100	111
K.LNLPILPTTTIGSFPQTVELRR.V	N	41.22	2465.4006	22	-0.9	822.8068	3	134.49	3	85084	20190523-10-H3.raw	1.79E7	1	1	427	448
K.DKLVVSTSC(+57.02)SLLHTAVDLINETKLDDEIK.S	Y	40.83	3255.6907	29	-2.9	814.9276	4	142.46	3	92491	20190523-10-H3.raw	4.88E6	2	2	320	348	Carbamidomethylation
K.LVVSTSC(+57.02)SLLHTAVDLINETKLDDEIKSWLAFAAQK.V	Y	40.83	4015.0977	36	0.7	804.0273	5	154.71	3	103848	20190523-10-H3.raw	3.31E6	1	1	322	357	Carbamidomethylation
K.SFELLSLLPK.I	Y	40.01	1145.6696	10	0.5	573.8423	2	140.34	3	90513	20190523-10-H3.raw	2.72E8	4	4	174	183
K.GM(+15.99)LTGPVTILNWSFVR.N	N	39.98	1805.9498	16	3.7	903.9855	2	142.74	3	92749	20190523-10-H3.raw	0	1	1	556	571	Oxidation (M)
K.GGIGVIQIDEAALR.E	N	39.97	1410.7831	14	2.3	706.4005	2	115.11	3	67218	20190523-10-H3.raw	1.59E8	1	1	597	610
K.GVDKSFELLSLLPK.I	Y	39.24	1544.8813	14	-0.1	515.9677	3	130.78	3	81636	20190523-10-H3.raw	1.24E6	1	1	170	183
K.FALESFWDGK.S	N	37.86	1198.5658	10	-0.1	600.2901	2	126.40	3	77645	20190523-10-H3.raw	7.48E7	1	1	19	28
K.KLNLPILPTTTIGSFPQTVELRR.V	N	37.26	2593.4956	23	2.3	649.3827	4	123.99	3	75378	20190523-10-H3.raw	4.11E7	2	2	426	448
K.DEALFSANAAALASR.R	Y	36.82	1505.7473	15	-1.2	753.8801	2	110.76	3	63290	20190523-10-H3.raw	2.24E7	1	1	373	387
K.YTEVKPALK.N	N	35.55	1047.5964	9	0.4	524.8057	2	61.37	3	21486	20190523-10-H3.raw	4.06E7	3	3	740	748
F.TANGWVQSYGSR.C	N	35.46	1324.6160	12	-1.3	663.3144	2	80.40	3	37033	20190523-10-H3.raw	2.01E6	1	1	510	521
R.IPSSEEIADR.V	Y	33.60	1115.5458	10	1.7	558.7811	2	70.83	3	29112	20190523-10-H3.raw	7.25E7	2	2	705	714
R.IPSSEEIADRVNK.M	Y	33.17	1456.7521	13	0.6	486.5916	3	75.61	3	33041	20190523-10-H3.raw	5.09E7	1	1	705	717
R.KYTEVKPALK.N	N	31.54	1175.6914	10	0.3	392.9045	3	57.09	3	17975	20190523-10-H3.raw	8.3E6	1	1	739	748
K.ILPIYKEVITELK.A	Y	30.72	1557.9381	13	-0.2	520.3199	3	120.32	3	71993	20190523-10-H3.raw	3.1E6	1	1	184	196
K.ALGVDTVPVLVGPVSY.L	Y	30.64	1584.8762	16	1.4	793.4465	2	144.49	3	94367	20190523-10-H3.raw	5.5E5	1	1	146	161
K.SWLAFAAQK.V	N	30.09	1020.5392	9	-0.4	511.2767	2	104.82	3	57998	20190523-10-H3.raw	3.06E7	2	2	349	357
K.VVEVNALAK.A	N	30.08	941.5546	9	0.8	471.7849	2	75.05	3	32574	20190523-10-H3.raw	1.32E8	2	2	358	366
K.VSEEDYVK.A	Y	29.32	967.4498	8	1.2	484.7328	2	65.97	3	25154	20190523-10-H3.raw	3.03E7	1	1	458	465
K.YLFAGVVDGR.N	N	27.47	1095.5713	10	-2.4	548.7916	2	104.51	3	57733	20190523-10-H3.raw	1.6E8	1	1	287	296
R.C(+57.02)VKPPVIYGDVSR.P	N	26.91	1488.7759	13	3.5	497.2676	3	81.95	3	38385	20190523-10-H3.raw	1.02E7	1	1	522	534	Carbamidomethylation
K.AMTVFWSAMAQSMTSR.P	Y	25.82	1803.8107	16	1.9	602.2786	3	135.54	3	86072	20190523-10-H3.raw	4.2E6	1	1	537	552
K.LLSVFR.E	N	23.54	733.4486	6	0.2	367.7317	2	92.22	3	47027	20190523-10-H3.raw	1.29E8	2	2	679	684
K.KVSEEDYVK.A	Y	22.94	1095.5448	9	1.4	366.1894	3	57.88	3	18647	20190523-10-H3.raw	3.91E6	1	1	457	465
K.FIPSNTY(sub F)AHF(sub Y)DQVLDTTAMLGAVPPR.Y	Y	22.73	2860.4216	26	1.7	716.1139	4	133.77	3	84422	20190523-10-H3.raw	3.38E7	1	1	56	81
K.EVITELK.A	N	22.46	830.4749	7	-0.6	416.2445	2	73.56	3	31347	20190523-10-H3.raw	8.06E7	1	1	190	196
K.TLDLVK.A	N	21.47	687.4167	6	-0.1	344.7156	2	73.53	3	31328	20190523-10-H3.raw	3.76E7	1	1	274	279
total 51 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
R.IPSAVGYQPTLASDLGALQER.I	N	59.52	2185.1379	21	0.2	1093.5764	2	123.13	3	74567	20190523-10-H3.raw	9.92E8	5	5	352	372
K.IGLFGGAGVGKTVLIMELINNVAK.A	N	59.43	2413.3767	24	-0.2	805.4660	3	152.83	3	102052	20190523-10-H3.raw	2.64E7	2	2	227	250
R.DAPALVDLATGQEILATGIK.V	N	57.89	1995.0887	20	-0.1	998.5516	2	144.79	3	94636	20190523-10-H3.raw	7.71E8	9	9	194	213
K.ENINSFQGLLDGKYDDLSEQSFYMVGGIDEVVAK.A	N	57.72	3779.7876	34	1.6	1260.9385	3	151.22	3	100538	20190523-10-H3.raw	6.27E7	4	4	513	546
K.NLQDIIAILGMDELSEDDKLTVAR.A	N	56.48	2671.3738	24	1.8	891.4668	3	153.88	3	103058	20190523-10-H3.raw	8E8	13	13	460	483
R.FEDQEGLPPIMTSLEVQDHPTR.L	N	55.91	2538.2061	22	0.8	847.0766	3	121.17	3	72759	20190523-10-H3.raw	8.25E8	8	8	98	119
K.YDDLSEQSFYMVGGIDEVVAK.A	N	54.93	2364.0830	21	1.3	1183.0503	2	136.83	3	87274	20190523-10-H3.raw	2.21E7	5	5	526	546
K.NLQDIIAILGM(+15.99)DELSEDDKLTVAR.A	N	53.98	2687.3687	24	-0.3	1344.6912	2	150.23	3	99633	20190523-10-H3.raw	1.31E8	7	7	460	483	Oxidation (M)
K.VLQNYKNLQDIIAILGMDELSEDDKLTVAR.A	N	53.79	3416.7861	30	-0.2	855.2036	4	148.98	3	98481	20190523-10-H3.raw	3.32E7	1	1	454	483
K.NLQDIIAILGMDELSEDDK.L	N	53.76	2131.0354	19	0.2	711.3525	3	155.26	3	104373	20190523-10-H3.raw	1.92E7	2	2	460	478
R.QISELGIYPAVDPLDSTSR.M	N	52.35	2060.0425	19	1.2	1031.0298	2	125.74	3	77030	20190523-10-H3.raw	6.09E8	4	4	415	433
K.AHGGFSVFAGVGER.T	N	51.93	1389.6790	14	-0.2	695.8466	2	91.27	3	46220	20190523-10-H3.raw	4.82E8	10	10	251	264
K.C(+57.02)ALVYGQMNEPPGAR.A	N	51.78	1661.7654	15	-0.1	554.9290	3	89.56	3	44795	20190523-10-H3.raw	4.71E8	14	14	292	306	Carbamidomethylation
R.MLSPHILGEEHYNTAR.G	N	51.42	1866.9047	16	1.6	623.3098	3	82.40	3	38790	20190523-10-H3.raw	8.13E8	6	6	434	449
R.LVLEVSHHLGQNVVR.T	N	51.11	1698.9529	15	0.8	850.4844	2	85.05	3	40968	20190523-10-H3.raw	6.96E8	11	11	120	134
K.IGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGER.T	N	49.91	3785.0449	38	0.6	758.0167	5	153.24	3	102451	20190523-10-H3.raw	3.83E6	1	1	227	264
R.DAEGQDVLLFIDNIFR.F	N	48.28	1863.9366	16	1.0	932.9765	2	158.44	3	107346	20190523-10-H3.raw	7.8E7	3	3	322	337
R.KVLNTGAPITVPVGR.A	N	48.27	1520.9038	15	0.2	761.4594	2	87.16	3	42740	20190523-10-H3.raw	2.18E8	2	2	149	163
R.VGLTGLTVAEYFR.D	N	47.83	1424.7664	13	0.0	713.3904	2	128.42	3	79491	20190523-10-H3.raw	3.26E8	4	4	309	321
R.FTQANSEVSALLGR.I	N	47.35	1491.7681	14	2.0	746.8928	2	107.20	3	60102	20190523-10-H3.raw	6.37E8	5	5	338	351
R.EGNDLYREMIESGVIK.L	N	46.61	1851.9036	16	0.2	618.3086	3	116.30	3	68280	20190523-10-H3.raw	5.84E7	3	3	267	282
R.DAEGQDVLLFIDNIY(sub F)R.F	N	46.10	1879.9315	16	-0.3	940.9728	2	155.60	3	104699	20190523-10-H3.raw	2.67E6	1	1	322	337
Y.ATSSPASSAAPSSAPAKDEGKK.T	Y	45.86	2044.0072	22	-1.3	682.3421	3	52.62	3	14635	20190523-10-H3.raw	2.02E8	2	2	52	73
K.TVLIMELINNVAK.A	N	45.76	1456.8323	13	0.7	729.4239	2	145.85	3	95581	20190523-10-H3.raw	7.94E8	18	18	238	250
Y.ATSSPASSAAPSSAPAK.D	Y	45.65	1486.7263	17	1.3	744.3714	2	58.44	3	19136	20190523-10-H3.raw	8.21E7	3	3	52	68
K.VLNTGAPITVPVGR.A	N	45.27	1392.8088	14	0.4	697.4120	2	98.07	3	52037	20190523-10-H3.raw	6.24E8	6	6	150	163
R.FLSQPFHVAEIFTGAPGK.Y	N	44.70	1945.0098	18	-2.7	649.3421	3	121.59	3	73141	20190523-10-H3.raw	0	1	1	490	507
R.DAEGQDVLLY(sub F)IDNIFR.F	N	43.93	1879.9315	16	1.2	940.9742	2	156.39	3	105444	20190523-10-H3.raw	8.22E5	1	1	322	337
Y.ATSSPASSAAPSSAPAKDEGK.K	Y	42.83	1915.9122	21	0.7	639.6451	3	56.65	3	17609	20190523-10-H3.raw	1.06E8	2	2	52	72
R.FEDQEGLPPIM(+15.99)TSLEVQDHPTR.L	N	42.56	2554.2009	22	2.0	852.4093	3	105.83	3	58888	20190523-10-H3.raw	2.88E7	2	2	98	119	Oxidation (M)
R.FTQANSEVSALLGRIPSAVGYQPTLASDLGALQER.I	N	42.03	3658.8955	35	-2.1	915.7292	4	144.77	3	94624	20190523-10-H3.raw	7.32E6	1	1	338	372
R.VC(+57.02)QVIGAIVDVR.F	N	41.08	1327.7281	12	1.0	443.5838	3	107.35	3	60240	20190523-10-H3.raw	2.94E8	4	4	86	97	Carbamidomethylation
R.IMNVLGEPIDER.G	N	41.00	1384.7020	12	0.2	693.3584	2	104.62	3	57820	20190523-10-H3.raw	5.31E8	3	3	169	180
K.NLQDIIAILGM(+15.99)DELSEDDK.L	N	39.79	2147.0303	19	-0.4	1074.5220	2	153.10	3	102315	20190523-10-H3.raw	2.96E6	1	1	460	478	Oxidation (M)
K.TEHYLPIHR.D	N	39.63	1164.6040	9	0.8	389.2089	3	64.24	3	23755	20190523-10-H3.raw	1.54E8	4	4	185	193
K.ENINSFQGLLDGK.Y	N	39.62	1433.7150	13	-4.4	717.8616	2	112.61	3	64964	20190523-10-H3.raw	7.83E7	1	1	513	525
R.IMNVLGEPIDERGEIK.T	N	39.40	1811.9451	16	1.0	604.9896	3	101.36	3	54876	20190523-10-H3.raw	2.11E8	3	3	169	184
K.TVLIM(+15.99)ELINNVAK.A	N	39.36	1472.8273	13	-0.7	737.4204	2	131.39	3	82198	20190523-10-H3.raw	1.77E7	2	2	238	250	Oxidation (M)
K.TYDYGGKGAIGR.V	N	38.82	1256.6149	12	-0.1	419.8789	3	65.02	3	24410	20190523-10-H3.raw	7E6	1	1	74	85
R.M(+15.99)LSPHILGEEHYNTAR.G	N	38.10	1882.8995	16	-0.5	471.7319	4	82.25	3	38661	20190523-10-H3.raw	1.03E7	1	1	434	449	Oxidation (M)
K.VVDLLAPYQR.G	N	38.08	1172.6553	10	0.2	587.3350	2	104.94	3	58107	20190523-10-H3.raw	8.14E8	6	6	214	223
R.IMNVLGEPIDERGEIKTEHYLPIHR.D	N	37.94	2958.5386	25	0.6	592.7153	5	102.33	3	55757	20190523-10-H3.raw	4.85E8	5	5	169	193
R.TREGNDLYREMIESGVIK.L	N	37.73	2109.0525	18	1.4	528.2711	4	105.03	3	58195	20190523-10-H3.raw	4.06E7	2	2	265	282
R.TIAMDGTEGLVR.G	N	36.65	1261.6337	12	0.4	631.8243	2	92.41	3	47191	20190523-10-H3.raw	6.75E8	3	3	135	146
K.ENINSFQGLLDGKYDDLSEQSFYM(+15.99)VGGIDEVVAK.A	N	36.61	3795.7825	34	1.4	1266.2699	3	143.24	3	93213	20190523-10-H3.raw	2.68E6	1	1	513	546	Oxidation (M)
