Antibody binding kinetic constants to selected MPER probes.

2012-07-19T02:07:19Z (GMT) by Javier Guenaga Richard T. Wyatt
a

MPER peptide: EQELLELDKWASLWNWFDITKWLWYIKKKKGSKKK.

b

Linked peptide: EQELLELDKWASLGGGGSGGWNWFDITKWLWYIKKKKGSKKK.

c

ES2 scaffold: scaffold protein displaying the 2F5 gp41 epitope stabilized in the antibody-bound conformation.

d

Association rate (kon) is measured in (1/Ms 105).

e

Dissociation rate (koff) is measured in (1/s 10−3).

f

Affinity constant (KD) is measured in (M 10−9 or nM).