H.ILGEEHYNTAR.G	N	36.53	1301.6364	11	1.0	651.8261	2	65.66	3	24913	20190523-10-H3.raw	3.85E8	3	3	439	449
R.VC(+57.02)QVIGAIVDVRFEDQEGLPPIMTSLEVQDHPTR.L	N	34.10	3847.9236	34	1.4	962.9896	4	140.35	3	90529	20190523-10-H3.raw	6.65E6	2	2	86	119	Carbamidomethylation
R.Y(sub F)EDQEGLPPIMTSLEVQDHPTR.L	N	34.02	2554.2009	22	-0.9	852.4069	3	118.57	3	70400	20190523-10-H3.raw	9.64E4	1	1	98	119
K.IGLFGGAGVGK.T	N	33.77	974.5549	11	-0.5	488.2845	2	96.51	3	50781	20190523-10-H3.raw	1.17E9	4	4	227	237
K.C(+57.02)ALVYGQM(+15.99)NEPPGAR.A	N	30.75	1677.7603	15	2.2	839.8893	2	80.64	3	37236	20190523-10-H3.raw	9.31E5	3	3	292	306	Carbamidomethylation; Oxidation (M)
R.EMIESGVIK.L	N	29.77	1004.5212	9	0.5	503.2681	2	80.40	3	37029	20190523-10-H3.raw	4.93E8	3	3	274	282
Y.ATSSPASSAAPSSAPAKDEGKKTYDYGGK.G	Y	29.11	2828.3464	29	1.9	566.6776	5	62.54	3	22378	20190523-10-H3.raw	1.66E7	1	1	52	80
K.KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR.Q	N	29.07	3841.9736	37	-3.4	961.4974	4	134.02	3	84648	20190523-10-H3.raw	4.75E6	1	1	378	414
R.DAPALVDLATGQEILATGIKVVDLLAPYQRGGK.I	N	29.06	3391.8713	33	1.8	848.9766	4	156.45	3	105500	20190523-10-H3.raw	1.27E6	1	1	194	226
F.AHLDATTVLSR.Q	N	28.05	1182.6356	11	1.1	592.3257	2	77.92	3	34923	20190523-10-H3.raw	3.6E6	1	1	404	414
R.IM(+15.99)NVLGEPIDER.G	N	27.24	1400.6969	12	-0.5	701.3554	2	104.62	3	57824	20190523-10-H3.raw	5.71E5	1	1	169	180	Oxidation (M)
R.TIAM(+15.99)DGTEGLVR.G	N	26.97	1277.6285	12	4.3	639.8243	2	80.27	3	36918	20190523-10-H3.raw	1.46E7	2	2	135	146	Oxidation (M)
A.PSSAPAKDEGKK.T	N	26.66	1213.6302	12	-3.8	607.8201	2	52.64	3	14655	20190523-10-H3.raw	0	2	2	62	73
R.IM(+15.99)NVLGEPIDERGEIKTEHYLPIHR.D	N	26.08	2974.5334	25	-0.4	496.7626	6	102.15	3	55597	20190523-10-H3.raw	3.95E6	1	1	169	193	Oxidation (M)
K.IGLY(sub F)GGAGVGK.T	N	25.42	990.5498	11	2.8	496.2836	2	85.29	3	41163	20190523-10-H3.raw	9.05E6	1	1	227	237
R.EM(+15.99)IESGVIK.L	N	23.01	1020.5161	9	-0.1	511.2653	2	70.93	3	29201	20190523-10-H3.raw	1.08E7	1	1	274	282	Oxidation (M)
K.GSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQISELGIYPAVDPLDSTSR.M	N	22.55	5755.9106	55	0.3	1439.9854	4	153.32	3	102520	20190523-10-H3.raw	0	1	1	379	433
R.DAPALVDLATGQEILATGIKVVDLLAPYQR.G	N	22.53	3149.7334	30	1.4	788.4417	4	158.62	3	107512	20190523-10-H3.raw	2.11E6	1	1	194	223
K.GSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR.Q	N	21.99	3713.8787	36	-3.0	1238.9631	3	139.60	3	89816	20190523-10-H3.raw	2.59E8	1	1	379	414
H.LDATTVLSR.Q	N	20.75	974.5397	9	3.2	488.2787	2	87.39	3	42914	20190523-10-H3.raw	4.92E6	1	1	406	414
total 65 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
R.VQLAETYLSQAALGDANADAIGR.G	N	65.01	2346.1814	23	0.8	1174.0989	2	122.82	3	74286	20190523-10-H3.raw	4.85E8	9	9	410	432
K.IKDEDIVTLVDQFPGQSIDFFGALR.A	N	63.69	2822.4490	25	1.7	1412.2341	2	153.51	3	102703	20190523-10-H3.raw	2.91E8	3	3	325	349
R.VPIIC(+57.02)TGNDFSTLYAPLIR.D	N	60.14	2149.1240	19	1.3	1075.5707	2	140.27	3	90446	20190523-10-H3.raw	6.74E8	5	5	278	296	Carbamidomethylation
K.NFLTLPNIKVPLILGIWGGK.G	N	59.81	2192.3086	20	1.0	1097.1627	2	153.51	3	102709	20190523-10-H3.raw	9.08E7	2	2	148	167
K.MGINPIMMSAGELESGNAGEPAK.L	N	59.61	2303.0596	23	0.5	1152.5376	2	122.10	3	73615	20190523-10-H3.raw	5.09E8	5	5	182	204
R.QYNLDNMMDGFYIAPAFMDK.L	N	58.42	2383.0322	20	-0.4	1192.5229	2	151.80	3	101077	20190523-10-H3.raw	1.53E8	4	4	121	140
R.TDKIKDEDIVTLVDQFPGQSIDFFGALR.A	N	58.25	3166.6187	28	0.1	792.6620	4	150.28	3	99675	20190523-10-H3.raw	7.17E7	5	5	322	349
R.MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK.E	N	57.56	3942.8374	36	0.7	1315.2874	3	144.17	3	94073	20190523-10-H3.raw	5.04E7	1	1	237	272
K.EENARVPIIC(+57.02)TGNDFSTLYAPLIR.D	N	56.38	2748.3904	24	-0.4	917.1370	3	132.76	3	83476	20190523-10-H3.raw	2.18E7	2	2	273	296	Carbamidomethylation
K.RVQLAETYLSQAALGDANADAIGR.G	N	55.79	2502.2827	24	0.6	835.1020	3	112.38	3	64754	20190523-10-H3.raw	2.99E7	2	2	409	432
K.MGINPIM(+15.99)MSAGELESGNAGEPAK.L	N	55.22	2319.0544	23	-0.4	1160.5341	2	114.06	3	66277	20190523-10-H3.raw	2.1E7	1	1	182	204	Oxidation (M)
K.GAQQVNLPVPEGC(+57.02)TDPVAENFDPTAR.S	Y	54.85	2781.3027	26	1.0	1391.6600	2	118.28	3	70124	20190523-10-H3.raw	1.53E8	4	4	439	464	Carbamidomethylation
K.GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR.Q	N	53.51	3323.5703	31	-0.7	1108.8633	3	122.76	3	74227	20190523-10-H3.raw	4.14E8	4	4	90	120
R.MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENAR.V	N	53.20	4542.1035	41	0.6	1136.5338	4	135.81	3	86322	20190523-10-H3.raw	7.1E7	4	4	237	277
R.EGPPVFEQPEMTYEK.L	N	53.02	1779.8025	15	1.4	890.9098	2	102.72	3	56101	20190523-10-H3.raw	4.48E8	2	2	378	392
K.M(+15.99)GINPIMMSAGELESGNAGEPAK.L	N	52.79	2319.0544	23	2.3	1160.5371	2	116.34	3	68317	20190523-10-H3.raw	1.59E7	3	3	182	204	Oxidation (M)
K.MC(+57.02)C(+57.02)LFINDLDAGAGR.M	N	52.64	1711.7480	15	1.0	856.8821	2	117.88	3	69743	20190523-10-H3.raw	4.44E8	4	4	222	236	Carbamidomethylation
K.LMEYGNMLVMEQENVK.R	N	52.19	1926.8889	16	0.8	964.4525	2	116.80	3	68745	20190523-10-H3.raw	7.29E7	4	4	393	408
K.MGINPIMM(+15.99)SAGELESGNAGEPAK.L	N	51.48	2319.0544	23	0.0	1160.5345	2	113.72	3	65968	20190523-10-H3.raw	2.1E7	2	2	182	204	Oxidation (M)
K.LMEYGNMLVMEQENVKR.V	N	50.65	2082.9900	17	1.3	1042.5037	2	106.17	3	59212	20190523-10-H3.raw	2.27E8	4	4	393	409
R.GLAYDTSDDQQDITR.G	N	50.39	1696.7540	15	0.7	849.3849	2	83.84	3	39992	20190523-10-H3.raw	3.99E8	4	4	73	87
R.EGPPVFEQPEMTYEKLMEYGNMLVMEQENVKR.V	N	46.82	3844.7820	32	-9.8	962.1934	4	150.36	3	99744	20190523-10-H3.raw	0	1	1	378	409
K.GM(+15.99)VDSVFQAPMGTGTHHAVLSSYEYVSQGLR.Q	N	44.94	3339.5652	31	0.5	835.8990	4	116.45	3	68424	20190523-10-H3.raw	3.93E7	1	1	90	120	Oxidation (M)
R.EGPPVFEQPEM(+15.99)TYEK.L	N	44.51	1795.7974	15	1.7	898.9075	2	93.47	3	48117	20190523-10-H3.raw	1.78E7	2	2	378	392	Oxidation (M)
R.QYNLDNM(+15.99)MDGFYIAPAFMDK.L	N	44.06	2399.0271	20	-1.2	1200.5194	2	138.86	3	89153	20190523-10-H3.raw	4.72E6	2	2	121	140	Oxidation (M)
R.EGPPVFEQPEMTYEKLMEYGNMLVMEQENVK.R	N	41.33	3688.6809	31	-0.4	1230.5671	3	153.47	3	102669	20190523-10-H3.raw	1.91E6	1	1	378	408
R.MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENARVPIIC(+57.02)TGNDFSTLYAPLIR.D	N	38.57	6673.2173	60	-0.7	1335.6498	5	151.62	3	100904	20190523-10-H3.raw	0	1	1	237	296	Carbamidomethylation
K.SFQC(+57.02)ELVMAK.M	N	37.84	1211.5679	10	1.1	606.7919	2	92.84	3	47556	20190523-10-H3.raw	4.35E8	4	4	172	181	Carbamidomethylation
K.FYWAPTREDR.I	N	37.34	1339.6309	10	1.5	670.8237	2	83.18	3	39434	20190523-10-H3.raw	2.01E8	4	4	303	312
K.DEDIVTLVDQFPGQSIDFFGALR.A	N	36.35	2581.2700	23	2.5	1291.6455	2	156.92	3	105941	20190523-10-H3.raw	4.05E5	1	1	327	349
K.LMEYGNM(+15.99)LVMEQENVK.R	N	35.99	1942.8839	16	-0.3	972.4489	2	103.71	3	57016	20190523-10-H3.raw	7.5E5	1	1	393	408	Oxidation (M)
K.LM(+15.99)EYGNMLVMEQENVKR.V	N	35.15	2098.9849	17	2.5	700.6707	3	98.89	3	52757	20190523-10-H3.raw	7.02E6	1	1	393	409	Oxidation (M)
K.VPLILGIWGGK.G	N	34.57	1151.7067	11	0.8	576.8611	2	132.55	3	83281	20190523-10-H3.raw	2.88E8	3	3	157	167
R.QYNLDNMMDGFYIAPAFM(+15.99)DK.L	N	33.28	2399.0271	20	3.7	1200.5253	2	145.13	3	94954	20190523-10-H3.raw	6.09E6	2	2	121	140	Oxidation (M)
M.SAGELESGNAGEPAK.L	N	32.95	1415.6528	15	0.0	708.8337	2	61.63	3	21668	20190523-10-H3.raw	4.05E6	2	2	190	204
K.IKDEDIVTLVDQFPGQSIDY(sub F)FGALR.A	N	32.31	2838.4438	25	3.5	947.1586	3	151.56	3	100849	20190523-10-H3.raw	2.36E6	1	1	325	349
R.KFVESLGVEK.I	N	32.30	1134.6284	10	1.3	568.3222	2	73.26	3	31121	20190523-10-H3.raw	1.81E8	3	3	359	368
K.SFQC(+57.02)ELVM(+15.99)AK.M	N	32.27	1227.5627	10	0.9	614.7892	2	83.55	3	39728	20190523-10-H3.raw	2.47E7	1	1	172	181	Carbamidomethylation; Oxidation (M)
R.YREAADLIKK.G	N	30.93	1205.6768	10	-0.2	302.4264	4	62.04	3	21978	20190523-10-H3.raw	2.53E7	3	3	210	219
K.NFLTLPNIK.V	N	30.35	1058.6124	9	0.1	530.3135	2	113.74	3	65987	20190523-10-H3.raw	2.84E8	2	2	148	156
K.LMEYGNM(+15.99)LVM(+15.99)EQENVKR.V	N	28.82	2114.9800	17	-0.4	706.0003	3	90.72	3	45738	20190523-10-H3.raw	7.13E6	1	1	393	409	Oxidation (M)
R.QYNLDNMM(+15.99)DGFYIAPAFMDK.L	N	28.82	2399.0271	20	-1.8	800.6815	3	138.99	3	89264	20190523-10-H3.raw	1.16E6	1	1	121	140	Oxidation (M)
K.FYWAPTR.E	N	28.48	939.4603	7	-0.3	470.7373	2	93.10	3	47781	20190523-10-H3.raw	2.02E8	2	2	303	309
K.FVESLGVEK.I	N	27.32	1006.5334	9	1.9	504.2749	2	81.97	3	38402	20190523-10-H3.raw	2.99E8	2	2	360	368
R.YREAADLIK.K	N	26.64	1077.5818	9	0.3	360.2013	3	69.22	3	27866	20190523-10-H3.raw	5.76E7	2	2	210	218
R.SDDGTC(+57.02)VYNF	Y	26.43	1176.4393	10	0.5	589.2272	2	105.76	3	58831	20190523-10-H3.raw	3.19E7	1	1	465	474	Carbamidomethylation
R.QF(sub Y)NLDNMM(+15.99)DGFYIAPAFMDK.L	N	26.24	2383.0322	20	-3.1	1192.5197	2	157.25	3	106242	20190523-10-H3.raw	6.53E5	1	1	121	140	Oxidation (M)
K.LVVHITK.N	N	26.02	808.5171	7	1.0	405.2662	2	63.61	3	23265	20190523-10-H3.raw	1.36E7	1	1	141	147
R.EAADLIK.K	N	25.99	758.4174	7	0.8	380.2162	2	66.49	3	25594	20190523-10-H3.raw	2.04E7	1	1	212	218
R.VYDDEVR.K	N	24.68	894.4083	7	0.3	448.2115	2	60.12	3	20467	20190523-10-H3.raw	2.81E7	1	1	352	358
K.GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLRQYNLDNMMDGFYIAPAFMDK.L	N	22.63	5688.5918	51	0.5	1138.7262	5	152.45	3	101691	20190523-10-H3.raw	0	1	1	90	140
R.VYDDEVRKFVESLGVEK.I	N	21.65	2011.0261	17	3.0	671.3513	3	123.86	3	75255	20190523-10-H3.raw	1.72E6	1	1	352	368
K.MGINPIM(+15.99)M(+15.99)SAGELESGNAGEPAK.L	N	21.04	2335.0493	23	1.0	1168.5331	2	103.80	3	57094	20190523-10-H3.raw	0	1	1	182	204	Oxidation (M)
K.NFLTLPNIKVPLILGIWGGKGQGK.S	N	20.37	2562.5049	24	-1.5	641.6325	4	145.55	3	95318	20190523-10-H3.raw	2.78E6	1	1	148	171
R.QYNLDNM(+15.99)MDGFF(sub Y)IAPAFMDKLVVHITK.N	N	20.37	3173.5388	27	1.4	1058.8550	3	152.42	3	101668	20190523-10-H3.raw	0	1	1	121	147	Oxidation (M)
total 55 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
K.LQQC(+57.02)VTDGELSDDNVAALLR.L	Y	59.19	2216.0742	20	0.2	1109.0446	2	121.74	3	73281	20190523-10-H3.raw	8.02E7	3	3	523	542	Carbamidomethylation
K.RDDSEYLLLNQLGGILGLSSK.E	Y	57.97	2290.2168	21	-2.1	1146.1133	2	152.79	3	102021	20190523-10-H3.raw	3.98E7	2	2	746	766
R.VMLC(+57.02)IPQQTVDTAHAEIC(+57.02)GTIFEK.V	Y	57.95	2760.3284	24	1.0	921.1176	3	126.62	3	77853	20190523-10-H3.raw	3.58E7	3	3	545	568	Carbamidomethylation
K.NALGIDEPDAAAMHMEIGR.R	Y	55.61	2009.9298	19	0.7	670.9844	3	108.84	3	61552	20190523-10-H3.raw	3.78E7	3	3	221	239
K.AVPAEPMSWEVSEELSDLYAIYSK.S	Y	54.19	2713.2832	24	-1.4	1357.6470	2	154.72	3	103860	20190523-10-H3.raw	9.21E6	1	1	947	970
R.DDSEYLLLNQLGGILGLSSK.E	Y	52.73	2134.1157	20	3.6	1068.0690	2	157.09	3	106096	20190523-10-H3.raw	1.01E7	2	2	747	766
R.YVTSVLPTEGQSLKGDEVAK.I	Y	51.87	2120.1001	20	0.8	707.7079	3	92.64	3	47384	20190523-10-H3.raw	1.03E8	4	4	196	215
K.VVVENISSALSILK.S	Y	51.29	1470.8657	14	0.6	736.4406	2	130.44	3	81314	20190523-10-H3.raw	4.63E7	2	2	349	362
R.GVGPISLIGDESDFER.R	Y	51.15	1689.8209	16	0.9	845.9185	2	122.47	3	73954	20190523-10-H3.raw	5.36E7	2	2	403	418
R.QKLQQC(+57.02)VTDGELSDDNVAALLR.L	Y	50.54	2472.2278	22	0.9	825.0839	3	111.13	3	63622	20190523-10-H3.raw	4.61E6	1	1	521	542	Carbamidomethylation
R.LATSAVVLAASLATGYGLGLR.L	Y	49.55	2003.1415	21	-0.7	668.7206	3	152.68	3	101911	20190523-10-H3.raw	2.21E7	2	2	93	113
R.LANAVSSGDLEAQDSK.A	Y	49.10	1603.7689	16	2.5	802.8937	2	76.13	3	33495	20190523-10-H3.raw	4.64E7	2	2	478	493
R.LSNSLVQAVALLR.Q	Y	47.20	1382.8245	13	1.1	692.4203	2	127.53	3	78669	20190523-10-H3.raw	7.21E7	4	4	915	927
K.GVVLSLNDLLAC(+57.02)DK.A	Y	46.62	1515.7966	14	-0.1	758.9055	2	130.36	3	81236	20190523-10-H3.raw	5.77E7	2	2	933	946	Carbamidomethylation
R.DAISSGVDGYDAETRK.S	Y	46.13	1682.7747	16	1.2	561.9329	3	79.12	3	35931	20190523-10-H3.raw	3.03E7	2	2	572	587
K.MANAIETAVNQGR.L	Y	45.67	1373.6721	13	0.5	687.8437	2	85.99	3	41735	20190523-10-H3.raw	5.83E7	2	2	827	839
K.VLEFNNLLVSLK.S	Y	45.66	1387.8075	12	0.7	694.9115	2	134.03	3	84652	20190523-10-H3.raw	7.4E7	2	2	381	392
K.EEDDEDEEWGSLESLR.K	Y	45.57	1936.7810	16	1.4	969.3992	2	117.18	3	69102	20190523-10-H3.raw	4.13E6	2	2	671	686
R.LANAVSSGDLEAQDSKAK.Y	Y	45.35	1802.9010	18	1.4	601.9751	3	69.86	3	28348	20190523-10-H3.raw	4.67E6	1	1	478	495
R.GVGPISLIGDESDFERR.M	Y	44.92	1845.9220	17	0.3	616.3148	3	111.68	3	64125	20190523-10-H3.raw	0	1	1	403	419
R.DAISSGVDGYDAETR.K	Y	44.86	1554.6797	15	0.6	778.3476	2	88.52	3	43911	20190523-10-H3.raw	2.33E7	2	2	572	586
K.AGAIHEEIYR.Q	Y	44.12	1157.5829	10	1.6	579.7996	2	66.06	3	25229	20190523-10-H3.raw	4.53E7	3	3	511	520
K.NALGIDEPDAAAMHMEIGRR.I	Y	44.05	2166.0310	20	0.0	542.5150	4	99.63	3	53416	20190523-10-H3.raw	1.41E7	1	1	221	240
R.KVVVENISSALSILK.S	Y	43.31	1598.9607	15	0.5	533.9944	3	115.97	3	67981	20190523-10-H3.raw	2.04E7	2	2	348	362
R.LQYLLGIDDSTATALR.E	Y	43.00	1748.9308	16	1.0	875.4736	2	123.37	3	74799	20190523-10-H3.raw	4.26E7	3	3	983	998
K.LSDELAEDLFR.E	Y	42.69	1306.6404	11	0.7	654.3279	2	121.18	3	72762	20190523-10-H3.raw	6.56E7	2	2	333	343
R.EAEAISVDVTSK.S	Y	42.35	1247.6245	12	0.7	624.8199	2	81.00	3	37552	20190523-10-H3.raw	2.15E7	3	3	461	472
S.AASSDQLSVSTQAK.N	Y	42.04	1391.6892	14	1.2	696.8527	2	66.58	3	25673	20190523-10-H3.raw	7.63E6	1	1	53	66
K.EIVNIHVGLAEQAFR.Q	Y	41.53	1694.9104	15	0.3	565.9776	3	109.18	3	61846	20190523-10-H3.raw	1.7E7	2	2	767	781
K.LC(+57.02)EELHFDAQK.A	Y	41.53	1388.6394	11	0.4	463.8873	3	80.60	3	37199	20190523-10-H3.raw	5.8E7	4	4	500	510	Carbamidomethylation
R.YVTSVLPTEGQSLK.G	Y	41.04	1520.8086	14	1.0	761.4124	2	95.76	3	50095	20190523-10-H3.raw	1.31E7	1	1	196	209
R.AYVTDALSGGRLEENKLVAMSQLR.N	Y	40.97	2620.3643	24	3.9	874.4654	3	114.67	3	66833	20190523-10-H3.raw	5.9E6	1	1	429	452
R.QQAEVILADGQLTK.A	Y	39.92	1512.8147	14	-2.5	757.4127	2	93.83	3	48424	20190523-10-H3.raw	4.62E7	1	1	782	795
K.TVSDIFSSGTGEFDETEVYQTIPSDLSIDVEK.A	Y	39.33	3507.6304	32	-3.6	1170.2131	3	147.20	3	96843	20190523-10-H3.raw	3.53E6	1	1	871	902
K.GDEAFQAEIC(+57.02)DIYC(+57.02)R.Y	Y	39.33	1845.7661	15	-1.8	923.8887	2	117.27	3	69190	20190523-10-H3.raw	3.53E6	1	1	181	195	Carbamidomethylation
R.DINVENLVDLRK.S	Y	38.89	1426.7780	12	0.3	476.6001	3	109.79	3	62403	20190523-10-H3.raw	4.4E7	3	3	315	326
K.QVGLPQPQAEK.V	Y	37.66	1193.6404	11	0.8	597.8279	2	74.07	3	31744	20190523-10-H3.raw	4.95E7	4	4	807	817
K.VTDAQVEIAIR.E	Y	35.58	1213.6666	11	3.7	607.8428	2	90.49	3	45553	20190523-10-H3.raw	6.49E6	2	2	288	298
R.ETAMSIASK.A	Y	35.07	936.4586	9	1.0	469.2371	2	64.63	3	24108	20190523-10-H3.raw	2.29E7	1	1	601	609
K.APEEDPVQEK.E	Y	34.96	1140.5298	10	2.9	571.2738	2	60.20	3	20522	20190523-10-H3.raw	3.08E6	2	2	661	670
K.MGKPGQTEITLK.D	Y	34.82	1301.7013	12	-0.9	434.9073	3	68.80	3	27546	20190523-10-H3.raw	1.99E7	1	1	698	709
K.GESSDKAPEEDPVQEK.E	Y	34.45	1743.7798	16	-0.5	582.2669	3	60.18	3	20507	20190523-10-H3.raw	4.99E6	1	1	655	670
R.IPFGAQITTK.R	Y	33.71	1074.6073	10	1.3	538.3116	2	89.08	3	44407	20190523-10-H3.raw	4.44E7	1	1	736	745
R.LEENKLVAMSQLR.N	Y	33.50	1529.8235	13	0.8	510.9489	3	92.50	3	47267	20190523-10-H3.raw	2.16E7	1	1	440	452
K.FKNALGIDEPDAAAMHMEIGR.R	Y	33.39	2285.0933	21	5.0	572.2834	4	107.10	3	60020	20190523-10-H3.raw	8.54E6	1	1	219	239
K.ARVEQLDELQK.Q	Y	31.87	1327.7095	11	1.2	443.5776	3	72.39	3	30398	20190523-10-H3.raw	1.55E7	1	1	796	806
K.GESSDKAPEEDPVQEKEEDDEDEEWGSLESLR.K	Y	31.71	3662.5503	32	1.9	916.6466	4	105.41	3	58517	20190523-10-H3.raw	4.77E5	1	1	655	686
R.AYVTDALSGGR.L	Y	31.59	1108.5513	11	-1.5	555.2821	2	82.78	3	39139	20190523-10-H3.raw	3.84E7	1	1	429	439
R.VEQLDELQK.Q	Y	31.53	1100.5713	9	0.9	551.2934	2	76.28	3	33637	20190523-10-H3.raw	1.78E7	1	1	798	806
R.YGVNKGDEAFQAEIC(+57.02)DIYC(+57.02)R.Y	Y	30.71	2407.0571	20	3.9	803.3628	3	110.87	3	63387	20190523-10-H3.raw	9.66E6	1	1	176	195	Carbamidomethylation
A.SSDQLSVSTQAK.N	Y	29.13	1249.6150	12	3.2	625.8168	2	64.41	3	23910	20190523-10-H3.raw	2.06E6	1	1	55	66
R.VEQLDELQKQVGLPQPQAEK.V	Y	27.89	2276.2012	20	1.0	759.7418	3	103.34	3	56664	20190523-10-H3.raw	8.44E5	1	1	798	817
K.LVAMSQLR.N	Y	25.69	916.5164	8	-1.1	459.2650	2	80.22	3	36884	20190523-10-H3.raw	3.37E7	1	1	445	452
R.VVHDLAQSR.L	Y	24.64	1023.5461	9	-0.4	342.1892	3	52.82	3	14791	20190523-10-H3.raw	9.36E5	1	1	906	914
K.APEEDPVQEKEEDDEDEEWGSLESLR.K	Y	24.26	3059.3003	26	2.8	1020.7769	3	111.93	3	64352	20190523-10-H3.raw	1.23E5	1	1	661	686
total 55 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
R.YTIHLPTDISEIRPGQDVTVTTDNGK.S	Y	59.95	2869.4458	26	1.0	718.3694	4	111.88	3	64296	20190523-10-H3.raw	2.1E8	3	3	932	957
R.VLLQDFTGVPAVVDLAC(+57.02)MR.D	N	59.50	2103.0857	19	0.3	1052.5504	2	148.07	3	97634	20190523-10-H3.raw	1.95E8	6	6	179	197	Carbamidomethylation
R.ATIANMSPEYGATMGFFPVDHVTLQYLK.L	Y	57.81	3100.5037	28	1.5	1034.5100	3	140.01	3	90208	20190523-10-H3.raw	1.68E8	4	4	390	417
R.DIWPTTEEIAEVVQSSVLPDMFR.A	Y	56.55	2661.2996	23	2.8	1331.6608	2	159.25	3	108095	20190523-10-H3.raw	2.14E7	2	2	684	706
R.FDTEVELAYFNHGGILPYVIR.N	Y	56.37	2452.2427	21	1.3	1227.1302	2	141.01	3	91141	20190523-10-H3.raw	6.68E7	4	4	965	985
K.DAYC(+57.02)LLNFGDSITTDHISPAGNIQK.D	Y	56.16	2749.3018	25	-0.4	917.4409	3	128.60	3	79656	20190523-10-H3.raw	8.7E7	2	2	760	784	Carbamidomethylation
R.VYSSYLELNLDDVEPC(+57.02)ISGPK.R	Y	56.15	2397.1409	21	-0.5	1199.5771	2	132.78	3	83493	20190523-10-H3.raw	4.32E7	2	2	450	470	Carbamidomethylation
K.WGSTAFQNMLVVPPGSGIVHQVNLEYLGR.V	N	55.62	3168.6179	29	0.6	1057.2139	3	141.71	3	91802	20190523-10-H3.raw	1.41E8	5	5	255	283
R.NGVTATDLVLTVTQMLR.K	Y	55.38	1830.9873	17	1.1	916.5020	2	154.86	3	103989	20190523-10-H3.raw	7.89E7	2	2	349	365
K.SGEDADTLGLTGHER.Y	Y	54.25	1556.7067	15	1.0	779.3614	2	74.51	3	32108	20190523-10-H3.raw	1.4E8	3	3	917	931
K.INPLVPVDLVIDHSVQVDVAR.S	N	53.71	2297.2742	21	-1.0	766.7646	3	135.49	3	86021	20190523-10-H3.raw	3.13E8	7	7	210	230
K.HGSVVIAAITSC(+57.02)TNTSNPSVMLGAGLVAK.K	Y	52.82	2854.4680	29	3.4	952.4999	3	123.22	3	74658	20190523-10-H3.raw	1.03E7	2	2	522	550	Carbamidomethylation
R.NGVTATDLVLTVTQMLRK.H	Y	52.27	1959.0823	18	1.0	654.0353	3	147.21	3	96851	20190523-10-H3.raw	1.81E7	3	3	349	366
R.SNLVGMGIIPLC(+57.02)FK.S	N	51.33	1547.8203	14	0.4	774.9177	2	136.42	3	86887	20190523-10-H3.raw	1.26E8	3	3	903	916	Carbamidomethylation
R.SENAVQANMELEFQR.N	N	50.82	1764.8101	15	0.7	883.4129	2	103.76	3	57057	20190523-10-H3.raw	2.46E7	3	3	231	245
R.ANNMFVDYNEPQQDR.V	Y	50.44	1839.7845	15	0.5	920.9000	2	92.20	3	47006	20190523-10-H3.raw	7.69E7	4	4	435	449
K.GIFTTLPKPGGGEFGK.F	Y	48.79	1604.8562	16	0.1	803.4355	2	102.80	3	56173	20190523-10-H3.raw	1.7E8	3	3	101	116
K.FVEFYGNGMSGLSLADR.A	Y	48.58	1861.8668	17	1.7	931.9423	2	123.72	3	75125	20190523-10-H3.raw	4.89E7	5	5	373	389
K.LSVPENTLYSWDPNSTYIHEPPYFK.D	Y	48.29	2996.4231	25	2.0	999.8170	3	130.14	3	81043	20190523-10-H3.raw	6.31E7	1	1	722	746
K.LGSDSNKINPLVPVDLVIDHSVQVDVAR.S	Y	47.74	2998.6086	28	-4.7	750.6559	4	129.96	3	80881	20190523-10-H3.raw	1E7	1	1	203	230
R.NGVTATDLVLTVTQM(+15.99)LR.K	Y	47.35	1846.9823	17	3.0	924.5012	2	141.08	3	91207	20190523-10-H3.raw	1.96E6	2	2	349	365	Oxidation (M)
R.SDETVAMIEAYLR.A	Y	47.17	1496.7180	13	0.1	749.3663	2	135.64	3	86165	20190523-10-H3.raw	6.03E7	4	4	422	434
K.AC(+57.02)DLGLQVKPWIK.T	Y	46.38	1526.8279	13	1.6	509.9507	3	103.53	3	56839	20190523-10-H3.raw	1.57E8	3	3	552	564	Carbamidomethylation
K.VVNFSFDGQPAELK.H	Y	43.88	1549.7776	14	0.5	775.8964	2	109.34	3	61991	20190523-10-H3.raw	1.06E8	3	3	508	521
K.SSGEDTIILAGAEYGSGSSR.D	Y	43.35	1955.9072	20	2.5	978.9633	2	103.48	3	56792	20190523-10-H3.raw	1.77E7	1	1	858	877
K.TVHIPSGEKLSVFDAAMR.Y	Y	43.13	1957.0090	18	0.2	490.2596	4	101.08	3	54626	20190523-10-H3.raw	1.09E7	2	2	838	855
R.NC(+57.02)DNFQVTKEDVEK.I	Y	42.36	1724.7676	14	-1.0	863.3902	2	72.53	3	30514	20190523-10-H3.raw	3.51E7	3	3	145	158	Carbamidomethylation
R.ANNM(+15.99)FVDYNEPQQDR.V	Y	39.37	1855.7795	15	3.2	928.9000	2	81.90	3	38334	20190523-10-H3.raw	3.09E5	1	1	435	449	Oxidation (M)
K.KAC(+57.02)DLGLQVKPWIK.T	Y	38.92	1654.9229	14	0.1	414.7380	4	93.04	3	47729	20190523-10-H3.raw	4.18E7	2	2	551	564	Carbamidomethylation
R.NC(+57.02)DNFQVTK.E	Y	38.12	1124.4921	9	1.4	563.2541	2	65.43	3	24735	20190523-10-H3.raw	2.62E7	1	1	145	153	Carbamidomethylation
R.VLLQDFTGVPAVVDLAC(+57.02)M(+15.99)R.D	N	37.93	2119.0806	19	1.4	707.3685	3	141.07	3	91205	20190523-10-H3.raw	6.67E6	3	3	179	197	Carbamidomethylation; Oxidation (M)
K.ADWHSC(+57.02)LDSK.V	Y	35.41	1217.5135	10	0.1	406.8452	3	71.45	3	29609	20190523-10-H3.raw	6.51E7	3	3	483	492	Carbamidomethylation
K.DMTMDPPGPHNVK.D	Y	35.08	1437.6381	13	1.5	480.2207	3	74.70	3	32278	20190523-10-H3.raw	6.22E7	4	4	747	759
K.LSVFDAAMR.Y	Y	35.02	1008.5062	9	0.3	505.2605	2	102.58	3	55973	20190523-10-H3.raw	9.88E7	1	1	847	855
K.TSLAPGSGVVTK.Y	N	34.16	1115.6187	12	1.8	558.8176	2	71.89	3	29963	20190523-10-H3.raw	1.18E8	2	2	565	576
K.FYSLPALNDPR.V	Y	34.11	1291.6560	11	0.5	646.8356	2	109.03	3	61722	20190523-10-H3.raw	9.65E7	2	2	117	127
R.ATIANMSPEYGATM(+15.99)GFFPVDHVTLQYLK.L	Y	33.45	3116.4988	28	5.1	1039.8455	3	133.67	3	84324	20190523-10-H3.raw	2.48E6	1	1	390	417	Oxidation (M)
K.QVEIPFKPAR.V	N	33.30	1183.6713	10	0.6	395.5646	3	82.47	3	38854	20190523-10-H3.raw	1.63E8	3	3	169	178
R.ATIANM(+15.99)SPEYGATMGFFPVDHVTLQYLK.L	Y	33.10	3116.4988	28	2.2	1039.8425	3	134.31	3	84919	20190523-10-H3.raw	4.9E6	1	1	390	417	Oxidation (M)
K.LMNGEVGPK.T	Y	32.42	943.4797	9	0.6	472.7474	2	66.02	3	25193	20190523-10-H3.raw	4.2E7	2	2	829	837
R.DIWPTTEEIAEVVQSSVLPDM(+15.99)FR.A	Y	30.57	2677.2944	23	1.5	1339.6565	2	156.76	3	105788	20190523-10-H3.raw	3.42E6	2	2	684	706	Oxidation (M)
K.DFNSYGSR.R	N	29.10	944.3988	8	1.3	473.2073	2	66.66	3	25753	20190523-10-H3.raw	1.37E7	1	1	801	808
R.ATYESITK.G	Y	28.70	911.4600	8	0.1	456.7373	2	63.09	3	22831	20190523-10-H3.raw	1.93E7	1	1	707	714
R.VDKLPYSIR.I	Y	28.34	1089.6182	9	0.1	364.2134	3	78.71	3	35588	20190523-10-H3.raw	5.69E7	1	1	128	136
K.TVHIPSGEK.L	Y	27.13	966.5134	9	1.1	323.1788	3	57.78	3	18557	20190523-10-H3.raw	3.21E6	2	2	838	846
K.DAYC(+57.02)LLNY(sub F)GDSITTDHISPAGNIQK.D	Y	26.88	2765.2966	25	-1.5	922.7714	3	122.50	3	73990	20190523-10-H3.raw	6.82E5	1	1	760	784	Carbamidomethylation
K.FYSLPALNDPRVDKLPYSIR.I	Y	23.96	2363.2637	20	4.5	591.8259	4	120.12	3	71804	20190523-10-H3.raw	3.15E6	1	1	117	136
K.IIDWEK.T	Y	23.61	802.4225	6	0.6	402.2188	2	79.46	3	36217	20190523-10-H3.raw	6.74E7	1	1	159	164
Y.ALAGTVNIDFETEPIGK.G	Y	23.29	1773.9148	17	4.2	887.9684	2	115.99	3	68004	20190523-10-H3.raw	9.51E5	1	1	657	673
R.ILLESAIR.N	N	23.21	913.5596	8	0.4	457.7873	2	92.24	3	47042	20190523-10-H3.raw	2.21E8	1	1	137	144
R.ANYLASPPLVVAYALAGTVNIDFETEPIGK.G	Y	22.67	3132.6382	30	2.1	1045.2222	3	157.33	3	106320	20190523-10-H3.raw	1.72E6	1	1	644	673
R.ANYLASPPLVVAY.A	N	22.10	1376.7340	13	2.2	689.3758	2	134.16	3	84779	20190523-10-H3.raw	3.9E6	1	1	644	656
total 52 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
K.LVLLGDEVYQQNIYQDERPFISSK.K	N	59.50	2853.4548	24	1.2	952.1600	3	125.26	3	76575	20190523-10-H3.raw	2.28E8	3	3	244	267
R.QVVALC(+57.02)QAPFLLDDPNVGMLFPADAIAR.A	Y	58.19	3040.5513	28	-2.5	1521.2791	2	154.46	3	103609	20190523-10-H3.raw	2.23E8	3	3	61	88	Carbamidomethylation
K.NVVC(+57.02)NFTEGAMYSFPQIR.L	Y	57.76	2131.9819	18	1.1	1066.9994	2	130.08	3	80991	20190523-10-H3.raw	1.43E8	4	4	379	396	Carbamidomethylation
R.AMVIINPGNPTGQC(+57.02)LSEANIR.E	N	56.63	2254.1199	21	0.4	752.3809	3	111.30	3	63772	20190523-10-H3.raw	3.14E8	4	4	213	233	Carbamidomethylation
K.FNDEFMTQYDNNFGYSK.M	Y	55.74	2118.8628	17	-0.1	1060.4386	2	118.43	3	70266	20190523-10-H3.raw	1.09E8	3	3	464	480
R.DGYPSDPELIFLTDGASK.G	N	54.80	1923.9102	18	1.2	962.9635	2	132.77	3	83491	20190523-10-H3.raw	1.99E8	3	3	124	141
K.HYLSLTSGGLGAYSDSR.G	N	54.69	1782.8536	17	1.8	892.4357	2	95.81	3	50137	20190523-10-H3.raw	2.4E8	4	4	91	107
K.LLEATGISTVPGSGFGQK.E	N	53.49	1760.9308	18	0.3	881.4729	2	106.81	3	59768	20190523-10-H3.raw	4.41E8	4	4	420	437
K.IIFTNVGNPHALGQKPLTFPR.Q	N	53.09	2319.2852	21	0.1	580.8286	4	104.49	3	57710	20190523-10-H3.raw	4.48E8	4	4	40	60
K.KIIFTNVGNPHALGQKPLTFPR.Q	N	53.03	2447.3801	22	1.8	490.4842	5	95.92	3	50240	20190523-10-H3.raw	2.01E7	1	1	39	60
R.AKHYLSLTSGGLGAYSDSR.G	N	53.00	1981.9857	19	2.0	992.0021	2	86.44	3	42113	20190523-10-H3.raw	5.71E7	3	3	89	107
K.LLEATGISTVPGSGFGQKEGVFHLR.T	N	52.63	2599.3757	25	0.5	650.8515	4	111.16	3	63652	20190523-10-H3.raw	2.06E7	1	1	420	444
R.TTILPAEDEMPEIMDSFK.K	Y	52.06	2065.9587	18	0.4	1033.9871	2	138.79	3	89091	20190523-10-H3.raw	9.4E7	4	4	445	462
K.ALDYDTLNENVKK.C	Y	51.24	1521.7675	13	0.5	761.8914	2	80.62	3	37220	20190523-10-H3.raw	1.84E8	3	3	5	17
F.LLDDPNVGMLFPADAIAR.A	N	50.95	1926.9873	18	0.7	964.5016	2	138.70	3	89018	20190523-10-H3.raw	2.42E7	1	1	71	88
R.AMVIINPGNPTGQC(+57.02)LSEANIREILK.F	Y	50.81	2737.4255	25	3.3	913.4855	3	123.97	3	75363	20190523-10-H3.raw	1.49E7	1	1	213	237	Carbamidomethylation
R.TTILPAEDEMPEIMDSFKK.F	Y	49.86	2194.0537	19	0.5	732.3589	3	126.00	3	77275	20190523-10-H3.raw	2.95E8	4	4	445	463
R.RDGYPSDPELIFLTDGASK.G	N	48.21	2080.0112	19	2.6	1041.0156	2	116.03	3	68034	20190523-10-H3.raw	2.79E7	2	2	123	141
K.LVLLGDEVYQQNIYQDERPFISSKK.V	N	47.76	2981.5498	25	1.2	746.3956	4	115.94	3	67952	20190523-10-H3.raw	3.87E7	1	1	244	268
R.AM(+15.99)VIINPGNPTGQC(+57.02)LSEANIR.E	N	46.17	2270.1147	21	2.4	757.7140	3	103.71	3	57014	20190523-10-H3.raw	2.6E6	2	2	213	233	Oxidation (M); Carbamidomethylation
K.FNDEFMTQYDNNFGYSKM	Y	45.26	2249.9033	18	0.5	1125.9595	2	125.06	3	76385	20190523-10-H3.raw	3.71E6	1	1	464	481
K.VLMEMGSPFSK.E	Y	44.84	1224.5883	11	0.9	613.3019	2	105.72	3	58791	20190523-10-H3.raw	1.59E8	2	2	269	279
R.GGYFEMTNLPPR.V	N	44.74	1380.6495	12	1.8	691.3333	2	106.02	3	59064	20190523-10-H3.raw	2.14E8	16	16	301	312
K.KFNDEFMTQYDNNFGYSK.M	Y	44.48	2246.9578	18	-1.0	749.9924	3	107.67	3	60531	20190523-10-H3.raw	1.48E7	3	3	463	480
K.NVVC(+57.02)NFTEGAM(+15.99)YSFPQIR.L	Y	44.15	2147.9768	18	0.2	1074.9958	2	121.66	3	73207	20190523-10-H3.raw	0	1	1	379	396	Carbamidomethylation; Oxidation (M)
K.LLEATGISTVPGSGY(sub F)GQK.E	N	42.53	1776.9258	18	2.7	889.4725	2	101.74	3	55227	20190523-10-H3.raw	7.04E5	1	1	420	437
Y.YLDESENWGLDVANLR.Q	Y	42.34	1892.8904	16	-0.7	947.4518	2	127.02	3	78227	20190523-10-H3.raw	1.3E6	1	1	183	198
R.LMTDGFNSC(+57.02)K.N	Y	42.30	1171.5001	10	1.2	586.7581	2	77.68	3	34724	20190523-10-H3.raw	2.49E8	2	2	369	378	Carbamidomethylation
K.ALDYDTLNENVK.K	Y	41.27	1393.6725	12	0.9	697.8441	2	90.99	3	45977	20190523-10-H3.raw	1.94E8	2	2	5	16
K.KVLMEMGSPFSK.E	Y	40.08	1352.6832	12	0.5	451.9019	3	92.67	3	47407	20190523-10-H3.raw	4.33E7	3	3	268	279
K.IIFTNVGNPHALGQK.P	N	40.04	1607.8783	15	1.6	804.9477	2	89.00	3	44324	20190523-10-H3.raw	5.54E7	2	2	40	54
K.EVQLVSFHTVSK.G	Y	39.46	1372.7350	12	1.1	687.3755	2	87.43	3	42947	20190523-10-H3.raw	2.56E8	3	3	280	291
K.GVMQILNC(+57.02)VIR.G	N	38.53	1301.6948	11	0.9	651.8553	2	128.99	3	80015	20190523-10-H3.raw	3.64E8	4	4	142	152	Carbamidomethylation
K.QAGKVPDVFYC(+57.02)LK.L	N	38.51	1523.7806	13	-0.3	762.8974	2	98.79	3	52673	20190523-10-H3.raw	5.7E7	2	2	407	419	Carbamidomethylation
K.VPDVFYC(+57.02)LK.L	N	38.02	1139.5685	9	-0.3	570.7913	2	108.74	3	61471	20190523-10-H3.raw	2.62E8	2	2	411	419	Carbamidomethylation
K.VASIALSPNVSAQIFMGLMVNPPKPGDISYDQFAR.E	Y	37.85	3732.9006	35	6.1	934.2382	4	152.94	3	102162	20190523-10-H3.raw	1.72E7	1	1	320	354
R.LPTGALQAAK.Q	Y	37.17	968.5654	10	0.7	485.2903	2	73.46	3	31271	20190523-10-H3.raw	2.65E8	2	2	397	406
K.GYWGEC(+57.02)GQR.G	N	33.70	1111.4506	9	0.6	556.7329	2	71.12	3	29365	20190523-10-H3.raw	9.4E7	2	2	292	300	Carbamidomethylation
E.KLVLLGDEVYQQNIYQDERPFISSK.K	Y	31.39	2981.5498	25	-0.8	746.3942	4	116.29	3	68271	20190523-10-H3.raw	3.87E7	1	1	243	267
K.PGDISYDQFAR.E	Y	31.35	1267.5833	11	1.2	634.7997	2	91.39	3	46323	20190523-10-H3.raw	1.5E6	1	1	344	354
K.FNDEFM(+15.99)TQYDNNFGYSK.M	Y	31.24	2134.8579	17	4.3	1068.4408	2	107.68	3	60541	20190523-10-H3.raw	2.37E5	2	2	464	480	Oxidation (M)
H.ALGQKPLTFPR.Q	N	29.22	1226.7135	11	-0.4	409.9116	3	80.10	3	36783	20190523-10-H3.raw	8.07E7	3	3	50	60
K.NVVC(+57.02)NFTEGAMYSFPQIRLPTGALQAAK.Q	Y	29.12	3082.5369	28	6.1	1028.5259	3	137.16	3	87575	20190523-10-H3.raw	1.22E6	1	1	379	406	Carbamidomethylation
R.LM(+15.99)TDGFNSC(+57.02)K.N	Y	28.76	1187.4951	10	0.5	594.7551	2	67.33	3	26332	20190523-10-H3.raw	2.85E6	2	2	369	378	Oxidation (M); Carbamidomethylation
R.VVEEIYK.V	Y	28.38	878.4749	7	1.1	440.2452	2	70.02	3	28476	20190523-10-H3.raw	8.89E7	2	2	313	319
K.EVAEFIQR.R	Y	28.31	990.5134	8	0.7	496.2643	2	81.61	3	38090	20190523-10-H3.raw	1.71E8	2	2	115	122
R.DGYPSDPELIFLTDGASKGVMQILNC(+57.02)VIR.G	N	28.31	3207.5942	29	2.1	1070.2076	3	156.90	3	105922	20190523-10-H3.raw	1.28E6	1	1	124	152	Carbamidomethylation
K.KIIFTNVGNPHALGQK.P	N	26.94	1735.9733	16	1.4	579.6658	3	79.68	3	36402	20190523-10-H3.raw	1.83E6	1	1	39	54
K.GVM(+15.99)QILNC(+57.02)VIR.G	N	26.49	1317.6897	11	-2.0	659.8508	2	112.10	3	64500	20190523-10-H3.raw	1.23E7	1	1	142	152	Oxidation (M); Carbamidomethylation
K.IIFTNVGNPH.A	N	25.49	1110.5822	10	-0.6	556.2980	2	89.39	3	44663	20190523-10-H3.raw	3.51E7	1	1	40	49
R.KEVAEFIQR.R	Y	25.45	1118.6084	9	2.8	560.3130	2	70.47	3	28815	20190523-10-H3.raw	8.36E6	1	1	114	122
K.GILESLR.R	N	23.44	786.4599	7	0.0	394.2372	2	90.77	3	45782	20190523-10-H3.raw	2.61E8	2	2	358	364
F.LLDDPNVGM(+15.99)LFPADAIAR.A	N	23.07	1942.9822	18	4.3	972.5026	2	131.25	3	82075	20190523-10-H3.raw	1.11E6	1	1	71	88	Oxidation (M)
K.KIIFTNVGNPH.A	N	20.48	1238.6771	11	0.8	620.3463	2	76.58	3	33889	20190523-10-H3.raw	1.93E6	1	1	39	49
total 54 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
R.EVAAFAQFGSDLDAATQALLNR.G	Y	61.07	2307.1494	22	0.5	770.0575	3	154.40	3	103554	20190523-10-H3.raw	2.81E8	8	8	402	423
R.EVAAFAQY(sub F)GSDLDAATQALLNR.G	Y	58.61	2323.1443	22	-1.7	775.3874	3	148.70	3	98217	20190523-10-H3.raw	2.8E7	3	3	402	423
R.DNGMHALIIYDDLSK.Q	Y	58.04	1703.8188	15	0.6	852.9172	2	114.47	3	66652	20190523-10-H3.raw	4.15E8	4	4	262	276
K.GMALNLENENVGIVVFGGDTAIK.E	Y	57.02	2360.2046	23	1.6	1181.1115	2	137.76	3	88141	20190523-10-H3.raw	3.85E7	12	12	63	85
R.EVAAY(sub F)AQFGSDLDAATQALLNR.G	Y	55.99	2323.1443	22	-2.2	1162.5769	2	151.06	3	100388	20190523-10-H3.raw	2.21E7	3	3	402	423
K.AILNSVKPELLQALK.G	Y	55.94	1635.9923	15	0.4	819.0038	2	112.30	3	64688	20190523-10-H3.raw	1.78E9	7	7	470	484
R.EVAAY(sub F)AQY(sub F)GSDLDAATQALLNR.G	Y	55.02	2339.1392	22	1.8	1170.5790	2	141.51	3	91608	20190523-10-H3.raw	2.54E6	2	2	402	423
R.VVSVGDGIAQVYGLNEIQAGEMVLY(sub F)ANGVK.G	Y	54.58	3092.5852	30	3.0	1547.3044	2	152.50	3	101740	20190523-10-H3.raw	3.45E6	2	2	33	62
R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Y	54.57	3076.5903	30	0.6	1026.5380	3	153.70	3	102890	20190523-10-H3.raw	2.07E8	5	5	33	62
K.AILNSVKPELLQALKGGLTNER.K	Y	54.23	2363.3535	22	0.7	591.8461	4	117.85	3	69714	20190523-10-H3.raw	2.9E7	3	3	470	491
R.LTEVLKQPQYAPLPIEK.Q	Y	52.66	1966.1139	17	0.8	656.3791	3	102.07	3	55529	20190523-10-H3.raw	1.58E8	3	3	427	443
R.VVDAMGVPIDGKGALSDHEQR.R	Y	51.77	2193.0847	21	1.2	549.2791	4	88.31	3	43730	20190523-10-H3.raw	2.01E8	5	5	109	129
R.ATSESETMYC(+57.02)VYVAIGQK.R	Y	49.98	2035.9231	18	-0.3	1018.9686	2	117.46	3	69355	20190523-10-H3.raw	1.54E5	3	3	195	212	Carbamidomethylation
K.QILVIYAAVNGFC(+57.02)DR.M	Y	49.47	1737.8872	15	0.8	869.9516	2	131.31	3	82129	20190523-10-H3.raw	1.1E8	11	11	444	458	Carbamidomethylation
R.GIRPAINVGLSVSR.V	N	48.36	1437.8416	14	0.6	719.9285	2	91.20	3	46159	20190523-10-H3.raw	4.44E8	5	5	363	376
R.IRNFYANFQVDEIGR.V	Y	47.09	1840.9220	15	1.3	614.6487	3	107.63	3	60501	20190523-10-H3.raw	3.06E7	3	3	18	32
K.GMALNLENENVGIVVY(sub F)GGDTAIKEGDLVKR.T	Y	47.00	3173.6389	30	0.1	794.4171	4	123.09	3	74538	20190523-10-H3.raw	6.65E6	1	1	63	92
R.AAELTNLFESR.I	Y	46.63	1249.6302	11	0.6	625.8228	2	107.55	3	60426	20190523-10-H3.raw	5.91E8	3	3	7	17
R.NFYANFQVDEIGR.V	Y	46.24	1571.7368	13	1.5	786.8768	2	115.63	3	67656	20190523-10-H3.raw	2.17E8	6	6	20	32
K.GMALNLENENVGIVVFGGDTAIKEGDLVKR.T	Y	46.12	3157.6440	30	6.2	790.4232	4	127.63	3	78753	20190523-10-H3.raw	3.93E7	2	2	63	92
K.QPQYAPLPIEKQILVIYAAVNGFC(+57.02)DR.M	Y	46.08	3002.5686	26	1.1	1001.8646	3	154.34	3	103498	20190523-10-H3.raw	5.7E6	1	1	433	458	Carbamidomethylation
R.VVDAMGVPIDGK.G	Y	45.68	1199.6219	12	1.1	600.8189	2	91.75	3	46632	20190523-10-H3.raw	6.15E8	2	2	109	120
R.EAFPGDVFYLHSR.L	Y	45.36	1536.7361	13	1.4	769.3764	2	109.08	3	61766	20190523-10-H3.raw	4.62E8	7	7	295	307
R.VVDAMGVPIDGKGALSDHEQRR.V	Y	45.25	2349.1858	22	1.3	470.8450	5	81.89	3	38328	20190523-10-H3.raw	1.05E7	1	1	109	130
R.TGSIVDVPAGK.A	Y	43.15	1042.5658	11	1.5	522.2910	2	75.93	3	33318	20190523-10-H3.raw	4.65E8	2	2	93	103
R.NY(sub F)YANFQVDEIGR.V	Y	43.03	1587.7317	13	-0.3	794.8729	2	109.60	3	62234	20190523-10-H3.raw	0	1	1	20	32
K.QVC(+57.02)GSLKLELAQYR.E	Y	42.70	1663.8716	14	1.7	555.6321	3	94.92	3	49367	20190523-10-H3.raw	1.97E7	2	2	388	401	Carbamidomethylation
R.KMELDAFLKER.A	Y	42.56	1378.7278	11	0.6	460.5835	3	93.01	3	47703	20190523-10-H3.raw	8.37E7	6	6	492	502
K.TTIAIDTILNQK.Q	Y	41.95	1329.7504	12	2.3	665.8840	2	110.18	3	62766	20190523-10-H3.raw	2.23E8	3	3	178	189
R.ATSESETMYC(+57.02)VYVAIGQKR.S	Y	41.81	2192.0242	19	-1.5	731.6809	3	108.93	3	61627	20190523-10-H3.raw	1.13E7	1	1	195	213	Carbamidomethylation
K.SVHEPMQTGLK.A	Y	41.76	1225.6125	11	1.1	409.5452	3	63.21	3	22928	20190523-10-H3.raw	3.66E8	4	4	143	153
R.NFYANY(sub F)QVDEIGR.V	Y	41.71	1587.7317	13	-0.2	794.8729	2	106.32	3	59350	20190523-10-H3.raw	3.16E7	1	1	20	32
K.GMALNLENENVGIVVY(sub F)GGDTAIK.E	Y	41.65	2376.1995	23	0.8	1189.1079	2	131.17	3	82002	20190523-10-H3.raw	1.68E6	1	1	63	85
R.NY(sub F)YANY(sub F)QVDEIGR.V	Y	41.35	1603.7267	13	-0.6	802.8701	2	101.37	3	54881	20190523-10-H3.raw	6.45E6	1	1	20	32
K.QPQYAPLPIEK.Q	Y	40.90	1282.6921	11	0.3	642.3535	2	90.78	3	45799	20190523-10-H3.raw	4.55E8	3	3	433	443
R.IRNFYANY(sub F)QVDEIGR.V	Y	40.24	1856.9169	15	0.7	619.9800	3	100.41	3	54050	20190523-10-H3.raw	1.57E6	1	1	18	32
R.KSVHEPMQTGLK.A	Y	39.85	1353.7074	12	-0.5	452.2429	3	56.07	3	17151	20190523-10-H3.raw	2.61E7	2	2	142	153
K.AVDSLVPIGR.G	Y	39.60	1025.5869	10	0.7	513.8011	2	94.46	3	48952	20190523-10-H3.raw	7.19E8	2	2	154	163
F.AQFGSDLDAATQALLNR.G	Y	38.52	1789.8959	17	-4.2	895.9515	2	127.22	3	78388	20190523-10-H3.raw	4.97E6	1	1	407	423
R.KMELDAFLK.E	Y	38.24	1093.5841	9	1.4	547.8001	2	99.46	3	53272	20190523-10-H3.raw	3.4E8	6	6	492	500
K.QVC(+57.02)GSLKLELAQYREVAAFAQFGSDLDAATQALLNR.G	Y	37.89	3953.0105	36	3.0	989.2629	4	153.37	3	102576	20190523-10-H3.raw	0	1	1	388	423	Carbamidomethylation
Q.YAPLPIEKQILVIYAAVNGFC(+57.02)DRMPLDR.I	Y	37.76	3261.7041	28	-1.4	816.4321	4	153.82	3	103002	20190523-10-H3.raw	6.88E6	1	1	436	463	Carbamidomethylation
K.GMALNLENENVGIVVFGGDTAIKEGDLVK.R	Y	37.64	3001.5430	29	4.2	1001.5258	3	135.25	3	85802	20190523-10-H3.raw	3.6E7	5	5	63	91
R.AAELTNLY(sub F)ESR.I	Y	37.50	1265.6251	11	0.6	633.8202	2	94.52	3	49009	20190523-10-H3.raw	5.97E7	2	2	7	17
R.DNGM(+15.99)HALIIYDDLSK.Q	Y	35.36	1719.8137	15	-1.4	574.2777	3	104.12	3	57386	20190523-10-H3.raw	1.54E7	1	1	262	276	Oxidation (M)
R.PAINVGLSVSR.V	N	34.83	1111.6349	11	-0.2	556.8246	2	92.61	3	47354	20190523-10-H3.raw	5.44E7	6	6	366	376
Y.SGC(+57.02)AMGEYFR.D	Y	34.71	1176.4692	10	-0.3	589.2417	2	87.20	3	42773	20190523-10-H3.raw	1.79E7	2	2	252	261	Carbamidomethylation
K.MELDAFLK.E	Y	33.67	965.4892	8	0.4	483.7521	2	114.51	3	66683	20190523-10-H3.raw	7.88E7	2	2	493	500
K.QPQYAPLPIEKQILVIYAAVNGY(sub F)C(+57.02)DRMPLDR.I	Y	33.38	3630.8689	31	2.9	908.7271	4	153.12	3	102328	20190523-10-H3.raw	2.2E6	1	1	433	463	Carbamidomethylation
R.EVAAFAQFGSDLDAATQALLNRGA.R	Y	33.15	2435.2080	24	10.5	812.7518	3	147.68	3	97279	20190523-10-H3.raw	3.88E6	1	1	402	425
R.DNGMHALIIYDDLSKQAVAF(sub Y)RQM(+15.99)SLLLR.R	Y	32.80	3233.6689	28	0.1	809.4246	4	138.89	3	89172	20190523-10-H3.raw	9.69E5	1	1	262	289	Oxidation (M)
K.GM(+15.99)ALNLENENVGIVVFGGDTAIK.E	Y	30.26	2376.1995	23	0.1	1189.1072	2	130.82	3	81677	20190523-10-H3.raw	0	1	1	63	85	Oxidation (M)
K.MELDAFLKER.A	Y	30.06	1250.6328	10	0.6	417.8851	3	104.48	3	57706	20190523-10-H3.raw	1.48E7	2	2	493	502
R.ELLIGDRQTGK.T	N	29.97	1228.6775	11	1.0	410.5669	3	67.23	3	26245	20190523-10-H3.raw	4.5E7	3	3	167	177
K.RTGSIVDVPAGK.A	Y	29.80	1198.6670	12	1.2	400.5634	3	66.74	3	25826	20190523-10-H3.raw	2.07E7	2	2	92	103
K.SVHEPM(+15.99)QTGLK.A	Y	27.96	1241.6074	11	-0.2	414.8763	3	56.13	3	17206	20190523-10-H3.raw	3.75E6	1	1	143	153	Oxidation (M)
K.LELAQYR.E	Y	27.47	891.4814	7	0.6	446.7482	2	79.45	3	36208	20190523-10-H3.raw	4.28E8	1	1	395	401
R.KMELDAY(sub F)LK.E	Y	26.89	1109.5791	9	0.5	555.7971	2	91.15	3	46122	20190523-10-H3.raw	2.47E7	1	1	492	500
R.KM(+15.99)ELDAFLK.E	Y	26.33	1109.5791	9	0.6	555.7972	2	84.93	3	40877	20190523-10-H3.raw	1.69E6	1	1	492	500	Oxidation (M)
R.QMSLLLR.R	N	26.03	859.4949	7	0.5	430.7550	2	94.13	3	48670	20190523-10-H3.raw	1.31E9	3	3	283	289
R.RVEVKAPGILER.K	Y	25.86	1365.8092	12	0.2	342.4597	4	75.11	3	32625	20190523-10-H3.raw	2.19E6	1	1	130	141
R.VVDAM(+15.99)GVPIDGK.G	Y	25.72	1215.6169	12	-0.5	608.8154	2	76.77	3	34054	20190523-10-H3.raw	1.72E7	2	2	109	120	Oxidation (M)
H.ALIIYDDLSK.Q	Y	24.88	1149.6281	10	0.3	575.8215	2	106.17	3	59209	20190523-10-H3.raw	1.15E7	1	1	267	276
R.EAFPGDVFYLH.S	Y	24.51	1293.6029	11	-0.7	647.8083	2	126.11	3	77370	20190523-10-H3.raw	2.52E7	2	2	295	305
K.MELDAY(sub F)LK.E	Y	23.46	981.4841	8	0.6	491.7496	2	105.22	3	58349	20190523-10-H3.raw	5.03E6	1	1	493	500
F.PGDVFYLHSR.L	N	22.88	1189.5880	10	-5.8	595.7979	2	98.25	3	52198	20190523-10-H3.raw	2.01E6	1	1	298	307
K.APGILER.K	Y	22.14	754.4337	7	-0.2	378.2241	2	68.51	3	27291	20190523-10-H3.raw	1.07E8	1	1	135	141
R.ELLIGDR.Q	N	21.92	814.4548	7	0.4	408.2349	2	80.73	3	37315	20190523-10-H3.raw	1.25E9	3	3	167	173
R.LTEVLKQPQYAPLPIEKQILVIF(sub Y)AAVNGFC(+57.02)DRM(+15.99)PLDR.I	Y	21.04	4298.2959	37	2.4	1075.5839	4	153.03	3	102243	20190523-10-H3.raw	0	1	1	427	463	Carbamidomethylation; Oxidation (M)
R.LTEVLK.Q	N	20.01	701.4323	6	0.6	351.7236	2	65.83	3	25038	20190523-10-H3.raw	1.03E8	1	1	427	432
total 70 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
K.LIGSPPGYVGYTEGGQLTEAVR.R	N	61.16	2263.1484	22	0.9	1132.5825	2	113.10	3	65408	20190523-10-H3.raw	5.2E7	2	2	686	707
K.AESETGEEGPMVTESDIQHIVSSWTGIPVEK.V	Y	58.12	3341.5608	31	2.8	1114.8640	3	150.58	3	99949	20190523-10-H3.raw	6.23E7	2	2	560	590
K.VPEPTVDETIQILK.G	Y	56.02	1580.8661	14	1.7	791.4417	2	115.66	3	67690	20190523-10-H3.raw	6.13E7	2	2	433	446
R.LGHNFVGTEQILLGLIGEGTGIAAK.V	N	54.61	2507.3748	25	1.1	627.8516	4	148.23	3	97786	20190523-10-H3.raw	4.11E7	3	3	116	140
R.MVGENNEVTANVGGGSSSNK.M	Y	54.36	1949.8749	20	0.8	975.9455	2	74.66	3	32240	20190523-10-H3.raw	1.94E7	2	2	234	253
R.QLGHNYIGSEHLLLGLLR.E	N	53.93	2032.1217	18	1.7	1017.0699	2	117.21	3	69136	20190523-10-H3.raw	1.38E8	2	2	190	207
K.MPTLEEYGTNLTK.L	N	51.21	1495.7228	13	1.1	748.8695	2	103.80	3	57100	20190523-10-H3.raw	6.16E7	1	1	254	266
K.AHPDVFNMMLQILEDGR.L	N	50.82	1984.9498	17	1.5	662.6582	3	153.34	3	102541	20190523-10-H3.raw	2.74E7	1	1	722	738
K.AHPDVFNMMLQILEDGRLTDSK.G	N	50.82	2529.2356	22	-0.3	633.3160	4	151.26	3	100570	20190523-10-H3.raw	2.54E7	3	3	722	743
K.NTLLIMTSNVGSSVIEK.G	N	48.37	1804.9604	17	0.9	903.4883	2	117.14	3	69070	20190523-10-H3.raw	4.99E7	2	2	751	767
K.VITLDMGLLVAGTK.Y	N	47.79	1429.8214	14	0.2	715.9182	2	132.08	3	82849	20190523-10-H3.raw	1.85E7	3	3	333	346
R.GELQC(+57.02)IGATTLDEYRK.H	N	47.58	1852.8989	16	0.4	927.4572	2	94.98	3	49420	20190523-10-H3.raw	7.8E7	4	4	401	416	Carbamidomethylation
K.NPNRPIASFIFSGPTGVGK.S	N	47.51	1958.0374	19	1.0	653.6871	3	109.49	3	62132	20190523-10-H3.raw	9.5E7	3	3	633	651
R.FQPVKVPEPTVDETIQILK.G	Y	46.27	2180.2092	19	1.3	727.7446	3	120.49	3	72140	20190523-10-H3.raw	2.87E7	4	4	428	446
R.GSGFVAVEIPFTPR.A	N	46.17	1475.7772	14	1.3	738.8969	2	124.21	3	75591	20190523-10-H3.raw	5.97E7	3	3	163	176
R.GELQC(+57.02)IGATTLDEYR.K	N	45.20	1724.8040	15	0.8	863.4099	2	107.25	3	60148	20190523-10-H3.raw	6.56E6	1	1	401	415	Carbamidomethylation
K.AHPDVFNM(+15.99)MLQILEDGR.L	N	44.56	2000.9448	17	1.6	667.9899	3	143.71	3	93642	20190523-10-H3.raw	7.09E5	1	1	722	738	Oxidation (M)
R.IASGDVPETIEGK.K	N	44.17	1314.6666	13	1.7	658.3417	2	81.07	3	37608	20190523-10-H3.raw	5.28E7	1	1	319	331
R.FLPDKAIDLIDEAGSR.V	N	43.01	1758.9152	16	3.2	587.3142	3	117.37	3	69281	20190523-10-H3.raw	1.15E7	1	1	480	495
K.LAEEGKLDPVVGR.Q	N	42.58	1381.7565	13	-0.4	461.5926	3	77.55	3	34633	20190523-10-H3.raw	6.85E7	3	3	267	279
R.VLENLGADPSNIR.T	N	42.52	1396.7310	13	0.6	699.3732	2	91.33	3	46275	20190523-10-H3.raw	1.15E8	2	2	216	228
R.IASGDVPETIEGKK.V	Y	41.22	1442.7616	14	0.9	481.9282	3	72.38	3	30390	20190523-10-H3.raw	3.23E7	2	2	319	332
K.ALAAYYFGSEEAMIR.L	N	41.02	1690.8025	15	2.9	846.4110	2	119.57	3	71285	20190523-10-H3.raw	8.55E6	2	2	657	671
R.VGLKNPNRPIASFIFSGPTGVGK.S	N	40.74	2355.3062	23	0.9	589.8344	4	106.26	3	59290	20190523-10-H3.raw	1.04E7	1	1	629	651
K.EIADILLKEVFER.L	Y	40.51	1573.8715	13	-2.0	787.9414	2	138.66	3	88982	20190523-10-H3.raw	3.15E6	2	2	824	836
R.IGFDLDYDEKDSSYNR.I	Y	38.04	1935.8486	16	-3.4	646.2880	3	100.63	3	54247	20190523-10-H3.raw	1.03E7	1	1	772	787
R.HAQVPEEARELEK.E	Y	37.60	1534.7739	13	0.8	512.5990	3	65.37	3	24686	20190523-10-H3.raw	9.76E6	1	1	500	512
K.AIDLIDEAGSR.V	N	37.60	1158.5880	11	0.8	580.3018	2	93.57	3	48212	20190523-10-H3.raw	7.2E7	1	1	485	495
K.QYFRPEFLNR.L	N	37.43	1368.6938	10	0.3	457.2387	3	93.19	3	47870	20190523-10-H3.raw	6.96E7	2	2	798	807
K.LIGSPPGYVGYTEGGQLTEAVRR.R	N	37.35	2419.2495	23	-0.7	807.4232	3	104.83	3	58010	20190523-10-H3.raw	1.09E7	1	1	686	708
K.VIMLAQEEAR.R	Y	37.04	1158.6067	10	0.5	580.3109	2	82.55	3	38934	20190523-10-H3.raw	4.81E7	1	1	105	114
K.QYFRPEFLNRLDEMIVFR.Q	N	36.58	2372.2100	18	-1.5	594.0589	4	135.17	3	85723	20190523-10-H3.raw	4.16E6	1	1	798	815
K.LAEEGKLDPVVGRQPQIER.V	N	36.42	2133.1541	19	2.4	534.2971	4	82.27	3	38678	20190523-10-H3.raw	2.29E7	2	2	267	285
R.RIGFDLDYDEK.D	Y	35.79	1369.6514	11	1.8	457.5585	3	93.94	3	48511	20190523-10-H3.raw	1.82E6	1	1	771	781
R.QSDEIILFIDEVHTLIGAGAAEGAIDAANILKPALAR.G	N	35.30	3815.0469	37	0.9	1272.6907	3	157.63	3	106595	20190523-10-H3.raw	6.51E5	1	1	364	400
R.VVDEGYNPSYGAR.P	Y	35.25	1425.6525	13	-0.1	713.8334	2	75.24	3	32739	20190523-10-H3.raw	5.24E7	1	1	854	866
R.LDMSEFMER.H	N	34.91	1156.4893	9	0.3	579.2521	2	111.64	3	64083	20190523-10-H3.raw	5.36E7	2	2	672	680
K.GKEMSKAESETGEEGPMVTESDIQHIVSSWTGIPVEK.V	Y	34.70	4001.8875	37	2.3	801.3866	5	134.30	3	84906	20190523-10-H3.raw	0	1	1	554	590
R.TKNNPC(+57.02)LIGEPGVGK.T	N	34.22	1582.8137	15	-0.6	528.6115	3	72.55	3	30537	20190523-10-H3.raw	1.57E7	2	2	294	308	Carbamidomethylation
R.RPYTVVLFDEIEK.A	Y	33.47	1607.8558	13	-2.4	804.9333	2	110.46	3	63035	20190523-10-H3.raw	1.14E7	2	2	709	721
R.RFQPVKVPEPTVDETIQILK.G	Y	33.24	2336.3103	20	-1.0	585.0843	4	111.05	3	63558	20190523-10-H3.raw	8.82E6	2	2	427	446
R.IGFDLDYDEK.D	Y	32.88	1213.5503	10	0.3	607.7826	2	106.34	3	59365	20190523-10-H3.raw	1.28E7	1	1	772	781
H.NYIGSEHLLLGLLR.E	N	31.78	1596.8987	14	2.6	533.3082	3	124.05	3	75439	20190523-10-H3.raw	2.64E6	1	1	194	207
R.IIGQDEAVK.A	Y	31.12	971.5287	9	1.2	486.7722	2	65.90	3	25101	20190523-10-H3.raw	5.28E7	1	1	610	618
K.TAIAEGLAQR.I	N	30.17	1028.5614	10	0.6	515.2883	2	73.70	3	31460	20190523-10-H3.raw	7.7E7	1	1	309	318
K.HIEKDPALER.R	N	29.08	1206.6356	10	-0.8	403.2188	3	54.29	3	15807	20190523-10-H3.raw	2.88E6	1	1	417	426
R.MVGENNEVTANVGGGSSSNKMPTLEEYGTNLTK.L	Y	28.73	3427.5872	33	0.9	1143.5374	3	106.94	3	59882	20190523-10-H3.raw	1.01E7	1	1	234	266
K.NNPC(+57.02)LIGEPGVGK.T	N	27.58	1353.6710	13	-0.4	677.8425	2	82.46	3	38845	20190523-10-H3.raw	5.13E7	1	1	296	308	Carbamidomethylation
K.SLVTEELK.Q	N	26.87	917.5070	8	0.6	459.7610	2	80.80	3	37381	20190523-10-H3.raw	8.12E7	1	1	790	797
R.LLEDSMAEK.M	N	24.98	1034.4954	9	0.3	518.2551	2	73.30	3	31156	20190523-10-H3.raw	7.5E6	1	1	875	883
K.M(+15.99)PTLEEYGTNLTK.L	N	24.55	1511.7178	13	-0.2	756.8660	2	94.37	3	48875	20190523-10-H3.raw	0	1	1	254	266	Oxidation (M)
Y.TVVLFDEIEK.A	N	24.21	1191.6387	10	3.2	596.8285	2	109.34	3	61999	20190523-10-H3.raw	4.94E6	1	1	712	721
R.VVQILGR.R	Y	23.16	783.4966	7	0.1	392.7556	2	77.51	3	34592	20190523-10-H3.raw	5.32E7	2	2	286	292
K.EIADILLK.E	Y	22.62	913.5484	8	0.0	457.7815	2	107.14	3	60051	20190523-10-H3.raw	5.52E7	2	2	824	831
K.SMGINLK.D	N	21.21	761.4105	7	0.6	381.7128	2	75.70	3	33124	20190523-10-H3.raw	2.36E7	1	1	144	150
total 55 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
K.IHLSLVANPSHLEAADSVVVGK.T	Y	62.63	2255.2273	22	-0.5	752.7493	3	104.67	3	57866	20190523-10-H3.raw	1.22E8	5	5	354	375
R.YLQMSDDNPYVIPDMEPTMR.K	Y	56.54	2414.0593	20	0.7	1208.0378	2	127.63	3	78754	20190523-10-H3.raw	1.64E7	2	2	783	802
R.QIFSEFSGGIRPVDEVGYTGTGDVK.Y	Y	56.51	2657.2971	25	1.4	886.7742	3	115.51	3	67555	20190523-10-H3.raw	7.23E7	3	3	313	337
K.LTDSFLDGTSSVYLEELQR.A	N	56.11	2172.0586	19	0.6	1087.0372	2	134.02	3	84650	20190523-10-H3.raw	3.68E7	3	3	62	80
R.AQMIESGEGVDWALAEALAFATLVVEGNHVR.L	Y	55.53	3282.6343	31	3.3	1095.2223	3	158.81	3	107690	20190523-10-H3.raw	3.48E6	1	1	626	656
K.QIQEC(+57.02)NWQIVNATTPANYFHVLR.R	Y	54.11	2801.3708	23	3.8	934.8011	3	127.93	3	79028	20190523-10-H3.raw	3.49E7	2	2	804	826	Carbamidomethylation
R.NFVGQAATSPGISGQTIQESMR.L	Y	53.65	2278.1011	22	-1.0	1140.0566	2	105.24	3	58369	20190523-10-H3.raw	4.91E7	4	4	99	120
R.GPSAATATGFYTFHVK.E	Y	53.18	1653.8151	16	0.5	552.2792	3	95.12	3	49542	20190523-10-H3.raw	5.56E7	2	2	978	993
R.AWEADPNSVDESWDNFFR.N	N	52.67	2183.9185	18	-0.5	1092.9659	2	141.52	3	91615	20190523-10-H3.raw	4.03E7	5	5	81	98
R.AADLGVESIVIGMSHR.G	Y	51.00	1653.8508	16	0.6	552.2912	3	116.66	3	68617	20190523-10-H3.raw	8E7	3	3	282	297
R.LAWSTQFENFLATK.W	Y	49.68	1654.8354	14	-0.3	828.4247	2	135.55	3	86077	20190523-10-H3.raw	4.65E7	2	2	243	256
K.VNTILNEEFVASKDYLPK.K	Y	49.56	2079.0889	18	0.4	694.0372	3	115.46	3	67513	20190523-10-H3.raw	2.37E7	2	2	550	567
R.FGLEGGESLIPGMK.E	Y	49.18	1433.7224	14	0.0	717.8685	2	122.20	3	73709	20190523-10-H3.raw	3.81E7	2	2	263	276
K.ALSAPIFHVNGDDVEAVVHAC(+57.02)ELAAEWR.Q	Y	47.21	3075.4871	28	-2.9	769.8768	4	138.28	3	88629	20190523-10-H3.raw	5.97E7	1	1	455	482	Carbamidomethylation
R.QTFHSDVVVDLVC(+57.02)YR.R	N	47.02	1836.8828	15	1.3	919.4499	2	110.01	3	62610	20190523-10-H3.raw	1.69E7	3	3	483	497	Carbamidomethylation
R.FGHNEIDEPSFTQPK.M	N	46.91	1744.8057	15	0.3	582.6093	3	85.02	3	40945	20190523-10-H3.raw	7.01E7	2	2	499	513
R.LEQAYC(+57.02)GNIGFEYMHIADRDK.C	Y	46.16	2529.1416	21	4.0	633.2952	4	106.16	3	59205	20190523-10-H3.raw	0	1	1	195	215	Carbamidomethylation
K.DQNDHSDLEEGIR.R	Y	44.62	1526.6597	13	2.2	764.3388	2	70.93	3	29204	20190523-10-H3.raw	7.38E6	2	2	880	892
K.SNLSEFDDVQGHPGFDK.Q	Y	44.43	1890.8384	17	1.5	946.4279	2	92.68	3	47417	20190523-10-H3.raw	1.02E7	1	1	853	869
R.AQM(+15.99)IESGEGVDWALAEALAFATLVVEGNHVR.L	Y	43.86	3298.6292	31	2.5	1100.5531	3	158.23	3	107157	20190523-10-H3.raw	7.47E5	1	1	626	656	Oxidation (M)
K.VNTILNEEFVASK.D	Y	43.29	1462.7667	13	0.9	732.3913	2	103.02	3	56381	20190523-10-H3.raw	4.23E7	2	2	550	562
K.VGATDVAIC(+57.02)R.V	Y	42.65	1060.5336	10	0.3	531.2742	2	74.26	3	31901	20190523-10-H3.raw	5.1E7	2	2	912	921	Carbamidomethylation
K.NHPSTLQIYHK.K	Y	42.61	1336.6887	11	0.0	446.5702	3	60.14	3	20480	20190523-10-H3.raw	1.72E7	2	2	520	530
K.AISSLPENFKPHR.A	Y	42.17	1494.7943	13	0.0	499.2721	3	75.99	3	33372	20190523-10-H3.raw	8.35E7	2	2	604	616
R.YLQMSDDNPYVIPDMEPTMRK.Q	Y	39.77	2542.1543	21	1.2	848.3931	3	115.38	3	67442	20190523-10-H3.raw	2.26E6	1	1	783	803
K.RFGLEGGESLIPGMK.E	Y	38.98	1589.8235	15	0.6	530.9487	3	109.40	3	62054	20190523-10-H3.raw	6.72E6	1	1	262	276
K.LLEC(+57.02)GEVSQQDIDR.I	Y	38.32	1660.7726	14	3.1	831.3961	2	86.46	3	42127	20190523-10-H3.raw	2.55E7	1	1	532	545	Carbamidomethylation
R.NTGVKPEILK.T	N	38.23	1097.6444	10	0.9	549.8300	2	64.96	3	24360	20190523-10-H3.raw	6.72E7	3	3	590	599
R.QTGLVMLLPHGYDGQGPEHSSAR.L	Y	36.72	2449.1809	23	-3.6	817.3979	3	99.36	3	53185	20190523-10-H3.raw	8.19E6	2	2	757	779
K.IETPTPWR.Y	Y	35.20	998.5185	8	1.1	500.2671	2	88.42	3	43818	20190523-10-H3.raw	1.59E7	1	1	223	230
R.VEQLC(+57.02)PFPYDLIQR.E	N	34.55	1776.8868	14	-4.2	593.3004	3	129.03	3	80049	20190523-10-H3.raw	5.37E6	3	3	922	935	Carbamidomethylation
R.F(sub Y)LQM(+15.99)SDDNPYVIPDMEPTMR.K	Y	34.29	2414.0593	20	-0.1	805.6937	3	127.81	3	78920	20190523-10-H3.raw	5.19E6	1	1	783	802	Oxidation (M)
K.KIHLSLVANPSHLEAADSVVVGK.T	Y	33.20	2383.3223	23	-1.4	596.8370	4	97.62	3	51651	20190523-10-H3.raw	1.25E6	1	1	353	375
K.QYYSNDLDR.T	Y	33.18	1172.5098	9	0.5	587.2625	2	71.46	3	29613	20190523-10-H3.raw	2.14E7	2	2	380	388
R.KPLIVMAPK.N	N	32.13	995.6201	9	0.9	498.8178	2	71.46	3	29615	20190523-10-H3.raw	3.7E7	3	3	835	843
R.DWLSTNWAGFK.S	Y	31.65	1323.6248	11	0.2	662.8198	2	132.73	3	83452	20190523-10-H3.raw	2.23E7	1	1	570	580
K.DQNDHSDLEEGIRR.L	Y	28.80	1682.7607	14	1.1	421.6979	4	65.23	3	24572	20190523-10-H3.raw	9.97E6	1	1	880	893
R.LNVLGNVVR.K	N	28.53	982.5923	9	-0.3	492.3033	2	95.36	3	49746	20190523-10-H3.raw	7.61E7	1	1	300	308
R.EKIETPTPWR.Y	Y	28.17	1255.6560	10	0.1	419.5593	3	80.26	3	36915	20190523-10-H3.raw	2.55E7	2	2	221	230
R.SSQYC(+57.02)TDVAK.A	N	26.54	1157.5023	10	-0.2	579.7583	2	59.67	3	20137	20190523-10-H3.raw	1.07E7	1	1	445	454	Carbamidomethylation
R.SVNRGDMEDIKYVGR.G	Y	26.40	1737.8468	15	-0.3	435.4688	4	74.85	3	32409	20190523-10-H3.raw	7.98E6	1	1	963	977
K.LDPLGLEQR.E	Y	25.52	1039.5662	9	0.6	520.7906	2	95.85	3	50177	20190523-10-H3.raw	5.54E7	1	1	138	146
K.SNLSEFDDVQGHPGFDKQGTR.F	Y	25.32	2333.0671	21	-2.6	584.2725	4	85.33	3	41199	20190523-10-H3.raw	2.37E6	1	1	853	873
R.FGLEGGESLIPGMKEMFDR.A	Y	25.15	2112.0020	19	-2.4	705.0062	3	134.15	3	84768	20190523-10-H3.raw	0	1	1	263	281
K.YHLGTSYDRPTR.G	N	22.48	1464.7109	12	2.5	733.3646	2	64.40	3	23903	20190523-10-H3.raw	3.21E6	1	1	338	349
K.AKLDPLGLEQR.E	Y	22.28	1238.6982	11	-0.7	413.9064	3	86.72	3	42355	20190523-10-H3.raw	2.54E7	1	1	136	146
K.KVGATDVAIC(+57.02)R.V	Y	21.72	1188.6284	11	-2.0	397.2159	3	64.24	3	23757	20190523-10-H3.raw	2.1E6	1	1	911	921	Carbamidomethylation
total 47 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
K.FKEEDGIDYAAVTVQLPGGERVPFLFTVK.Q	N	66.05	3224.6755	29	1.5	1075.9008	3	137.84	3	88212	20190523-10-H3.raw	1.84E8	7	7	187	215
K.SKPETGEVIGVFESLQPSDTDLGAK.V	N	64.56	2603.2966	25	1.4	1302.6573	2	121.88	3	73413	20190523-10-H3.raw	1.71E9	8	8	291	315
K.FKEEDGIDYAAVTVQLPGGER.V	N	61.94	2293.1226	21	1.3	1147.5701	2	111.21	3	63702	20190523-10-H3.raw	1.72E8	4	4	187	207
K.GTGTANQC(+57.02)PTIDGGSETFSFK.A	N	59.00	2173.9585	21	0.4	1087.9869	2	101.08	3	54620	20190523-10-H3.raw	5.12E8	7	7	106	126	Carbamidomethylation
K.EEDGIDYAAVTVQLPGGER.V	N	58.62	2017.9592	19	0.2	1009.9871	2	117.92	3	69779	20190523-10-H3.raw	5.1E7	4	4	189	207
K.SKPETGEVIGVFESLQPSDTDLGAKVPK.D	N	56.31	2927.5127	28	0.9	976.8457	3	118.22	3	70063	20190523-10-H3.raw	3.21E8	4	4	291	318
K.KFC(+57.02)FEPTSFTVK.A	N	55.20	1489.7275	12	0.5	745.8714	2	101.46	3	54965	20190523-10-H3.raw	5.72E8	4	4	134	145	Carbamidomethylation
R.LTYTLDEIEGPFEVGSDGSVK.F	Y	54.55	2255.0845	21	1.6	1128.5513	2	131.62	3	82410	20190523-10-H3.raw	2.95E8	10	10	166	186
R.GGSTGYDNAVALPAGGR.G	N	52.46	1561.7484	17	0.2	781.8817	2	84.73	3	40723	20190523-10-H3.raw	4.39E8	5	5	247	263
K.FC(+57.02)FEPTSFTVKADSVSK.N	N	52.30	1948.9241	17	-0.6	650.6483	3	107.06	3	59986	20190523-10-H3.raw	3.39E7	2	2	135	151	Carbamidomethylation
K.GRGGSTGYDNAVALPAGGR.G	N	48.03	1774.8710	19	0.9	592.6315	3	75.83	3	33239	20190523-10-H3.raw	2.84E7	1	1	245	263
K.QLEASGKPESFSGK.F	Y	48.01	1463.7256	14	1.1	732.8708	2	64.06	3	23616	20190523-10-H3.raw	6.41E8	4	4	216	229
R.GDEEELSKENVK.N	Y	45.21	1375.6466	12	1.7	688.8317	2	60.19	3	20521	20190523-10-H3.raw	7.14E7	4	4	264	275
R.GGSTGYDNAVALPAGGRGDEEELSK.E	Y	45.01	2449.1357	25	-0.3	817.3856	3	88.41	3	43817	20190523-10-H3.raw	3.92E7	1	1	247	271
R.GGSTGYDNAVALPAGGRGDEEELSKENVK.N	Y	43.31	2919.3845	29	1.9	730.8548	4	87.13	3	42718	20190523-10-H3.raw	2.73E8	4	4	247	275
K.GRGGSTGYDNAVALPAGGRGDEEELSKENVK.N	Y	42.97	3132.5071	31	1.6	627.5097	5	81.23	3	37758	20190523-10-H3.raw	9.66E7	2	2	245	275
K.FC(+57.02)FEPTSFTVK.A	N	41.54	1361.6326	11	0.3	681.8237	2	114.24	3	66438	20190523-10-H3.raw	1.07E9	4	4	135	145	Carbamidomethylation
K.GRGGSTGYDNAVALPAGGRGDEEELSK.E	Y	41.20	2662.2583	27	0.6	666.5723	4	81.53	3	38020	20190523-10-H3.raw	1.04E7	1	1	245	271
K.EEDGIDYAAVTVQLPGGERVPFLFTVK.Q	N	40.06	2949.5122	27	3.6	984.1815	3	145.87	3	95601	20190523-10-H3.raw	7.35E6	1	1	189	215
K.TYMEVKGTGTANQC(+57.02)PTIDGGSETFSFK.A	N	39.63	2925.3162	27	-0.6	976.1121	3	103.56	3	56870	20190523-10-H3.raw	4.28E6	1	1	100	126	Carbamidomethylation
K.SKPETGEVIGVFESLQPSDTDLGAKVPKDVK.I	N	38.66	3269.7029	31	0.7	654.9483	5	113.40	3	65678	20190523-10-H3.raw	4.73E7	2	2	291	321
K.NAPPDFQNTK.L	Y	37.84	1130.5356	10	0.9	566.2756	2	64.51	3	23999	20190523-10-H3.raw	3.23E8	5	5	152	161
K.NTAASVGEITLK.I	N	37.69	1202.6506	12	1.6	602.3336	2	86.85	3	42471	20190523-10-H3.raw	1.37E9	5	5	276	287
R.GGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLK.I	Y	37.42	4104.0244	41	3.1	821.8147	5	104.95	3	58123	20190523-10-H3.raw	4.5E7	1	1	247	287
R.VPFLFTVK.Q	N	37.36	949.5637	8	-0.1	475.7891	2	115.45	3	67504	20190523-10-H3.raw	1.33E9	2	2	208	215
K.IQGVWYGQIE	N	35.98	1191.5924	10	0.2	596.8036	2	121.02	3	72611	20190523-10-H3.raw	2.77E8	4	4	322	331
K.RLTYDEIQSK.T	N	34.58	1251.6459	10	0.3	626.8304	2	67.18	3	26202	20190523-10-H3.raw	4.59E8	3	3	90	99
R.LTYDEIQSK.T	N	34.23	1095.5448	9	0.4	548.7799	2	75.60	3	33034	20190523-10-H3.raw	3.71E8	2	2	91	99
R.GSSFLDPK.G	N	28.20	849.4232	8	0.2	425.7190	2	74.35	3	31971	20190523-10-H3.raw	5.32E8	3	3	237	244
V.KGTGTANQC(+57.02)PTIDGGSETFSFK.A	N	27.74	2302.0535	22	0.6	768.3589	3	90.65	3	45686	20190523-10-H3.raw	1.64E5	1	1	105	126	Carbamidomethylation
K.FLVPSYR.G	N	25.65	880.4807	7	0.5	441.2478	2	92.24	3	47041	20190523-10-H3.raw	1.55E9	2	2	230	236
Y.TLDEIEGPFEVGSDGSVK.F	Y	25.15	1877.8894	18	-2.7	939.9495	2	114.70	3	66860	20190523-10-H3.raw	8.91E5	1	1	169	186
K.TYMEVK.G	N	25.06	769.3680	6	-0.1	385.6913	2	62.15	3	22070	20190523-10-H3.raw	4.57E7	1	1	100	105
K.NAPPDFQNTKLMTRLTYTLDEIEGPFEVGSDGSVK.F	Y	23.74	3868.8828	35	1.4	968.2294	4	144.22	3	94116	20190523-10-H3.raw	0	1	1	152	186
K.KFC(+57.02)FEPTSF.T	N	20.32	1161.5165	9	0.3	581.7657	2	110.02	3	62621	20190523-10-H3.raw	1.48E7	1	1	134	142	Carbamidomethylation
total 35 peptides

Peptide	Uniq	-10lgP	Mass	Length	ppm	m/z	z	RT	Fraction	Scan	Source File	Area Sample 3	#Spec	#Spec Sample 3	Start	End	PTM
K.SSGGYNAGLEGLLKPADGVC(+57.02)GC(+57.02)FNK.D	Y	59.70	2570.1892	25	1.2	857.7380	3	114.70	3	66864	20190523-10-H3.raw	6.75E7	3	3	487	511	Carbamidomethylation
K.RQNMLDEIEREFEAATSGLK.E	Y	54.78	2336.1431	20	0.3	585.0432	4	143.08	3	93069	20190523-10-H3.raw	8.81E6	2	2	261	280
K.VGSVLGSSSSVTSTTSESAATSESIESLK.Q	Y	52.69	2787.3508	29	0.2	930.1245	3	106.89	3	59832	20190523-10-H3.raw	9.37E6	3	3	563	591
K.DKDGLQADTDSSINIAEILAEESK.L	Y	51.99	2561.2344	24	0.2	854.7523	3	131.21	3	82038	20190523-10-H3.raw	1.21E7	1	1	512	535
K.QLNLDDFSEGDDSAESAR.R	Y	51.95	1967.8344	18	1.7	984.9261	2	103.31	3	56637	20190523-10-H3.raw	1.92E7	2	2	360	377
K.MLEEIEREFEEATKGLEELR.H	Y	50.70	2450.1997	20	1.8	817.7419	3	148.76	3	98274	20190523-10-H3.raw	2.55E7	2	2	227	246
R.QNMLDEIEREFEAATSGLKELK.I	Y	50.59	2550.2634	22	1.8	851.0966	3	153.13	3	102338	20190523-10-H3.raw	1.25E7	2	2	262	283
R.QNMLDEIEREFEAATSGLK.E	Y	49.93	2180.0420	19	-0.7	727.6874	3	153.64	3	102829	20190523-10-H3.raw	1.26E7	1	1	262	280
K.TDDSAQGLDDEQSAKR.Q	Y	49.40	1734.7656	16	0.7	579.2629	3	59.17	3	19756	20190523-10-H3.raw	5.15E5	1	1	171	186
R.QSMLDEIEREFEAATNSLK.Q	Y	48.83	2210.0525	19	-2.6	1106.0306	2	154.04	3	103205	20190523-10-H3.raw	2.45E7	2	2	341	359
K.TDDSAQGLDDEQSAK.R	Y	48.42	1578.6646	15	1.7	790.3409	2	63.20	3	22925	20190523-10-H3.raw	1.1E7	1	1	171	185
R.NSMLEAIEREFEAATK.G	Y	48.22	1837.8879	16	0.2	613.6367	3	141.66	3	91751	20190523-10-H3.raw	1.14E7	2	2	379	394
K.FTSLTTSLSELLK.E	Y	47.86	1438.7919	13	-0.1	720.4031	2	135.63	3	86151	20190523-10-H3.raw	1.27E8	2	2	715	727
K.VGSVLGSSSSVTSTTSESAATSESIESLKQTLR.K	Y	47.70	3285.6423	33	-0.6	1096.2207	3	113.94	3	66159	20190523-10-H3.raw	3.67E6	1	1	563	595
K.ADDLTGINDEEHAAK.R	Y	47.55	1597.7219	15	0.7	799.8688	2	70.83	3	29117	20190523-10-H3.raw	1.13E7	2	2	209	223
R.EFEAAHAGFEQLK.T	Y	47.45	1475.7045	13	0.1	738.8596	2	87.20	3	42775	20190523-10-H3.raw	2.54E7	3	3	158	170
R.DLVNHPNFDAIIAAGTR.Y	Y	47.34	1822.9325	17	1.2	608.6522	3	117.05	3	68977	20190523-10-H3.raw	4.47E7	3	3	604	620
K.AKDEQAAEEFAVETTK.R	Y	47.34	1765.8369	16	1.1	883.9267	2	81.59	3	38077	20190523-10-H3.raw	2.72E7	3	3	743	758
R.NSMLEAFEREFEAATNAK.A	Y	47.33	2056.9524	18	-1.8	686.6569	3	141.42	3	91524	20190523-10-H3.raw	1.8E7	4	4	450	467
K.GLEELKNESEQAENKR.N	Y	45.64	1872.9177	16	0.0	625.3132	3	72.99	3	30900	20190523-10-H3.raw	6.48E7	4	4	434	449
K.EAGSDGINKVEESKDDEEAARR.H	Y	44.67	2404.1101	22	1.5	481.8300	5	64.88	3	24289	20190523-10-H3.raw	8.43E6	1	1	127	148
K.NPSTISTTVQK.S	Y	44.34	1174.6194	11	1.1	588.3176	2	63.04	3	22792	20190523-10-H3.raw	4.29E7	2	2	476	486
R.QSMLDEIERDFEAATK.G	Y	44.00	1881.8778	16	-1.6	628.2989	3	141.78	3	91862	20190523-10-H3.raw	3.19E7	3	3	187	202
K.GLEELKANDSTGDKDDDEHVAR.R	Y	43.47	2413.0994	22	0.1	483.6272	5	67.96	3	26830	20190523-10-H3.raw	6.98E6	2	2	395	416
K.SSGGYNAGLEGLLKPADGVC(+57.02)GC(+57.02)FNKDKDGLQADTDSSINIAEILAEESKLQGSGTSR.L	Y	43.25	5899.8115	57	3.0	984.3121	6	135.22	3	85770	20190523-10-H3.raw	2.24E7	2	2	487	543	Carbamidomethylation
R.LTTSLNNLVDTHR.K	Y	42.57	1482.7791	13	0.6	742.3972	2	88.84	3	44179	20190523-10-H3.raw	7.26E6	1	1	544	556
K.QLNLDDFSEGDDSAESARR.N	Y	41.96	2123.9355	19	-0.8	708.9852	3	93.36	3	48029	20190523-10-H3.raw	2.71E7	1	1	360	378
K.QLEDIADNKAEGDDESAKR.Q	Y	41.58	2102.9714	19	2.4	526.7514	4	66.06	3	25228	20190523-10-H3.raw	1.82E7	1	1	322	340
K.EASQAYEEYHEAVHK.A	Y	41.12	1789.7906	15	1.3	597.6049	3	67.41	3	26406	20190523-10-H3.raw	1.97E7	4	4	728	742
R.YEVLSSASIGYISLLAK.Y	Y	40.84	1812.9873	17	1.8	907.5026	2	138.16	3	88513	20190523-10-H3.raw	3.75E5	2	2	621	637
K.ADDLTGINDEEHAAKR.Q	Y	40.70	1753.8230	16	0.7	585.6154	3	66.49	3	25596	20190523-10-H3.raw	2.51E6	2	2	209	224
K.EAGSDGINKVEESKDDEEAAR.R	Y	39.34	2248.0090	21	-0.9	563.0090	4	67.08	3	26119	20190523-10-H3.raw	3.44E6	1	1	127	147
K.GLEQLKADDLTGINDEEHAAKR.Q	Y	38.21	2422.2087	22	3.1	606.5613	4	87.30	3	42841	20190523-10-H3.raw	1.08E7	1	1	203	224
R.NSMLEAFER.E	Y	37.02	1095.5018	9	0.4	548.7584	2	100.16	3	53857	20190523-10-H3.raw	3E7	1	1	450	458
K.TVIKEGLEASQR.V	Y	35.82	1329.7252	12	1.6	444.2497	3	66.35	3	25469	20190523-10-H3.raw	4.47E6	1	1	640	651
R.LTTSLNNLVDTHRK.E	Y	35.77	1610.8740	14	3.3	537.9670	3	78.39	3	35313	20190523-10-H3.raw	5.13E7	3	3	544	557
K.RQNMLDEIEREFEAATSGLKELK.I	Y	35.32	2706.3645	23	1.0	542.2807	5	144.21	3	94109	20190523-10-H3.raw	9.45E6	2	2	261	283
K.LEAEKVDVDSK.F	Y	35.02	1231.6295	11	1.9	616.8232	2	61.99	3	21936	20190523-10-H3.raw	3.17E7	3	3	704	714
R.TVDSVFAAAK.T	Y	34.68	1007.5287	10	2.2	504.7727	2	82.64	3	39015	20190523-10-H3.raw	0	1	1	672	681
R.QSMLDEIER.D	Y	33.32	1119.5229	9	1.3	560.7695	2	94.96	3	49403	20190523-10-H3.raw	4.82E7	2	2	187	195
R.QSMLDAIER.E	Y	33.05	1061.5176	9	0.6	531.7664	2	95.40	3	49782	20190523-10-H3.raw	3.76E7	1	1	303	311
R.EFEAATSGLK.E	Y	32.65	1051.5186	10	0.1	526.7666	2	76.09	3	33462	20190523-10-H3.raw	5.13E6	1	1	271	280
R.EFEAATNSLK.Q	Y	32.63	1108.5400	10	1.5	555.2781	2	75.68	3	33103	20190523-10-H3.raw	1.99E7	1	1	350	359
R.QNMLDEIER.E	Y	30.72	1146.5339	9	1.3	574.2750	2	94.68	3	49152	20190523-10-H3.raw	1.63E7	1	1	262	270
R.NSMLEAIER.E	Y	29.74	1061.5176	9	1.2	531.7667	2	92.74	3	47466	20190523-10-H3.raw	3.33E7	2	2	379	387
R.EFEAAHAGFEQLKTDDSAQGLDDEQSAK.R	Y	28.46	3036.3584	28	0.8	760.0975	4	95.17	3	49594	20190523-10-H3.raw	3E5	1	1	158	185
K.DGLQADTDSSINIAEILAEESKLQGSGTSR.L	Y	28.13	3104.5110	30	-1.4	1035.8428	3	137.22	3	87634	20190523-10-H3.raw	5.51E5	1	1	514	543
K.GLEQLKADDLTGINDEEHAAK.R	Y	26.34	2266.1077	21	5.0	756.3803	3	92.69	3	47424	20190523-10-H3.raw	1.6E6	1	1	203	223
K.IMLEAIER.E	Y	26.00	973.5266	8	0.0	487.7706	2	92.66	3	47400	20190523-10-H3.raw	4.59E7	2	2	419	426
K.ANGENSAKNPSTISTTVQK.S	Y	25.40	1945.9705	19	2.0	649.6654	3	62.18	3	22093	20190523-10-H3.raw	1.26E7	1	1	468	486
K.IMLEAIEREFEAATK.G	Y	24.86	1749.8971	15	-1.2	584.3056	3	131.15	3	81978	20190523-10-H3.raw	3.17E6	1	1	419	433
K.INAHTVKDDVDDKEQDAKR.Q	Y	20.11	2196.0771	19	-0.9	367.0198	6	61.88	3	21848	20190523-10-H3.raw	6.56E6	1	1	284	302
total 52 peptides